Summary

1. Notes


2. Result Statistics

Figure 1. False discovery rate (FDR) curve. X axis is the number of peptide-spectrum matches (PSM) being kept. Y axis is the corresponding FDR.



Figure 2. PSM score distribution. (a) Distribution of PEAKS peptide score; (b) Scatterplot of PEAKS peptide score versus precursor mass error.

(a)
(b)
Table 1. Statistics of data.
#Scans#FeaturesIdentified#Peptides#Sequences#Proteins*
MS1MS2#PSMs#Scans#FeaturesGroupsAllTop
Total1853818328871232000157141511712117210049201791221690
F11774725804431721511451217585723198132
F101445066767101661102510001057018015978393235
F11149016005985015702688813117215777296195
F12135726594390270277127197830372350106680328
F13178042557843974851840222724823259318130
F2139576300181914746739600415114738198114
F314375669361022628358241055285843214487
F4135557541512037912431194141611051044313296
F51318879299116370183217311449519719263417199
F61339473671113396183817491108525724573455234
F71238678855111633144813701087916115554258133
F813868736561039809108341226915014156309171
F91218477903117974136212841175217716365327169
* proteins with significant peptides are used in counts.

Figure 3. Sample overlap for Proteins and Peptides (up to 8 samples). (a) All Proteins; (b) Top Proteins; (c) Peptides;

(a)
Do not support more than 8 samples
(b)
Do not support more than 8 samples
(c)
Do not support more than 8 samples

Figure 4. Distribution of peptide feature detection. (a) Feature m/z distribution; (b) Feature RT distribution.

(a)
(b)

Figure 5. Distribution of identified peptide features. (a) Feature abundance distribution; (b) De novo sequencing validation.

(a)
(b)
Table 2. Result filtration parameters.
Peptide -10lgP≥41.8
PTM Ascore≥0
Protein -10lgP≥20
Proteins unique peptides≥1
De novo score(%)≥50%
Table 3. Statistics of filtered result.
FDR (Peptide-Spectrum Matches)0.1%
FDR (Peptide Sequences)1.3%
FDR (Protein Group)7.6%
De Novo Only Spectra248152
Table 4. PTM profile.
Name ∆Mass Position #PSM -10lgP Abundance AScore
Carbamidomethyl57.02C9818103.216.19E71000.00
Oxidation15.99M108891.906.56E81000.00

3. Experiment Control

Figure 6. Precursor mass error of peptide-spectrum matches (PSM) in filtered result. (a) Distribution of precursor mass error in ppm; (b) Scatterplot of precursor m/z versus precursor mass error in ppm.

(a)
(b)

Table 5. Number of identified peptides in each sample by the number of missed cleavages.

Missed Cleavages01234+
F1571000
F10138321000
F1113234600
F1229771400
F1321631100
F212327100
F36914200
F47726200
F515044300
F620153300
...

4. Other Information

Table 6. Search parameters.
Search Engine Name: PEAKS
Parent Mass Error Tolerance: 10.0 ppm
Fragment Mass Error Tolerance: 0.6 Da
Precursor Mass Search Type: monoisotopic
Enzyme: Trypsin
Max Missed Cleavages: 2
Digest Mode: Semispecific
Fixed Modifications:
  Carbamidomethylation: 57.02
Variable Modifications:
  Oxidation (M): 15.99
Max Variable PTM Per Peptide: 3
Database: NCBI_Serpentes_NR
Taxon: All
Contaminant Database: cRAP_contaminants
Searched Entry: 410049
FDR Estimation: Enabled
Merge Options: no merge
Precursor Options: corrected
Charge Options: no correction
Filter Charge: 2 - 8
Process: true
Associate chimera: yes
Table 7. Instrument parameters.
Fractions: NaNaKA16_F1.raw, NaNaKA16_F10.raw, NaNaKA16_F11.raw,
NaNaKA16_F12.raw, NaNaKA16_F13.raw, NaNaKA16_F2.raw, NaNaKA1
6_F3.raw, NaNaKA16_F4.raw, NaNaKA16_F5.raw, NaNaKA16_F6.raw,
NaNaKA16_F7.raw, NaNaKA16_F8.raw, NaNaKA16_F9.raw
Ion Source: ESI(nano-spray)
Fragmentation Mode: CID, CAD(y and b ions)
MS Scan Mode: FT-ICR/Orbitrap
MS/MS Scan Mode: FT-ICR/Orbitrap

Protein List

Protein Accession Contains:
Protein Description Contains:
Protein Sample Area >=
Protein PTM Contains:
Protein Group Protein ID Accession -10lgP Coverage (%) Coverage (%) F1Coverage (%) F10Coverage (%) F11Coverage (%) F12Coverage (%) F13Coverage (%) F2Coverage (%) F3Coverage (%) F4Coverage (%) F5Coverage (%) F6Coverage (%) F7Coverage (%) F8Coverage (%) F9 Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Peptides #Unique #Spec F1#Spec F10#Spec F11#Spec F12#Spec F13#Spec F2#Spec F3#Spec F4#Spec F5#Spec F6#Spec F7#Spec F8#Spec F9 PTM Avg. Mass Description
8 20 2GIZ 363.58 74 0819743600060708 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 24954 Chain B, Structural And Functional Analysis Of Natrin, A Member Of Crisp-3 Family Blocks A Variety Of Ion Channels
8 21 1XX5 363.58 74 0819743600060708 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 24954 Chain C, Natrin 1
8 22 3MZ8 363.58 74 0819743600060708 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 24954 Chain B, Crystal Structure Of Zinc-Bound Natrin From Naja Atra
8 23 Q7T1K6.1 363.58 68 0818683300060608 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 26882 RecName: Full=Cysteine-rich venom protein natrin-1; AltName: Full=Cysteine-rich venom protein 1; AltName: Full=NA-CRVP1; AltName: Full=Protein G2a; Flags: Precursor
8 24 AAP85301.1 363.58 68 0818683300060608 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 26882 natrin [Naja atra]
8 25 ACH73167.1 363.58 68 0818683300060608 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 26846 kaouthin-1 precursor [Naja kaouthia]
8 26 P84805.2 363.58 68 0818683300060608 5.4573E64.0163E74.8621E103.33E77.9009E61.8333E50 50 35 021316633700040101 Y 26846 RecName: Full=Cysteine-rich venom protein kaouthin-1; AltName: Full=Cysteine-rich venom protein 25; Short=CRVP-25k; Flags: Precursor
42 1 AVX27607.1 357.18 40 0232333297044501910 3.4205E71.3232E68.2977E76.7734E73.7271E78.2584E53.3503E69.9673E62.2165E7 34 12 059351128215073201428 Y 57963 L-amino acid oxidase, partial [Naja atra]
42 2 5Z2G 357.18 40 0232333297044501910 3.4205E71.3232E68.2977E76.7734E73.7271E78.2584E53.3503E69.9673E62.2165E7 34 12 059351128215073201428 Y 57963 Chain B, L-amino acid oxidase
42 3 A8QL58.2 357.18 40 0232333297044501910 3.4205E71.3232E68.2977E76.7734E73.7271E78.2584E53.3503E69.9673E62.2165E7 34 12 059351128215073201428 Y 57963 RecName: Full=L-amino-acid oxidase; Short=LAO; Short=NA-LAAO; Flags: Precursor
1 80 CAA45372.1 346.63 88 048374848120194883888859 6.9673E71.4844E7 45 1 03622381020329391953388448 Y 13477 phospholipase a2 [Naja naja]
1 82 1A3F 346.63 89 049374949120194984898960 6.9673E71.4844E7 45 1 03622381020329391953388448 Y 13346 Chain C, Phospholipase A2 (Pla2) From Naja Naja Venom
1 83 1A3D 346.63 89 049374949120194984898960 6.9673E71.4844E7 45 1 03622381020329391953388448 Y 13346 Chain A, Phospholipase A2
1 84 P15445.1 346.63 89 049374949120194984898960 6.9673E71.4844E7 45 1 03622381020329391953388448 Y 13346 RecName: Full=Acidic phospholipase A2 2; Short=PLA22; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase
1 85 1PSH 346.63 89 049374949120194984898960 6.9673E71.4844E7 45 1 03622381020329391953388448 Y 13346 Chain C, Phospholipase A2
2 221 1YI5 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain J, Long Neurotoxin 1
2 222 4AEA 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain B, Long Neurotoxin 1
2 223 1CTX 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain A, ALPHA-COBRATOXIN
2 224 2CTX 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain A, ALPHA-COBRATOXIN
2 225 P01391.1 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 RecName: Full=Alpha-cobratoxin; Short=Alpha-CbT; Short=alpha-CT; Short=alpha-Cbtx; AltName: Full=Alpha-elapitoxin-Nk2a; Short=Alpha-EPTX-Nk2a; AltName: Full=Long neurotoxin 1; AltName: Full=Siamensis 3
2 226 1LXH 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain A, LONG NEUROTOXIN 1
2 227 1LXG 343.47 97 21424259595982809761614161 9.1527E61.686E87.9452E77.513E76.0306E65.5153E83.8575E106.2435E106.7316E103.819E98.6239E72.6489E73.5673E8 31 13 1218141685249658575019812732 Y 7831 Chain A, Long neurotoxin 1
37 297 AAS94269.1 329.03 42 03724365505842362940 2.1402E62.8298E61.9319E97.0917E5 24 3 06091317022379121376 Y 27030 nerve growth factor II [Naja sputatrix]
37 298 Q5YF89.1 329.03 42 03724365505842362940 2.1402E62.8298E61.9319E97.0917E5 24 3 06091317022379121376 Y 27030 RecName: Full=Venom nerve growth factor 2; Short=v-NGF-2; Short=vNGF-2; AltName: Full=Nerve growth factor II; Flags: Precursor
45 8 Q9PVK7.1 315.79 40 0448300028168126 7.7381E69.8751E51.0165E69.4121E71.432E79.6223E72.2471E7 29 8 042619300124515166 Y 67662 RecName: Full=Zinc metalloproteinase-disintegrin-like cobrin; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
45 9 AAF00693.1 315.79 40 0448300028168126 7.7381E69.8751E51.0165E69.4121E71.432E79.6223E72.2471E7 29 8 042619300124515166 Y 67662 cobrin precursor [Naja naja]
59 31 XP_026544671.1 312.39 28 0108195000081277 2.0337E68.9589E5 21 2 051112830000161874 Y 60656 tissue-type plasminogen activator, partial [Notechis scutatus]
54 60 ACH73168.1 307.72 61 0385656000000000 1.217E81.2833E91.2554E8 24 7 01717441000000000 Y 26216 kaouthin-2 precursor [Naja kaouthia]
54 61 P84808.2 307.72 61 0385656000000000 1.217E81.2833E91.2554E8 24 7 01717441000000000 Y 26216 RecName: Full=Cysteine-rich venom protein kaouthin-2; AltName: Full=Cysteine-rich venom protein 23; Short=CRVP-23k; Flags: Precursor
54 62 AHZ08822.1 307.72 61 0385656000000000 1.217E81.2833E91.2554E8 24 7 01717441000000000 Y 26216 cysteine-rich secretory protein [Micropechis ikaheca]
55 75 XP_034291085.1 303.83 23 0111018200005599 01.4032E64.1585E8 21 2 081515320000131485 Y 63129 tissue-type plasminogen activator [Pantherophis guttatus]
55 76 XP_034291087.1 303.83 23 0111018200005599 01.4032E64.1585E8 21 2 081515320000131485 Y 63129 tissue-type plasminogen activator [Pantherophis guttatus]
55 77 XP_034291086.1 303.83 23 0111018200005599 01.4032E64.1585E8 21 2 081515320000131485 Y 63129 tissue-type plasminogen activator [Pantherophis guttatus]
75 13 3PRX 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 Chain D, Cobra Venom Factor
75 14 3PVM 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 Chain D, Cobra Venom Factor
75 15 Q91132.1 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 RecName: Full=Cobra venom factor; Short=CVF; Short=CVFk; AltName: Full=Complement C3 homolog; Contains: RecName: Full=Cobra venom factor alpha chain; Contains: RecName: Full=Cobra venom factor gamma chain; Contains: RecName: Full=C...
75 16 AAA68989.1 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 cobra venom factor precursor [Naja kaouthia]
75 17 CAI46845.1 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 unnamed protein product [Naja naja]
75 18 6I2X 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 Chain B, Cobra venom factor
75 19 I51018 299.72 23 011101900010021 2.2798E76.2039E71.0651E8 33 22 061266200070021 Y 184517 cobra venom factor precursor - monocled cobra
47 11 ACN50006.1 298.91 30 0024250021316552 0 23 1 00122360012920381 Y 69181 atragin precursor, partial [Naja atra]
47 12 D3TTC2.1 298.91 30 0024250021316552 0 23 1 00122360012920381 Y 69181 RecName: Full=Zinc metalloproteinase-disintegrin-like atragin; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
72 35 P82942.1 287.12 29 01610221600311151108 5.9195E68.1916E62.1966E75.7977E63.4085E82.8519E95.3659E77.1814E6 18 12 06817110011253303 Y 44493 RecName: Full=Hemorrhagic metalloproteinase-disintegrin-like kaouthiagin; AltName: Full=Snake venom metalloproteinase; Short=SVMP
4 380 764177A 280.64 93 0143347494993676749343334 0 17 1 07916146743470169121111719 Y 7706 toxin B
5 362 P25668.1 279.47 93 0283232344893939375343248 5.247E65.4239E68.3364E92.3424E101.7299E105.9718E82.0334E7 16 2 0991595243364870120111720 Y 7847 RecName: Full=Long neurotoxin 1; AltName: Full=Toxin A
11 530 P25672.1 278.66 93 0141432324489939373321432 1.1563E79.3448E74.4981E91.1598E102.9335E8 16 3 077116333324095201746316 Y 7889 RecName: Full=Long neurotoxin 4; AltName: Full=Toxin D
18 241 PSNJ3K 273.63 55 029181919120192951544250 5.6525E65.4823E7 17 2 0161226620320283369159177 Y 13271 phospholipase A2 (EC 3.1.1.4) III - monocled cobra
17 258 0508173A 272.58 76 029181919120192949565367 2.1553E71.4856E7 20 4 0161226620320282367162183 Y 13229 phospholipase A2 E3
17 259 P25498.1 272.58 76 029181919120192949565367 2.1553E71.4856E7 20 4 0161226620320282367162183 Y 13229 RecName: Full=Acidic phospholipase A2 E; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase
70 532 P82464.1 267.53 86 03131000003186865757 8.0424E63.6818E61.5657E74.073E87.6493E91.0533E85.0925E7 17 14 011000004368086 Y 7624 RecName: Full=Muscarinic toxin-like protein 3; Short=MTLP-3
38 365 1T37 262.02 42 018101800001040424218 3.6037E73.3667E73.4246E92.7128E108.3689E91.506E10 13 8 013370000212715188120 Y 13162 Chain A, Phospholipase A2 Isoform 3
38 366 1ZM6 262.02 42 018101800001040424218 3.6037E73.3667E73.4246E92.7128E108.3689E91.506E10 13 8 013370000212715188120 Y 13162 Chain A, Phospholipase A2 Isoform 3
71 64 XP_029140080.1 253.06 19 0861230000101236 1.2319E61.3702E69.6234E62.3912E77.3676E61.527E6 12 1 0567410000191964 Y 62665 tissue-type plasminogen activator [Protobothrops mucrosquamatus]
71 70 JAI11009.1 253.06 20 0971330000111346 1.2319E61.3702E69.6234E62.3912E77.3676E61.527E6 12 1 0567410000191964 Y 59716 tissue-type plasminogen activator [Crotalus adamanteus]
82 36 ADG02948.1 252.64 18 044124442411002 1.7705E61.4324E66.6603E63.9675E65.5621E55.6803E71.7191E8 13 3 037146211525002 Y 66246 metalloproteinase atrase B [Naja atra]
82 37 D6PXE8.1 252.64 18 044124442411002 1.7705E61.4324E66.6603E63.9675E65.5621E55.6803E71.7191E8 13 3 037146211525002 Y 66246 RecName: Full=Zinc metalloproteinase-disintegrin-like atrase-B; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
82 39 ACN50005.1 252.64 18 044124442411002 1.7705E61.4324E66.6603E63.9675E65.5621E55.6803E71.7191E8 13 3 037146211525002 Y 66292 K-like metalloprotease precursor, partial [Naja atra]
82 40 D3TTC1.1 252.64 18 044124442411002 1.7705E61.4324E66.6603E63.9675E65.5621E55.6803E71.7191E8 13 3 037146211525002 Y 66292 RecName: Full=Zinc metalloproteinase-disintegrin-like kaouthiagin-like; Short=K-like; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
35 590 P60044.1 242.58 42 0212111110002130423128 01.489E6 16 1 0955100079224517379 Y 14073 RecName: Full=Acidic phospholipase A2 2; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
35 591 AAR00254.1 242.58 42 0212111110002130423128 01.489E6 16 1 0955100079224517379 Y 14073 phospholipase A2 isoform 2 precursor, partial [Naja sagittifera]
35 619 1XXW 242.58 45 0222212120002232453329 01.489E6 16 1 0955100079224517379 Y 13277 Chain B, Phospholipase A2 Isoform 2
35 620 1S6B 242.58 45 0222212120002232453329 01.489E6 16 1 0955100079224517379 Y 13277 Chain B, Phospholipase A2 isoform 2
35 621 2RD4 242.58 45 0222212120002232453329 01.489E6 16 1 0955100079224517379 Y 13277 Chain B, Phospholipase A2 isoform 2
69 3267 JAA75025.1 240.27 13 013131300001313131313 5.8775E62.4285E62.4039E61.2439E78.2398E92.1904E77.7818E66.0445E7 9 6 02110000111233511 Y 16595 PLA2-Sut-8 [Suta fasciata]
67 635 ABN72541.1 239.75 16 00916500000000 4.1304E6 8 1 003143200000000 Y 31137 putative serine protease, partial [Naja atra]
67 636 ABN72545.1 239.75 16 00916500000000 4.1304E6 8 1 003143200000000 Y 31010 putative serine protease, partial [Bungarus multicinctus]
67 637 A8QL57.1 239.75 16 00916500000000 4.1304E6 8 1 003143200000000 Y 31010 RecName: Full=Snake venom serine protease BmSP; Short=SVSP; Flags: Precursor
67 638 A8QL53.1 239.75 16 00916500000000 4.1304E6 8 1 003143200000000 Y 31137 RecName: Full=Snake venom serine protease NaSP; Short=SVSP; Flags: Precursor
68 625 XP_026522175.1 235.43 21 00821500000000 1.7578E6 8 1 003140200000000 Y 31530 snake venom serine protease NaSP isoform X1 [Notechis scutatus]
68 650 XP_026522176.1 235.43 23 00923500000000 1.7578E6 8 1 003140200000000 Y 28988 serine protease harobin isoform X2 [Notechis scutatus]
68 679 XP_026522177.1 235.43 23 00923500000000 1.7578E6 8 1 003140200000000 Y 28056 serine protease harobin isoform X3 [Notechis scutatus]
58 889 P82463.1 234.15 77 0292912000297742422929 6.3064E62.4346E63.3475E52.938E61.9251E101.7838E86.0421E62.3887E61.6324E7 8 8 0212000219321312 Y 7298 RecName: Full=Muscarinic toxin-like protein 2; Short=MTLP-2
52 732 P25674.1 225.14 44 18001818374238383718018 4.6388E6 9 1 6002212315714723201 Y 7821 RecName: Full=Long neurotoxin 1; AltName: Full=Toxin CM-5
90 242 P0DI91.1 221.40 81 036225535120017220034 1.0135E62.4269E72.7322E61.8088E67.453E5 11 4 045192430013004 Y 11216 RecName: Full=L-amino-acid oxidase; Short=LAAO; Short=LAO
23 384 P86540.2 220.16 88 035132301213126283886735 5.2696E61.1409E6 10 2 02110112242935163 Y 6793 RecName: Full=Cytotoxin 8; Short=CTX8
34 164 P01440.1 219.97 97 1383789213131303368489345 9.2923E53.3882E61.4076E6 12 2 216717921411032292019 Y 6763 RecName: Full=Cytotoxin 2; AltName: Full=Cobramine-B; AltName: Full=Cytotoxin II
118 29 5H7W 218.28 26 00272200002044 2.7183E67.2729E6 11 3 00142300002015 Y 58198 Chain B, venom 5'-nucleotidase
118 30 A0A2I4HXH5.1 218.28 26 00272200002044 2.7183E67.2729E6 11 3 00142300002015 Y 58198 RecName: Full=Snake venom 5'-nucleotidase; Short=5'-NT; AltName: Full=Ecto-5'-nucleotidase; Flags: Precursor
94 1329 P19859.1 216.61 63 00000018396139403939 3.3057E74.0485E78.3572E87.8424E62.9747E71.4564E78.7373E6 12 11 00000035351423 Y 6508 RecName: Full=Kunitz-type serine protease inhibitor; AltName: Full=Venom chymotrypsin inhibitor
94 1330 1702215A 216.61 63 00000018396139403939 3.3057E74.0485E78.3572E87.8424E62.9747E71.4564E78.7373E6 12 11 00000035351423 Y 6508 chymotrypsin inhibitor
93 198 ETE68810.1 214.67 32 08819281446613855 3.7961E62.8507E74.393E72.4421E63.064E64.1372E6 10 3 075717151114443 Y 29588 Glutathione peroxidase 3, partial [Ophiophagus hannah]
136 34 XP_026570202.1 213.47 10 0338000011000 2.6745E62.8881E67.1049E67.4916E65.7591E6 11 11 06610000041000 Y 133145 Golgi apparatus protein 1 [Pseudonaja textilis]
64 192 Q9W6W9.1 212.61 72 0465237001001052265330 3.5601E5 10 1 01637120010162125 Y 9099 RecName: Full=Cytotoxin 4N; AltName: Full=Cardiotoxin-4N; Short=CTX-4N; Flags: Precursor
64 193 CAB42057.1 212.61 72 0465237001001052265330 3.5601E5 10 1 01637120010162125 Y 9099 cardiotoxin-4N [Naja atra]
100 730 P82885.1 202.60 56 16483256000037320013 4.4967E54.6854E81.1686E77.7052E67.2249E63.4117E65.3893E5 6 6 23035000042001 Y 12038 RecName: Full=Thaicobrin
91 533 P01427.1 200.03 80 59000080431800000 5.1027E76.0969E89.2136E68.5404E4 8 8 90000494100000 Y 6885 RecName: Full=Short neurotoxin 1; AltName: Full=Neurotoxin II; Short=NT II; Short=NTII; Short=NTX II; AltName: Full=Neurotoxin alpha
91 534 1NOR 200.03 80 59000080431800000 5.1027E76.0969E89.2136E68.5404E4 8 8 90000494100000 Y 6885 Chain A, NEUROTOXIN II
91 535 2MJ4 200.03 80 59000080431800000 5.1027E76.0969E89.2136E68.5404E4 8 8 90000494100000 Y 6885 Chain A, Short neurotoxin 1
124 63 JAG67188.1 198.32 19 00261600000033 1.1341E6 9 1 00141900000015 Y 64759 Snake venom 5'-nucleotidase [Boiga irregularis]
108 995 APB88857.1 198.14 42 0000000001903642 6.8846E71.6894E71.3327E8 10 8 00000000070821 Y 9695 neurotoxin-like protein [Naja naja]
108 996 CAB45156.1 198.14 42 0000000001903642 6.8846E71.6894E71.3327E8 10 8 00000000070821 Y 9695 neurotoxin-like protein [Naja atra]
108 997 Q9W717.1 198.14 42 0000000001903642 6.8846E71.6894E71.3327E8 10 8 00000000070821 Y 9695 RecName: Full=Neurotoxin-like protein NTL2; Flags: Precursor
36 388 AAB25732.1 192.05 80 04848352201301358357745 6.926E61.1895E71.0889E86.0589E6 9 3 036525111001017347133 Y 6701 cardiotoxin isoform 1, cytotoxin isoform 1, CTX-1 [Naja naja=Formosan cobra, ssp. atra, venom, Peptide, 60 aa]
155 295 XP_026575983.1 190.28 19 05410300000330 6.3277E51.2185E54.4202E71.333E51.7428E63.131E6 8 7 01111100000110 N 37973 cathepsin S [Pseudonaja textilis]
155 296 XP_026575982.1 190.28 19 05410300000330 6.3277E51.2185E54.4202E71.333E51.7428E63.131E6 8 7 01111100000110 N 37973 cathepsin S [Pseudonaja textilis]
99 461 4GFY 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 462 1SV9 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2
99 463 3G8F 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 464 1TK4 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 465 2QVD 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 466 4EIX 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 467 3H1X 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Simultaneous Inhibition Of Anti-Coagulation And Inflammation: Crystal Structure Of Phospholipase A2 Complexed With Indomethacin At 1.4 A Resolution Reveals The Presence Of The New Common Ligand Binding Site
99 468 2B17 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Specific Binding Of Non-Steroidal Anti-Inflammatory Drugs (Nsaids) To Phospholipase A2: Crystal Structure Of The Complex Formed Between Phospholipase A2 And Diclofenac At 2.7 A Resolution:
99 469 2ARM 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 470 1TG4 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2
99 471 1SQZ 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2
99 472 3FG5 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Crystal Structure Determination Of A Ternary Complex Of Phospholipase A2 With A Pentapetide Flsyk And Ajmaline At 2.5 A Resolution
99 473 1ZWP 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 474 2QU9 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 475 1Y38 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain B, Phospholipase A2 Vrv-pl-viiia
99 476 4GLD 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 477 4FGA 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 478 1ZR8 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 479 1TP2 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain B, Phospholipase A2 Vrv-pl-viiia
99 480 1Q7A 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 481 1TH6 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2
99 482 4HMB 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 483 3CBI 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain D, Crystal Structure Of The Ternary Complex Of Phospholipase A2 With Ajmaline And Anisic Acid At 3.1 A Resolution
99 484 P59071.1 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 RecName: Full=Basic phospholipase A2 VRV-PL-VIIIa; Short=svPLA2; AltName: Full=DPLA2; AltName: Full=P1; AltName: Full=Phosphatidylcholine 2-acylhydrolase; AltName: Full=Phospholipase A2 4; Short=PLA24
99 485 2QUE 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Phospholipase A2 Vrv-pl-viiia
99 486 3FO7 188.94 39 08839000008000 9.8858E7 4 2 02134000001000 Y 13611 Chain A, Simultaneous Inhibition Of Anti-Coagulation And Inflammation: Crystal Structure Of Phospholipase A2 Complexed With Indomethacin At 1.4 A Resolution Reveals The Presence Of The New Common Ligand Binding Site
99 487 AAZ53186.1 188.94 34 07734000007000 9.8858E7 4 2 02134000001000 Y 15353 phospholipase A2 [Daboia russelii limitis]
99 488 AAZ53179.1 188.94 34 07734000007000 9.8858E7 4 2 02134000001000 Y 15381 phospholipase A2 [Daboia siamensis]
152 72 5GZ4 188.79 7 0000602220000 3.0397E6 6 2 0000902410000 Y 94616 Chain A, Snake Venom Phosphodiesterase (pde)
152 73 A0A2D0TC04.1 188.79 7 0000602220000 3.0397E6 6 2 0000902410000 Y 94616 RecName: Full=Venom phosphodiesterase; Short=PDE
152 74 5GZ5 188.79 7 0000602220000 3.0397E6 6 2 0000902410000 Y 94616 Chain A, Snake Venom Phosphodiesterase (pde)
97 201 XP_026541908.1 188.16 33 0881929940618855 1.2069E63.3174E61.1691E73.9836E6 8 1 07571351024443 Y 28574 glutathione peroxidase 3 isoform X1 [Notechis scutatus]
53 1278 P20229.1 183.03 44 160000441919190000 4.9737E52.0038E106.6671E61.2942E57.7812E4 9 9 300002375110000 Y 6371 RecName: Full=Kunitz-type serine protease inhibitor; AltName: Full=Venom trypsin inhibitor
120 674 XP_034258146.1 179.54 21 055111744409555 6.8309E51.2476E5 6 2 0424931102243 Y 28406 glutathione peroxidase 3 [Pantherophis guttatus]
87 567 1UG4 176.50 57 0275723001301327133723 2.358E6 6 1 08313001012142 Y 6689 Chain A, Crystal Structure Of Cardiotoxin Vi From Taiwan Cobra (Naja Atra) Venom
87 568 ADN67586.1 176.50 55 0265523001301326133523 2.358E6 6 1 08313001012142 Y 6953 three-finger toxin precursor, partial [Naja atra]
87 569 2207174C 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8952 cardiotoxin:ISOTYPE=N
87 570 CAB42058.1 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8980 cardiotoxin-N [Naja atra]
87 571 AAB86638.1 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8980 cardiotoxin N [Naja atra]
87 572 CAA07687.1 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8980 cardiotoxin 6 [Naja atra]
87 573 P80245.2 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8980 RecName: Full=Cytotoxin 6; AltName: Full=Cardiotoxin 6; Short=CTX6; AltName: Full=Cardiotoxin A6; Short=CTX A6; AltName: Full=Cardiotoxin N; Short=CTXN; Short=Ctx-N; AltName: Full=Cytotoxin N; Flags: Precursor
87 574 CAA90966.1 176.50 42 0204217001001020102717 2.358E6 6 1 08313001012142 Y 8952 cardiotoxin N [Naja naja]
87 575 CAA69977.1 176.50 41 0204117001001020102717 2.358E6 6 1 08313001012142 Y 9201 cardiotoxin 6 [Naja atra]
87 576 Q98965.1 176.50 41 0204117001001020102717 2.358E6 6 1 08313001012142 Y 9201 RecName: Full=Cytotoxin 6; AltName: Full=Cardiotoxin-6; Short=CTX6; Flags: Precursor
151 86 CAA55333.1 173.37 14 0106800000000 3.4219E64.3738E6 8 6 01010700000000 Y 69799 cobra serum albumin [Naja naja]
151 87 S59517 173.37 14 0106800000000 3.4219E64.3738E6 8 6 01010700000000 Y 69799 serum albumin precursor - monocled cobra
161 232 JAS05092.1 169.48 13 0002600205000 2.1613E7 6 1 00011000103000 Y 68997 Metalloproteinase type III 2 [Micrurus tener]
85 911 P49122.1 168.10 41 03030100000010101021 3.8675E64.1549E7 4 1 061050000032824 Y 9086 RecName: Full=Cytotoxin 7; AltName: Full=Cardiotoxin-7; Short=CTX7; Short=Ctx-7; AltName: Full=Cardiotoxin-like basic protein 2; Short=CLBP2; Flags: Precursor
85 912 CAA77017.1 168.10 41 03030100000010101021 3.8675E64.1549E7 4 1 061050000032824 Y 9086 cardiotoxin 7 precursor [Naja atra]
85 913 CAA90967.1 168.10 41 03030100000010101021 3.8675E64.1549E7 4 1 061050000032824 Y 9086 cardiotoxin 7 [Naja naja]
138 111 XP_026581281.1 167.08 12 0466500000003 1.5157E62.4175E62.4449E62.3712E6 6 2 04231100000001 Y 67027 acetylcholinesterase, partial [Pseudonaja textilis]
172 187 XP_026561288.1 165.55 7 0000302420000 6.225E6 5 1 0000202510000 Y 96749 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X4 [Pseudonaja textilis]
172 188 XP_026561287.1 165.55 7 0000302420000 6.225E6 5 1 0000202510000 Y 96734 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X3 [Pseudonaja textilis]
172 189 XP_026561289.1 165.55 7 0000302420000 6.225E6 5 1 0000202510000 Y 96775 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X5 [Pseudonaja textilis]
172 190 XP_026561284.1 165.55 7 0000302420000 6.225E6 5 1 0000202510000 Y 100812 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X1 [Pseudonaja textilis]
172 191 XP_026561286.1 165.55 7 0000302420000 6.225E6 5 1 0000202510000 Y 100853 ectonucleotide pyrophosphatase/phosphodiesterase family member 3 isoform X2 [Pseudonaja textilis]
96 1642 AJB84504.1 164.86 6 0056500000000 8.0725E6 4 1 00243200000000 Y 28572 serine protease precursor [Philodryas chamissonis]
145 202 4QWW 160.76 12 0322600000003 1.1881E7 6 2 02121500000001 Y 60267 Chain B, Acetylcholinesterase
145 203 AAC59905.1 160.76 11 0322600000003 1.1881E7 6 2 02121500000001 Y 64723 acetylcholinesterase [Bungarus fasciatus]
40 947 P00600.1 157.57 20 08888008818181810 3.7449E87.0956E75.0959E72.0327E63.4961E51.7447E81.5647E103.8482E93.7982E91.0131E11 5 2 0955100161005528260 Y 13427 RecName: Full=Acidic phospholipase A2 DE-II; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase
40 950 P00601.1 157.57 20 08888008818181810 3.7449E87.0956E75.0959E72.0327E63.4961E51.7447E81.5647E103.8482E93.7982E91.0131E11 5 2 0955100161005528260 Y 13360 RecName: Full=Acidic phospholipase A2 DE-III; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase
46 1010 XP_013911763.1 152.33 6 0056500000000 1.1323E7 3 1 003302300000000 Y 27138 PREDICTED: cysteine-rich venom protein TEL1-like [Thamnophis sirtalis]
46 1014 XP_032069584.1 152.33 6 0056500000000 1.1323E7 3 1 003302300000000 Y 27051 cysteine-rich venom protein TEL1-like [Thamnophis elegans]
171 927 XP_026579406.1 152.12 15 000000001415000 5.9383E71.1749E8 3 3 00000000310000 Y 22428 BPTI/Kunitz domain-containing protein-like isoform X3 [Pseudonaja textilis]
171 928 XP_026579408.1 152.12 15 000000001415000 5.9383E71.1749E8 3 3 00000000310000 Y 22376 BPTI/Kunitz domain-containing protein-like isoform X1 [Pseudonaja textilis]
171 929 XP_026579405.1 152.12 15 000000001415000 5.9383E71.1749E8 3 3 00000000310000 Y 22372 BPTI/Kunitz domain-containing protein-like isoform X2 [Pseudonaja textilis]
171 930 XP_026579404.1 152.12 15 000000001415000 5.9383E71.1749E8 3 3 00000000310000 Y 22376 BPTI/Kunitz domain-containing protein-like isoform X1 [Pseudonaja textilis]
171 931 XP_026579409.1 152.12 15 000000001415000 5.9383E71.1749E8 3 3 00000000310000 Y 22372 BPTI/Kunitz domain-containing protein-like isoform X2 [Pseudonaja textilis]
185 1331 2M99 151.33 54 0000000335403300 7.3152E51.395E84.2021E5 4 3 0000000170100 Y 6391 Chain A, Protease inhibitor NACI
185 1332 CAE51866.1 151.33 38 0000000233802300 7.3152E51.395E84.2021E5 4 3 0000000170100 Y 8815 chymotrypsin inhibitor [Naja atra]
185 1333 Q5ZPJ7.1 151.33 38 0000000233802300 7.3152E51.395E84.2021E5 4 3 0000000170100 Y 8815 RecName: Full=Kunitz-type serine protease inhibitor NACI; AltName: Full=Naja atra chymotrypsin inhibitor; Short=ACI; Short=NA-CI; Flags: Precursor
185 1334 CAE51867.1 151.33 38 0000000233802300 7.3152E51.395E84.2021E5 4 3 0000000170100 Y 8815 chymotrypsin inhibitor precursor [Naja atra]
162 398 JAB52939.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47564 vascular endothelial growth factor C [Micrurus fulvius]
162 399 JAI08988.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47564 Vascular endothelial growth factor 2 [Micrurus fulvius]
162 400 JAI09156.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47564 Vascular endothelial growth factor C-like protein [Micrurus fulvius]
162 401 JAS04977.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47564 Vascular endothelial growth factor 2 [Micrurus fulvius]
162 402 JAC95037.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47507 Vascular endothelial growth factor C [Pantherophis guttatus]
162 403 XP_034298588.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47507 vascular endothelial growth factor C isoform X1 [Pantherophis guttatus]
162 404 XP_026522979.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47528 vascular endothelial growth factor C [Notechis scutatus]
162 405 ETE60014.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47557 Vascular endothelial growth factor C [Ophiophagus hannah]
162 406 XP_026555459.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47615 vascular endothelial growth factor C [Pseudonaja textilis]
162 407 LAA17506.1 148.24 11 0300073000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 53369 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
162 408 LAB17921.1 148.24 11 0300073000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 53456 hypothetical protein, partial [Micrurus spixii]
162 409 XP_034298590.1 148.24 15 0400095000044 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 40062 vascular endothelial growth factor C isoform X3 [Pantherophis guttatus]
162 410 XP_034298589.1 148.24 14 0400094000044 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 42840 vascular endothelial growth factor C isoform X2 [Pantherophis guttatus]
162 411 JAC96561.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47649 Vascular endothelial growth factor C [Echis coloratus]
162 412 XP_029139565.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47709 vascular endothelial growth factor C [Protobothrops mucrosquamatus]
162 413 JAI10614.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47697 Vascular endothelial growth factor C-like protein [Crotalus adamanteus]
162 414 JAV48556.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47653 Vascular endothelial growth factor C-like protein [Agkistrodon contortrix contortrix]
162 415 XP_013912093.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47484 PREDICTED: vascular endothelial growth factor C [Thamnophis sirtalis]
162 417 JAC94973.1 148.24 15 0400095000044 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 40057 Vascular endothelial growth factor C [Opheodrys aestivus]
162 418 SMD28268.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47611 vascular endothelial growth factor CdtVEGF3 [Crotalus durissus terrificus]
162 419 JAA95033.1 148.24 13 0300084000033 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 47639 Vascular endothelial growth factor C-like protein [Crotalus horridus]
162 443 LAB17920.1 148.24 18 05000116000055 9.1753E62.7328E61.4164E51.5718E62.8923E6 5 5 0500051000021 Y 32584 hypothetical protein [Micrurus spixii]
189 639 XP_026575343.1 146.67 5 0005000000000 5.649E6 3 3 0006000000000 N 97316 peptidyl-glycine alpha-amidating monooxygenase isoform X3 [Pseudonaja textilis]
189 640 XP_026575334.1 146.67 5 0005000000000 5.649E6 3 3 0006000000000 N 109505 peptidyl-glycine alpha-amidating monooxygenase isoform X2 [Pseudonaja textilis]
189 641 XP_026575314.1 146.67 5 0005000000000 5.649E6 3 3 0006000000000 N 109576 peptidyl-glycine alpha-amidating monooxygenase isoform X1 [Pseudonaja textilis]
189 642 XP_026575325.1 146.67 5 0005000000000 5.649E6 3 3 0006000000000 N 109576 peptidyl-glycine alpha-amidating monooxygenase isoform X1 [Pseudonaja textilis]
189 643 XP_026575319.1 146.67 5 0005000000000 5.649E6 3 3 0006000000000 N 109576 peptidyl-glycine alpha-amidating monooxygenase isoform X1 [Pseudonaja textilis]
122 437 XP_026570451.1 145.89 7 0002530233222 1.4999E6 4 2 0003640136121 N 62685 keratin, type II cytoskeletal 5-like [Pseudonaja textilis]
150 357 AAM51550.1 143.55 8 0202600004222 3.8745E6 4 2 0102900004122 Y 68176 mocarhagin 1 [Naja mossambica]
150 358 Q10749.3 143.55 8 0202600004222 3.8745E6 4 2 0102900004122 Y 68176 RecName: Full=Snake venom metalloproteinase-disintegrin-like mocarhagin; Short=MOC; Short=Mocarhagin-1; Short=SVMP; AltName: Full=Zinc metalloproteinase mocarhagin; Flags: Precursor
193 624 P18964.1 143.53 28 00628000000000 3.2408E51.5397E7 4 4 0019000000000 Y 26182 RecName: Full=Factor V activator RVV-V alpha; AltName: Full=Russel's viper venom FV activator alpha; Short=RVV-V alpha; AltName: Full=Snake venom serine protease; Short=SVSP
193 654 P18965.2 143.53 25 00525000000000 3.2408E51.5397E7 4 4 0019000000000 Y 28823 RecName: Full=Factor V activator RVV-V gamma; AltName: Full=Russel's viper venom FV activator gamma; Short=RVV-V gamma; AltName: Full=Snake venom serine protease; Short=SVSP; Flags: Precursor
193 673 ADP88558.1 143.53 25 00525000000000 3.2408E51.5397E7 4 4 0019000000000 Y 28814 RVV-V gamma-like protein precursor [Daboia siamensis]
148 390 LAA86163.1 141.65 8 0000022226000 1.6308E71.6776E62.4729E59.5826E61.3887E7 4 4 0000055244000 Y 67294 hypothetical protein [Micrurus lemniscatus lemniscatus]
111 2144 JAA75028.1 141.41 14 00000000014880 7.4633E6 4 1 000000000222610 Y 16452 PLA2-Sut-1 [Suta fasciata]
191 439 AAZ39880.1 141.32 7 0005000000220 6.8373E6 3 2 0005000000110 Y 69555 hemorrhagic metalloproteinase russelysin [Daboia russelii]
191 440 B8K1W0.1 141.32 7 0005000000220 6.8373E6 3 2 0005000000110 Y 69555 RecName: Full=Zinc metalloproteinase-disintegrin-like daborhagin-K; AltName: Full=Haemorrhagic metalloproteinase russelysin; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
146 982 Q9W727.1 141.07 43 000000000431200 1.6607E6 4 1 0000000008700 Y 9934 RecName: Full=Muscarinic toxin-like protein; Flags: Precursor
146 983 Q9DEQ3.1 141.07 43 000000000431200 1.6607E6 4 1 0000000008700 Y 9962 RecName: Full=Neurotoxin homolog NL1; Flags: Precursor
146 984 CAB50691.1 141.07 43 000000000431200 1.6607E6 4 1 0000000008700 Y 9934 snake venom [Bungarus multicinctus multicinctus]
146 985 CAC08183.1 141.07 43 000000000431200 1.6607E6 4 1 0000000008700 Y 9962 unnamed protein product (plasmid) [Naja atra]
175 1218 XP_032075406.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 85050 LOW QUALITY PROTEIN: amyloid-beta precursor protein [Thamnophis elegans]
175 1221 XP_013912685.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84599 PREDICTED: amyloid beta A4 protein isoform X1 [Thamnophis sirtalis]
175 1228 LAB26479.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84918 hypothetical protein [Micrurus spixii]
175 1240 XP_026519907.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 82911 amyloid-beta A4 protein isoform X2 [Notechis scutatus]
175 1241 XP_026556422.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 82796 amyloid-beta A4 protein isoform X2 [Pseudonaja textilis]
175 1242 XP_015676850.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 82886 amyloid-beta precursor protein isoform X2 [Protobothrops mucrosquamatus]
175 1250 JAV51273.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84882 amyloid beta A4 protein-like protein [Agkistrodon contortrix contortrix]
175 1251 AFJ49397.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84854 Amyloid beta A4 protein-like [Crotalus adamanteus]
175 1252 JAG47493.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84854 amyloid beta A4 protein-like protein [Crotalus horridus]
175 1253 JAG45861.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84854 amyloid beta A4 protein-like protein [Crotalus horridus]
175 1254 JAI14367.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84854 amyloid beta A4 protein-like protein [Crotalus adamanteus]
175 1255 JAA97793.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84854 amyloid beta A4 protein-like protein [Crotalus horridus]
175 1256 XP_034283168.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84566 amyloid-beta precursor protein isoform X1 [Pantherophis guttatus]
175 1257 XP_026519906.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84815 amyloid-beta A4 protein isoform X1 [Notechis scutatus]
175 1258 XP_026556420.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84700 amyloid-beta A4 protein isoform X1 [Pseudonaja textilis]
175 1259 XP_013912686.1 137.06 5 0000000050000 4.9768E7 2 2 00000000120000 Y 78403 PREDICTED: amyloid beta A4 protein isoform X2 [Thamnophis sirtalis]
175 1260 XP_034283217.1 137.06 5 0000000050000 4.9768E7 2 2 00000000120000 Y 78383 amyloid-beta precursor protein isoform X2 [Pantherophis guttatus]
175 1261 XP_015676849.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84789 amyloid-beta precursor protein isoform X1 [Protobothrops mucrosquamatus]
175 1327 JAI10297.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84624 amyloid beta A4 protein-like protein [Micrurus fulvius]
175 1577 JAG68744.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 84419 amyloid beta A4 protein-like protein [Boiga irregularis]
175 1578 ETE71713.1 137.06 4 0000000040000 4.9768E7 2 2 00000000120000 Y 83462 Amyloid beta A4 protein, partial [Ophiophagus hannah]
179 360 XP_026556851.1 135.58 10 0102000007011 1.8048E61.5704E51.672E700 5 5 0101000007012 Y 81535 hepatocyte growth factor isoform X2 [Pseudonaja textilis]
179 361 XP_026556843.1 135.58 10 0102000007011 1.8048E61.5704E51.672E700 5 5 0101000007012 Y 82067 hepatocyte growth factor isoform X1 [Pseudonaja textilis]
158 2050 1COD 134.23 61 610000610000000 9.9654E61.1582E8 3 2 9000080000000 Y 6957 Chain A, COBROTOXIN
158 2051 1V6P 134.23 61 610000610000000 9.9654E61.1582E8 3 2 9000080000000 Y 6957 Chain B, Cobrotoxin
158 2052 1COE 134.23 61 610000610000000 9.9654E61.1582E8 3 2 9000080000000 Y 6957 Chain A, COBROTOXIN
158 2053 AAB25735.1 134.23 61 610000610000000 9.9654E61.1582E8 3 2 9000080000000 Y 6957 neurotoxin, NTX [Naja naja=Formosan cobra, ssp. atra, venom, Peptide, 62 aa]
158 2054 ADN67584.1 134.23 59 590000590000000 9.9654E61.1582E8 3 2 9000080000000 Y 7221 three-finger toxin precursor, partial [Naja atra]
158 2055 AAB36932.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin''' [Naja atra]
158 2056 Q9PTT0.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 RecName: Full=Cobrotoxin homolog; AltName: Full=Short neurotoxin; Flags: Precursor
158 2057 P60770.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 RecName: Full=Cobrotoxin; Short=CBT; AltName: Full=Atratoxin; AltName: Full=Short neurotoxin 1; Flags: Precursor
158 2058 P60771.2 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 RecName: Full=Cobrotoxin; Short=CBT; AltName: Full=Short neurotoxin I; Short=NT1; Flags: Precursor
158 2059 AAY63884.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 neurotoxin [Naja kaouthia]
158 2060 AAB36930.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin' [Naja atra]
158 2061 AAB03222.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin'' [Naja atra]
158 2062 CAA73097.2 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin [Naja atra]
158 2063 AAB03221.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin' [Naja atra]
158 2064 ADN67574.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 three-finger toxin precursor [Naja atra]
158 2065 AAB03223.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin''' [Naja atra]
158 2066 AAB36931.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin'' [Naja atra]
158 2067 AAB01538.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 cobrotoxin [Naja atra]
158 2068 AAF21774.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 neurotoxin preprotein precursor [Naja naja]
158 2069 AAR33035.1 134.23 46 460000460000000 9.9654E61.1582E8 3 2 9000080000000 Y 9262 atratoxin [Naja atra]
113 1841 LAB46845.1 133.22 23 00000000011111123 4.6144E7 4 1 000000000202611 Y 12553 hypothetical protein, partial [Micrurus spixii]
113 1978 LAA90412.1 133.22 23 00000000011111123 4.6144E7 4 1 000000000202611 Y 12188 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
113 1979 LAA90421.1 133.22 23 00000000011111123 4.6144E7 4 1 000000000202611 Y 12261 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
113 2175 LAB46837.1 133.22 23 00000000011111123 4.6144E7 4 1 000000000202611 Y 12466 hypothetical protein, partial [Micrurus spixii]
113 2176 LAB46855.1 133.22 23 00000000011111123 4.6144E7 4 1 000000000202611 Y 12539 hypothetical protein, partial [Micrurus spixii]
131 622 XP_032067281.1 133.02 5 0002242244222 3.5293E6 3 1 0003241136121 N 59706 keratin, type II cytoskeletal 6A-like [Thamnophis elegans]
131 623 XP_013915209.1 133.02 5 0002242244222 3.5293E6 3 1 0003241136121 N 59764 PREDICTED: keratin, type II cytoskeletal 6A-like [Thamnophis sirtalis]
137 1337 P86368.1 132.62 24 08823000008900 2.1087E5 3 1 02115000001100 Y 13687 RecName: Full=Basic phospholipase A2 3; Short=PLA23; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase
163 594 JAG66642.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Boiga irregularis]
163 595 JAB53407.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 Ubiquitin-40S ribosomal protein S27a [Micrurus fulvius]
163 596 JAI11580.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Crotalus adamanteus]
163 597 XP_015686894.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Protobothrops mucrosquamatus]
163 598 XP_007432078.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Python bivittatus]
163 599 JAV49286.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Agkistrodon contortrix contortrix]
163 600 LAA53283.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 hypothetical protein [Micrurus corallinus]
163 601 XP_015686900.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Protobothrops mucrosquamatus]
163 602 XP_007432077.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Python bivittatus]
163 603 XP_026551822.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Pseudonaja textilis]
163 604 AFJ51304.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 Ubiquitin-40S ribosomal protein S27a-like [Crotalus adamanteus]
163 605 XP_034283249.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Pantherophis guttatus]
163 606 XP_026551821.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Pseudonaja textilis]
163 607 JAA95751.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Crotalus horridus]
163 608 XP_032072309.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Thamnophis elegans]
163 609 XP_026532495.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Notechis scutatus]
163 610 XP_026532494.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Notechis scutatus]
163 611 JAI09470.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Micrurus fulvius]
163 612 XP_032072311.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Thamnophis elegans]
163 613 XP_034283248.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 ubiquitin-40S ribosomal protein S27a [Pantherophis guttatus]
163 614 LAB39333.1 132.14 30 2400100000160000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 17979 hypothetical protein [Micrurus spixii]
163 615 LAB39331.1 132.14 28 220090000150000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 19424 hypothetical protein [Micrurus spixii]
163 616 LAA53282.1 132.14 26 210090000140000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 20590 hypothetical protein, partial [Micrurus corallinus]
163 685 XP_013929631.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14674 PREDICTED: ubiquitin-60S ribosomal protein L40 [Thamnophis sirtalis]
163 686 XP_013929630.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14674 PREDICTED: ubiquitin-60S ribosomal protein L40 [Thamnophis sirtalis]
163 720 JAI09497.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 60S ribosomal protein L40 [Micrurus fulvius]
163 721 JAB53439.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 Ubiquitin-60S ribosomal protein L40 [Micrurus fulvius]
163 722 JAI11613.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 60S ribosomal protein L40 [Crotalus adamanteus]
163 723 AFJ51273.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 Ubiquitin-60S ribosomal protein L40 [Crotalus adamanteus]
163 724 JAG66673.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 60S ribosomal protein L40 [Boiga irregularis]
163 725 JAA95781.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 60S ribosomal protein L40 [Crotalus horridus]
163 726 JAB53440.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14716 ubiquitin-60S ribosomal protein L40 [Micrurus fulvius]
163 727 AAG17445.1 132.14 37 3000120000200000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 14728 ubiquitin fusion protein [Ophiophagus hannah]
163 740 JAI10738.1 132.14 48 3900160000260000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 10986 ubiquitin C [Crotalus adamanteus]
163 741 XP_013928637.1 132.14 21 170070000110000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 25822 PREDICTED: polyubiquitin-B [Thamnophis sirtalis]
163 742 AFJ51941.1 132.14 21 170070000110000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 25806 putative ubiquitin B [Crotalus adamanteus]
163 745 JAB53023.1 132.14 12 10004000070000 2.1518E78.563E51.0437E6 4 4 11001000020000 N 42865 polyubiquitin-C isoform 2 [Micrurus fulvius]
123 648 LAA22167.1 131.33 7 7000000000000 8.7118E6 3 3 26000000000000 N 61958 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
123 657 XP_007444287.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 57067 ATP synthase subunit alpha, mitochondrial [Python bivittatus]
123 658 XP_026569669.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 60057 ATP synthase subunit alpha, mitochondrial [Pseudonaja textilis]
123 659 JAB53920.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59947 ATP synthase subunit alpha [Micrurus fulvius]
123 660 XP_026544199.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 60073 ATP synthase subunit alpha, mitochondrial [Notechis scutatus]
123 681 JAG47406.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59979 ATP synthase subunit alpha, mitochondrial-like protein [Crotalus horridus]
123 682 JAI14245.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59936 ATP synthase subunit alpha, mitochondrial-like protein [Crotalus adamanteus]
123 683 JAG45747.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59979 ATP synthase subunit alpha, mitochondrial-like protein [Crotalus horridus]
123 684 JAA97708.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59979 ATP synthase subunit alpha, mitochondrial-like protein [Crotalus horridus]
123 690 XP_013922009.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 58891 PREDICTED: ATP synthase subunit alpha, mitochondrial [Thamnophis sirtalis]
123 691 XP_032069128.1 131.33 8 8000000000000 8.7118E6 3 3 26000000000000 N 59972 ATP synthase subunit alpha, mitochondrial [Thamnophis elegans]
147 528 D5LMJ3.1 129.83 4 0222400000000 5.6566E71.1334E88.156E73.8861E5 3 3 03413200000000 Y 68254 RecName: Full=Zinc metalloproteinase-disintegrin-like atrase-A; AltName: Full=Snake venom metalloproteinase; Short=SVMP; Flags: Precursor
147 529 ADF43026.1 129.83 4 0222400000000 5.6566E71.1334E88.156E73.8861E5 3 3 03413200000000 Y 68254 metalloproteinase atrase A [Naja atra]
201 1683 ACF21000.1 129.81 9 0009000077000 5.7554E63.4892E61.1315E6 4 4 0004000021000 Y 21835 cathelicidin-related protein precursor [Naja atra]
201 1684 B6S2X0.1 129.81 9 0009000077000 5.7554E63.4892E61.1315E6 4 4 0004000021000 Y 21835 RecName: Full=Cathelicidin-related antimicrobial peptide Na_CRAMP; AltName: Full=Cathelicidin-NA antimicrobial peptide; AltName: Full=Vipericidin; Flags: Precursor
126 312 JAG47405.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56548 ATP synthase subunit beta, mitochondrial-like protein [Crotalus horridus]
126 313 JAA97707.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56562 ATP synthase subunit beta, mitochondrial-like protein [Crotalus horridus]
126 314 JAG45746.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56580 ATP synthase subunit beta, mitochondrial-like protein [Crotalus horridus]
126 315 JAV51185.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56592 ATP synthase subunit beta, mitochondrial-like protein [Agkistrodon contortrix contortrix]
126 316 AFJ49478.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56574 ATP synthase subunit beta, mitochondrial [Crotalus adamanteus]
126 317 JAI14244.1 129.27 7 7000000000000 3.6919E6 3 3 15000000000000 N 56574 ATP synthase subunit beta, mitochondrial-like protein [Crotalus adamanteus]
180 584 XP_025032248.1 127.98 11 0000000092000 5.9367E7 5 2 0000000091000 Y 41355 insulin-like growth factor-binding protein 3, partial [Python bivittatus]
180 766 XP_013925299.1 127.98 14 00000000113000 5.9367E7 5 2 0000000091000 Y 32409 PREDICTED: insulin-like growth factor-binding protein 3 [Thamnophis sirtalis]
180 772 XP_032093683.1 127.98 14 00000000113000 5.9367E7 5 2 0000000091000 Y 32147 insulin-like growth factor-binding protein 3 [Thamnophis elegans]
180 871 XP_015680080.1 127.98 14 00000000113000 5.9367E7 5 2 0000000091000 Y 31982 LOW QUALITY PROTEIN: insulin-like growth factor-binding protein 3 [Protobothrops mucrosquamatus]
221 1293 XP_026571876.1 123.92 3 0000000110000 2.542E5 3 1 0000000140000 Y 108071 complement component C6-like [Pseudonaja textilis]
184 435 XP_026558105.1 123.87 16 00000000143000 2.241E8 4 1 0000000081000 Y 32240 insulin-like growth factor-binding protein 3 isoform X1 [Pseudonaja textilis]
170 490 AXL96618.1 122.29 6 0022400000000 1.3261E5 3 1 0012800000000 Y 68520 acetycholinesterase 2, partial [Ahaetulla prasina]
170 491 JAC96629.1 122.29 6 0022400000000 1.3261E5 3 1 0012800000000 Y 69005 Acetylcholinesterase transcript 1 [Echis coloratus]
170 492 AHY20009.1 122.29 6 0022400000000 1.3261E5 3 1 0012800000000 Y 68986 acetylcholinesterase [Echis coloratus]
170 493 ASU45022.1 122.29 7 0022500000000 1.3261E5 3 1 0012800000000 Y 62791 acetylcholinesterase, partial [Daboia russelii]
220 1280 XP_029140716.1 122.26 3 0000000030000 2.402E6 3 1 0000000060000 Y 104965 complement component C6 [Protobothrops mucrosquamatus]
220 1290 XP_026522231.1 122.26 3 0000000030000 2.402E6 3 1 0000000060000 Y 108124 complement component C6-like [Notechis scutatus]
220 1306 XP_032070501.1 122.26 3 0000000030000 2.402E6 3 1 0000000060000 Y 104608 complement component C6-like [Thamnophis elegans]
167 1055 AAB32582.1 118.18 14 0141414000000008 3.0482E71.5311E77.9103E60 2 2 0353000000001 Y 20452 phospholipase A2 31 kda subunit, PLA2 31 kda subunit=urokinase-type plasminogen activator receptor homolog [Naja naja kaouthia=Thailand cobras, blood, Peptide, 188 aa]
167 1056 Q7LZI1.1 118.18 14 0141414000000008 3.0482E71.5311E77.9103E60 2 2 0353000000001 Y 20452 RecName: Full=Phospholipase A2 inhibitor 31 kDa subunit; AltName: Full=gamma-PLI
183 527 ETE59846.1 117.37 5 0103200000000 8.1726E6 3 1 0106200000000 Y 72383 Alpha-fetoprotein, partial [Ophiophagus hannah]
182 827 XP_026555558.1 115.66 8 0535000000000 1.2567E6 3 1 0226000000000 Y 61349 hepatocyte growth factor activator [Pseudonaja textilis]
182 841 XP_034282171.1 115.66 10 0737000000000 1.2567E6 3 1 0226000000000 Y 46138 hepatocyte growth factor activator [Pantherophis guttatus]
24 1422 1CDT 114.67 27 022000120122227272722 2.4904E82.7013E65.7501E71.6839E63.5494E61.9896E6 3 1 021000102148752 Y 6715 Chain B, CARDIOTOXIN VII4
24 1423 P01452.1 114.67 27 022000120122227272722 2.4904E82.7013E65.7501E71.6839E63.5494E61.9896E6 3 1 021000102148752 Y 6715 RecName: Full=Cytotoxin 4; AltName: Full=CTX M3; AltName: Full=Cardiotoxin V(II)4
128 1622 XP_013925940.1 113.49 8 4008444444000 3.8043E5 3 1 20021102221000 Y 26870 PREDICTED: cationic trypsin-3-like [Thamnophis sirtalis]
128 1685 XP_029139862.1 113.49 7 3007333333000 3.8043E5 3 1 20021102221000 Y 31859 cationic trypsin-3 [Protobothrops mucrosquamatus]
128 1717 XP_015670838.1 113.49 8 4008444444000 3.8043E5 3 1 20021102221000 Y 26884 cationic trypsin-3-like [Protobothrops mucrosquamatus]
160 1205 ETE63009.1 111.48 9 0995000000000 4.1542E71.6447E74.5596E6 2 1 0774000000000 Y 34271 Extracellular matrix protein 1, partial [Ophiophagus hannah]
160 1497 XP_034280930.1 111.48 7 0774000000000 4.1542E71.6447E74.5596E6 2 1 0774000000000 Y 39235 extracellular matrix protein 1 [Pantherophis guttatus]
139 809 ETE67452.1 111.12 9 0044000006000 1.6125E69.1581E58.0495E7 3 3 00120000018000 Y 39348 Tumor necrosis factor receptor superfamily member 11B [Ophiophagus hannah]
181 1520 XP_026576072.1 108.26 6 0633000000000 1.3801E55.5659E6 2 1 0326000000000 Y 39960 extracellular matrix protein 1 isoform X2 [Pseudonaja textilis]
181 1521 XP_026576070.1 108.26 6 0633000000000 1.3801E55.5659E6 2 1 0326000000000 Y 40088 extracellular matrix protein 1 isoform X1 [Pseudonaja textilis]
224 542 JAG67228.1 107.84 12 00001200000000 5.1493E5 4 1 0000500000000 Y 44109 Glia-derived nexin-like protein [Boiga irregularis]
224 555 XP_034295297.1 107.84 12 00001200000000 5.1493E5 4 1 0000500000000 Y 44043 glia-derived nexin [Pantherophis guttatus]
214 1480 P82462.1 107.17 43 000000000043430 4.7405E74.4988E7 1 1 0000000000120 Y 7366 RecName: Full=Muscarinic toxin-like protein 1; Short=MTLP-1
202 1703 BAN08536.1 105.21 15 0770000009009 7.9588E61.268E6 2 1 0210000002002 Y 16576 phospholipase A2 [Protobothrops flavoviridis]
202 1704 BAM76245.1 105.21 15 0770000009009 7.9588E61.268E6 2 1 0210000002002 Y 16546 pancreatic phospholipase A2 [Protobothrops elegans]
168 2029 XP_034292109.1 103.54 7 0000076660000 1.3046E73.9264E74.6158E74.2897E6 2 2 0000043310000 Y 33533 neural proliferation differentiation and control protein 1 [Pantherophis guttatus]
199 876 JAB53674.1 100.91 16 0000000008080 4.8944E61.4123E7 3 3 0000000003030 Y 27667 platelet-derived growth factor A chain long form [Micrurus fulvius]
199 888 LAB42085.1 100.91 17 0000000008090 4.8944E61.4123E7 3 3 0000000003030 Y 25772 hypothetical protein, partial [Micrurus spixii]
199 899 LAB42082.1 100.91 14 0000000007070 4.8944E61.4123E7 3 3 0000000003030 Y 31036 hypothetical protein, partial [Micrurus spixii]
199 906 XP_026560089.1 100.91 20 000000000100100 4.8944E61.4123E7 3 3 0000000003030 Y 22535 platelet-derived growth factor subunit A isoform X3 [Pseudonaja textilis]
199 917 XP_026560087.1 100.91 18 0000000009090 4.8944E61.4123E7 3 3 0000000003030 Y 24924 platelet-derived growth factor subunit A isoform X1 [Pseudonaja textilis]
199 918 LAA51478.1 100.91 33 000000000160170 4.8944E61.4123E7 3 3 0000000003030 Y 13713 hypothetical protein, partial [Micrurus corallinus]
199 919 XP_034286468.1 100.91 25 000000000120130 4.8944E61.4123E7 3 3 0000000003030 Y 18298 platelet-derived growth factor subunit A, partial [Pantherophis guttatus]
199 921 XP_026560088.1 100.91 18 0000000009090 4.8944E61.4123E7 3 3 0000000003030 Y 24698 platelet-derived growth factor subunit A isoform X2 [Pseudonaja textilis]
199 940 AFJ50955.1 100.91 20 000000000100100 4.8944E61.4123E7 3 3 0000000003030 Y 22576 Platelet-derived growth factor subunit A preproprotein [Crotalus adamanteus]
199 941 JAI12034.1 100.91 20 000000000100100 4.8944E61.4123E7 3 3 0000000003030 Y 22576 platelet-derived growth factor subunit A [Crotalus adamanteus]
199 942 XP_015676418.1 100.91 20 000000000100100 4.8944E61.4123E7 3 3 0000000003030 Y 22562 platelet-derived growth factor subunit A [Protobothrops mucrosquamatus]
199 943 LAA51474.1 100.91 33 000000000160170 4.8944E61.4123E7 3 3 0000000003030 Y 13798 hypothetical protein, partial [Micrurus corallinus]
199 944 XP_007426296.1 100.91 20 000000000100100 4.8944E61.4123E7 3 3 0000000003030 Y 22561 platelet-derived growth factor subunit A isoform X3 [Python bivittatus]
199 945 XP_025021193.1 100.91 19 00000000090100 4.8944E61.4123E7 3 3 0000000003030 Y 23303 platelet-derived growth factor subunit A isoform X2 [Python bivittatus]
199 946 XP_015743230.1 100.91 18 0000000009090 4.8944E61.4123E7 3 3 0000000003030 Y 24934 platelet-derived growth factor subunit A isoform X1 [Python bivittatus]
199 949 XP_026540879.1 100.91 18 0000000009090 4.8944E61.4123E7 3 3 0000000003030 Y 25552 platelet-derived growth factor subunit A [Notechis scutatus]
245 933 ETE63349.1 99.67 4 0004000000000 1.9395E6 2 2 0002000000000 Y 74315 Polymeric immunoglobulin receptor [Ophiophagus hannah]
194 2409 ETE61477.1 98.50 35 0151535000000000 6.87E5 2 1 0126000000000 Y 10789 Hepatocyte growth factor activator, partial [Ophiophagus hannah]
159 1182 JAS05124.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16135 Phospholipase A2 5a [Micrurus tener]
159 1183 JAS05123.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16135 Phospholipase A2 5b [Micrurus tener]
159 1190 AET85561.1 92.82 22 00000000092290 5.5123E7 3 1 0000000001310 Y 13385 phospholipase A2, partial [Micrurus tener tener]
159 1191 JAS05125.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16124 Phospholipase A2 4d [Micrurus tener]
159 1192 JAS05128.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16122 Phospholipase A2 4a [Micrurus tener]
159 1193 JAS05127.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16123 Phospholipase A2 4b [Micrurus tener]
159 1194 JAS05126.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16361 Phospholipase A2 4c [Micrurus tener]
159 1195 JAB52812.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16012 phospholipase A2 11 [Micrurus fulvius]
159 1196 JAB52803.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16123 phospholipase A2 1a [Micrurus fulvius]
159 1197 JAS05033.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16123 Phospholipase A2 2a [Micrurus fulvius]
159 1198 JAI09044.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16123 Phospholipase A2 2a [Micrurus fulvius]
159 1199 JAS05025.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16167 Phospholipase A2 2c [Micrurus fulvius]
159 1200 JAS05019.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16167 Phospholipase A2 2i [Micrurus fulvius]
159 1201 JAI09030.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16167 Phospholipase A2 2i [Micrurus fulvius]
159 1202 JAI09036.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16167 Phospholipase A2 2c [Micrurus fulvius]
159 1203 JAB52789.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16167 phospholipase A2 2a [Micrurus fulvius]
159 1211 JAS05020.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16216 Phospholipase A2 2h [Micrurus fulvius]
159 1212 JAI09031.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16216 Phospholipase A2 2h [Micrurus fulvius]
159 1213 JAB52781.1 92.82 18 00000000081880 5.5123E7 3 1 0000000001310 Y 16216 phospholipase A2 2i [Micrurus fulvius]
239 2427 ETE59007.1 92.64 32 00032000000000 9.9997E6 2 2 0003000000000 N 9348 hypothetical protein L345_15265, partial [Ophiophagus hannah]
176 1279 ETE65528.1 92.44 9 0444060000444 1.6385E6 2 1 0122010000121 Y 28804 H-2 class II histocompatibility antigen gamma chain [Ophiophagus hannah]
257 1309 XP_026560868.1 91.01 1 0100000000000 1.0243E60 2 2 0100000010000 Y 277539 cation-independent mannose-6-phosphate receptor [Pseudonaja textilis]
257 1310 XP_026531033.1 91.01 1 0100000000000 1.0243E60 2 2 0100000010000 Y 281509 cation-independent mannose-6-phosphate receptor [Notechis scutatus]
257 1311 ETE64374.1 91.01 1 0100000010000 1.0243E60 2 2 0100000010000 Y 244985 Cation-independent mannose-6-phosphate receptor [Ophiophagus hannah]
257 1314 XP_034284419.1 91.01 1 0100000000000 1.0243E60 2 2 0100000010000 Y 277267 cation-independent mannose-6-phosphate receptor [Pantherophis guttatus]
209 986 XP_032090066.1 87.95 9 0335000005000 1.5737E60 2 1 0221000001000 Y 39123 extracellular matrix protein 1 isoform X2 [Thamnophis elegans]
209 987 XP_032090065.1 87.95 9 0335000005000 1.5737E60 2 1 0221000001000 Y 40343 extracellular matrix protein 1 isoform X1 [Thamnophis elegans]
240 4386 JAA74930.1 87.54 14 00000000140000 8.4235E5 1 1 0000000010000 Y 11058 3FTx-Pse-99 [Pseudonaja modesta]
222 1233 XP_026544110.1 87.41 8 0305000000000 1.4523E7 2 1 0102000000000 Y 50196 hepatocyte growth factor activator [Notechis scutatus]
264 835 P0DI84.1 85.14 5 0500000000000 1.7954E6 1 1 0200000000000 N 54748 RecName: Full=L-amino-acid oxidase; Short=LAO; Short=VAA-LAAO I
264 836 3KVE 85.14 5 0500000000000 1.7954E6 1 1 0200000000000 N 54933 Chain D, Structure Of Native L-Amino Acid Oxidase From Vipera Ammodytes Ammodytes: Stabilization Of The Quaternary Structure By Divalent Ions And Structural Changes In The Dynamic Active Site
226 2271 JAA75029.1 84.58 18 00000000007018 1.751E6 2 1 0000000000101 Y 16220 PLA2-Sut-25 [Suta fasciata]
232 1469 ADI47614.1 83.98 4 0000000002220 1.1234E6 2 1 0000000001110 Y 57183 metalloproteinase, partial [Echis coloratus]
266 2288 P0DMT2.1 83.46 15 000000000015150 1.7369E61.2456E7 1 1 0000000000120 Y 13865 RecName: Full=Phospholipase A2 homolog; Short=svPLA2 homolog; AltName: Full=ECS_00014
266 2379 3BJW 83.46 15 000000000015150 1.7369E61.2456E7 1 1 0000000000120 Y 13819 Chain H, Phospholipase A2
266 2380 2QHD 83.46 15 000000000015150 1.7369E61.2456E7 1 1 0000000000120 Y 13819 Chain B, Phospholipase A2
266 2381 P48650.1 83.46 15 000000000015150 1.7369E61.2456E7 1 1 0000000000120 Y 13819 RecName: Full=Basic phospholipase A2 homolog ecarpholin S; Short=Ecs-S49; Short=svPLA2 homolog
266 2382 2QHE 83.46 15 000000000015150 1.7369E61.2456E7 1 1 0000000000120 Y 13819 Chain A, Phospholipase A2
200 1315 XP_026571379.1 83.09 3 0131000000001 1.8284E61.5489E77.0028E64.4868E6 2 2 0123000000002 Y 80026 C4b-binding protein alpha chain-like isoform X1 [Pseudonaja textilis]
215 1510 XP_032085287.1 82.09 18 01870000000000 1.8111E6 2 1 0310000000000 Y 16345 phospholipase A2 [Thamnophis elegans]
292 988 JAG46496.1 82.04 5 0005000000000 2.3013E6 2 1 0002000000000 N 49179 legumain preproprotein [Crotalus horridus]
249 1101 ACD43466.1 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 acidic phospholipase A2 [Daboia siamensis]
249 1102 P31100.1 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 RecName: Full=Acidic phospholipase A2 RV-7; Short=svPLA2; AltName: Full=F7; AltName: Full=Phosphatidylcholine 2-acylhydrolase; AltName: Full=Phospholipase A2 inhibitor; AltName: Full=S4; AltName: Full=Viperotoxin F; AltName: Full=...
249 1103 CAA48457.1 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 phospholipase a2 [Daboia russelii]
249 1104 S29299 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 phospholipase A2 (EC 3.1.1.4) - Russell's viper
249 1105 AAZ53184.1 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 acidic phospholipase A2 [Daboia russelii limitis]
249 1106 ACD43468.1 81.81 20 00020000000000 2.7298E6 2 2 0004000000000 Y 15421 acidic phospholipase A2 [Daboia siamensis]
141 1316 AXL95289.1 81.75 8 0008000000000 2.2338E8 2 1 00013000000000 Y 26943 cysteine-rich secretory protein, partial [Spilotes sulphureus]
242 1033 XP_034262239.1 77.68 2 2000000000000 1.6814E6 2 2 3000000000000 N 181278 myosin-7 [Pantherophis guttatus]
242 1176 XP_032092515.1 77.68 2 2000000000000 1.6814E6 2 2 3000000000000 N 224393 LOW QUALITY PROTEIN: myosin-7-like [Thamnophis elegans]
242 1178 XP_026538839.1 77.68 2 2000000000000 1.6814E6 2 2 3000000000000 N 223333 myosin-7 [Notechis scutatus]
242 1179 XP_015677713.1 77.68 2 2000000000000 1.6814E6 2 2 3000000000000 N 206763 myosin-7-like [Protobothrops mucrosquamatus]
253 1002 ETE67243.1 76.56 2 0002000000000 1.6499E5 1 1 0001000000000 Y 46824 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase, partial [Ophiophagus hannah]
253 1007 XP_032079951.1 76.56 3 0003000000000 1.6499E5 1 1 0001000000000 Y 37830 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase [Thamnophis elegans]
253 1009 XP_034298591.1 76.56 3 0003000000000 1.6499E5 1 1 0001000000000 Y 37788 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase [Pantherophis guttatus]
253 1023 XP_026555457.1 76.56 3 0003000000000 1.6499E5 1 1 0001000000000 Y 37785 N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase [Pseudonaja textilis]
253 1048 XP_013912092.1 76.56 13 00013000000000 1.6499E5 1 1 0001000000000 Y 9501 PREDICTED: N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase-like [Thamnophis sirtalis]
254 1637 Q9YGJ6.1 75.68 45 310000130000000 1.582E8 2 1 2000020000000 Y 9220 RecName: Full=Alpha-neurotoxin NTX-1; Short=NTX1; Flags: Precursor
254 1638 O57326.1 75.68 45 310000130000000 1.582E8 2 1 2000020000000 Y 9289 RecName: Full=Alpha-neurotoxin NTX-3; Short=NTX3; Flags: Precursor
254 1639 AAC69915.1 75.68 45 310000130000000 1.582E8 2 1 2000020000000 Y 9289 post synaptic alpha neurotoxin precursor [Naja sputatrix]
254 1640 AAD08812.1 75.68 45 310000130000000 1.582E8 2 1 2000020000000 Y 9220 post synaptic alpha neurotoxin precursor [Naja sputatrix]
235 1476 Q53B55.1 75.55 14 00000000140000 2.7231E6 1 1 0000000010000 Y 10154 RecName: Full=Long neurotoxin-like OH-31; Flags: Precursor
235 1477 AAT97253.1 75.55 14 00000000140000 2.7231E6 1 1 0000000010000 Y 10154 long chain neurotoxin-like protein [Ophiophagus hannah]
235 1723 P01387.1 75.55 18 00000000180000 2.7231E6 1 1 0000000010000 Y 8106 RecName: Full=Long neurotoxin 1; AltName: Full=Neurotoxin A
235 1945 Q53B53.1 75.55 14 00000000140000 2.7231E6 1 1 0000000010000 Y 9867 RecName: Full=Long neurotoxin OH-34; Flags: Precursor
235 1946 AAT97255.1 75.55 14 00000000140000 2.7231E6 1 1 0000000010000 Y 9867 long chain neurotoxin precursor, partial [Ophiophagus hannah]
229 1032 AAZ39881.1 74.52 2 0002000000000 7.5878E4 1 1 0001000000000 N 69648 RVV-X-heavy chain [Daboia russelii]
229 1035 AAB22477.1 74.52 3 0003000000000 7.5878E4 1 1 0001000000000 N 47975 coagulation factor X activating enzyme heavy chain, RVV-X-heavy chain=metalloproteinase with disintegrin (platelet aggregation inhibitor)-like and C-type lectin-like domains [Vipera russelli=Russell's viper, Siamensis, venom, Peptide, 429 aa]
311 1872 CAL69604.1 74.51 19 00000001900000 1.1621E6 1 1 0000000100000 Y 9443 trypsin inhibitor-3 precursor [Daboia siamensis]
311 1873 A8Y7N6.1 74.51 19 00000001900000 1.1621E6 1 1 0000000100000 Y 9443 RecName: Full=Kunitz-type serine protease inhibitor C3; AltName: Full=BPTI-3; AltName: Full=Trypsin inhibitor 3; AltName: Full=Trypsin inhibitor C3; Flags: Precursor
311 1874 AFD04724.1 74.51 18 00000001800000 1.1621E6 1 1 0000000100000 Y 10132 Kunitz-type protease inhibitor [Daboia russelii]
311 1875 CAL69605.1 74.51 18 00000001800000 1.1621E6 1 1 0000000100000 Y 10162 trypsin inhibitor-4 precursor [Daboia siamensis]
311 1876 A8Y7N7.1 74.51 18 00000001800000 1.1621E6 1 1 0000000100000 Y 10162 RecName: Full=Kunitz-type serine protease inhibitor C4; AltName: Full=BPTI-4; AltName: Full=Trypsin inhibitor 4; AltName: Full=Trypsin inhibitor C4; Flags: Precursor
311 2824 ABD24042.1 74.51 19 00000001900000 1.1621E6 1 1 0000000100000 Y 9417 Kunitz protease inhibitor-III [Daboia russelii russelii]
311 2825 Q2ES48.1 74.51 19 00000001900000 1.1621E6 1 1 0000000100000 Y 9417 RecName: Full=Kunitz-type serine protease inhibitor 3; AltName: Full=Kunitz protease inhibitor 3; AltName: Full=Kunitz protease inhibitor III; Flags: Precursor
213 2019 XP_032084681.1 72.28 2 0000200002000 6.4023E52.2329E7 1 1 0000100003000 Y 69288 zinc metalloproteinase-disintegrin-like MTP9 [Thamnophis elegans]
213 2715 XP_013922279.1 72.28 7 0000700007000 6.4023E52.2329E7 1 1 0000100003000 Y 18221 PREDICTED: hemorrhagic metalloproteinase-disintegrin-like kaouthiagin, partial [Thamnophis sirtalis]
297 1929 P25679.2 71.90 20 00000000020000 1.8887E7 1 1 0000000002000 Y 7438 RecName: Full=Weak toxin CM-9a
297 1960 P60814.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9811 RecName: Full=Probable weak neurotoxin NNAM2I; Flags: Precursor
297 1961 CAA06888.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9811 neurotoxin [Naja atra]
297 2168 2MJ0 71.90 20 00000000020000 1.8887E7 1 1 0000000002000 Y 7729 Chain A, Weak tryptophan-containing neurotoxin
297 2259 P82935.2 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9915 RecName: Full=Tryptophan-containing weak neurotoxin; Short=WTX; Flags: Precursor
297 2315 CAA04578.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9885 unnamed protein product (plasmid) [Naja atra]
297 2363 AAL87467.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9806 weak neurotoxin 5 precursor [Naja sputatrix]
297 2364 O42255.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9806 RecName: Full=Weak neurotoxin 5; Short=Wntx-5; Flags: Precursor
297 2365 AAB87415.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9806 weak neurotoxin isoform precursor [Naja sputatrix]
297 2449 AAB87416.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9807 weak neurotoxin isoform precursor [Naja sputatrix]
297 2450 O42256.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9807 RecName: Full=Weak neurotoxin 6; Short=Wntx-6; Flags: Precursor
297 2480 CAA10530.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9899 neurotoxin homolog [Naja atra]
297 2481 Q9YGI4.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9899 RecName: Full=Probable weak neurotoxin NNAM2; AltName: Full=TA-N9; Flags: Precursor
297 2622 AAL87466.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9823 weak neurotoxin 8 precursor [Naja sputatrix]
297 2623 AAD39353.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9809 weak neurotoxin precursor [Naja sputatrix]
297 2624 Q802B3.2 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9809 RecName: Full=Weak neurotoxin 8; Short=Wntx-8; Flags: Precursor
297 2832 AAD39354.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9836 weak neurotoxin precursor [Naja sputatrix]
297 2833 Q9W7I3.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9836 RecName: Full=Weak neurotoxin 9; Short=Wntx-9; Flags: Precursor
297 2892 AAL87465.1 71.90 15 00000000015000 1.8887E7 1 1 0000000002000 Y 9824 weak neurotoxin 6 precursor [Naja sputatrix]
297 3761 C0HJW9.2 71.90 39 00000000039000 1.8887E7 1 1 0000000002000 Y 3943 RecName: Full=Neurotoxin Nk-3FTx
225 1914 E5L0E4.1 71.71 6 0666000000000 3.9103E63.6573E61.9316E6 1 1 0131000000000 N 28035 RecName: Full=Beta-fibrinogenase-like; Short=RVBF; AltName: Full=Snake venom serine protease; Short=SVSP; Flags: Precursor
225 1915 ADP88560.1 71.71 6 0666000000000 3.9103E63.6573E61.9316E6 1 1 0131000000000 N 28035 serine beta-fibrinogenase-like protein precursor [Daboia siamensis]
228 1389 ETE73990.1 71.44 1 0100000000001 7.3137E64.6581E6 1 1 0200000000002 N 146075 Desmocollin-2 [Ophiophagus hannah]
228 1402 XP_032078632.1 71.44 1 0100000000001 7.3137E64.6581E6 1 1 0200000000002 N 100258 LOW QUALITY PROTEIN: desmocollin-2-like [Thamnophis elegans]
228 1403 XP_013911097.1 71.44 1 0100000000001 7.3137E64.6581E6 1 1 0200000000002 N 100546 PREDICTED: desmocollin-2-like isoform X1 [Thamnophis sirtalis]
228 1404 XP_013911096.1 71.44 1 0100000000001 7.3137E64.6581E6 1 1 0200000000002 N 100546 PREDICTED: desmocollin-2-like isoform X1 [Thamnophis sirtalis]
228 1405 XP_013911098.1 71.44 2 0200000000002 7.3137E64.6581E6 1 1 0200000000002 N 94407 PREDICTED: desmocollin-2-like isoform X2 [Thamnophis sirtalis]
228 1432 XP_026526159.1 71.44 2 0200000000002 7.3137E64.6581E6 1 1 0200000000002 N 94797 desmocollin-2-like isoform X3 [Notechis scutatus]
228 1433 XP_026526158.1 71.44 2 0200000000002 7.3137E64.6581E6 1 1 0200000000002 N 94988 desmocollin-2-like isoform X2 [Notechis scutatus]
228 1438 XP_026526157.1 71.44 1 0100000000001 7.3137E64.6581E6 1 1 0200000000002 N 100936 desmocollin-2-like isoform X1 [Notechis scutatus]
218 3715 ETE67110.1 70.63 8 0880000000000 1.0165E61.4658E6 1 1 0230000000000 N 16724 Insulin-like growth factor-binding protein 6 [Ophiophagus hannah]
271 1319 JAB53705.1 70.54 14 00014000000000 1.596E6 2 2 0003000000000 N 23247 phosphatidylethanolamine-binding protein 4 [Micrurus fulvius]
271 1511 XP_026539772.1 70.54 14 00014000000000 1.596E6 2 2 0003000000000 N 23342 phosphatidylethanolamine-binding protein 4 [Notechis scutatus]
271 1512 XP_026539773.1 70.54 14 00014000000000 1.596E6 2 2 0003000000000 N 23342 phosphatidylethanolamine-binding protein 4 [Notechis scutatus]
271 2455 XP_026570986.1 70.54 14 00014000000000 1.596E6 2 2 0003000000000 N 23371 phosphatidylethanolamine-binding protein 4 [Pseudonaja textilis]
271 2456 XP_026570987.1 70.54 14 00014000000000 1.596E6 2 2 0003000000000 N 23371 phosphatidylethanolamine-binding protein 4 [Pseudonaja textilis]
270 1231 JAC94989.1 69.37 5 0000500000000 1.7683E4 2 1 0000200000000 N 63907 Phospholipase B [Opheodrys aestivus]
304 2520 JAB52813.1 69.00 13 013000000000013 2.1439E61.8341E6 1 1 0100000000001 Y 16274 Phospholipase A2 10 [Micrurus fulvius]
304 2521 JAI09045.1 69.00 13 013000000000013 2.1439E61.8341E6 1 1 0100000000001 Y 16274 Phospholipase A2 1 [Micrurus fulvius]
304 2522 JAS05034.1 69.00 13 013000000000013 2.1439E61.8341E6 1 1 0100000000001 Y 16274 Phospholipase A2 1 [Micrurus fulvius]
304 2523 JAS05141.1 69.00 13 013000000000013 2.1439E61.8341E6 1 1 0100000000001 Y 16274 Phospholipase A2 1 [Micrurus tener]
494 2519 XP_026558006.1 68.99 8 0800000000000 9.5542E6 1 1 0100000000000 Y 40576 MANSC domain-containing protein 1 [Pseudonaja textilis]
289 1344 XP_032084613.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 87537 amyloid-like protein 2 isoform X2 [Thamnophis elegans]
289 1345 XP_032084612.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 88960 amyloid-like protein 2 isoform X1 [Thamnophis elegans]
289 1353 XP_032084615.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 81056 amyloid-like protein 2 isoform X4 [Thamnophis elegans]
289 1354 XP_032084614.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 82479 amyloid-like protein 2 isoform X3 [Thamnophis elegans]
289 1406 XP_026534403.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 87705 amyloid-like protein 2 isoform X2 [Notechis scutatus]
289 1407 XP_026534402.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 89114 amyloid-like protein 2 isoform X1 [Notechis scutatus]
289 1408 XP_026564759.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 87596 amyloid-like protein 2 isoform X2 [Pseudonaja textilis]
289 1409 XP_026564758.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 89005 amyloid-like protein 2 isoform X1 [Pseudonaja textilis]
289 1434 XP_026534405.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 81206 amyloid-like protein 2 isoform X4 [Notechis scutatus]
289 1435 XP_026534404.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 82614 amyloid-like protein 2 isoform X3 [Notechis scutatus]
289 1436 XP_026564761.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 81096 amyloid-like protein 2 isoform X4 [Pseudonaja textilis]
289 1437 XP_026564760.1 68.76 2 0200000000000 0 1 1 0100000000000 Y 82505 amyloid-like protein 2 isoform X3 [Pseudonaja textilis]
289 1496 LAA59850.1 68.76 3 0300000000000 0 1 1 0100000000000 Y 47699 hypothetical protein, partial [Micrurus corallinus]
319 4096 ETE57873.1 67.63 12 00012000000000 8.0605E5 1 1 0002000000000 N 13885 hypothetical protein L345_16412, partial [Ophiophagus hannah]
149 2588 E3P6P4.1 65.98 6 0660000000006 1.1945E85.9073E51.7714E6 1 1 01510000000002 Y 15772 RecName: Full=Cystatin; Flags: Precursor
149 2589 ACR83850.1 65.98 6 0660000000006 1.1945E85.9073E51.7714E6 1 1 01510000000002 Y 15772 cystatin precursor [Naja kaouthia]
306 2490 JAS03127.1 64.42 8 0000000008000 1.7968E7 1 1 0000000002000 Y 20534 Papilin, partial [Phalotris mertensi]
237 1636 S68801 64.29 11 00011000000000 2.7542E5 1 1 0001000000000 N 9793 acetylcholinesterase (EC 3.1.1.7) - banded krait (fragments)
251 1657 XP_026524106.1 63.65 2 0022000000000 6.5993E56.3396E5 1 1 0011000000000 N 55065 nucleobindin-2 [Notechis scutatus]
251 1675 XP_026562300.1 63.65 2 0022000000000 6.5993E56.3396E5 1 1 0011000000000 N 51084 nucleobindin-2 isoform X2 [Pseudonaja textilis]
251 1676 XP_026562299.1 63.65 2 0022000000000 6.5993E56.3396E5 1 1 0011000000000 N 55120 nucleobindin-2 isoform X1 [Pseudonaja textilis]
255 2184 XP_034262406.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25308 serum amyloid P-component-like, partial [Pantherophis guttatus]
255 3229 XP_015678953.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25637 C-reactive protein [Protobothrops mucrosquamatus]
255 3626 JAG66558.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25320 serum amyloid P-component-like [Boiga irregularis]
255 3683 XP_026545516.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25122 C-reactive protein-like [Notechis scutatus]
255 3772 ETE56526.1 62.29 5 0005000000000 1.462E7 1 1 0003000000000 N 22732 Serum amyloid P-component, partial [Ophiophagus hannah]
255 3879 XP_034261801.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25330 C-reactive protein-like [Pantherophis guttatus]
255 4298 XP_026572193.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25165 serum amyloid P-component-like [Pseudonaja textilis]
255 4299 XP_015678948.1 62.29 4 0004000000000 1.462E7 1 1 0003000000000 N 25142 serum amyloid P-component-like [Protobothrops mucrosquamatus]
310 2625 XP_015680851.2 61.93 5 0500000000000 1.9911E7 1 1 0200000000000 Y 20839 cystatin-1-like [Protobothrops mucrosquamatus]
318 4411 XP_026553567.1 61.47 5 0000000050000 5.4621E5 1 1 0000000010000 N 29143 somatomedin-B and thrombospondin type-1 domain-containing protein-like [Pseudonaja textilis]
449 1748 XP_013928420.1 60.77 5 0000050000000 7.5948E5 1 1 0000010000000 Y 33841 PREDICTED: epithelial cell adhesion molecule [Thamnophis sirtalis]
449 2118 ETE70163.1 60.77 5 0000050000000 7.5948E5 1 1 0000010000000 Y 33908 Epithelial cell adhesion molecule [Ophiophagus hannah]
178 2667 XP_032073624.1 60.71 3 0333000000000 1.2432E78.5152E73.2948E6 1 1 0362000000000 Y 41736 membrane cofactor protein-like isoform X1 [Thamnophis elegans]
178 3625 XP_032073625.1 60.71 3 0333000000000 1.2432E78.5152E73.2948E6 1 1 0362000000000 Y 39347 membrane cofactor protein-like isoform X2 [Thamnophis elegans]
178 3847 XP_032073626.1 60.71 3 0333000000000 1.2432E78.5152E73.2948E6 1 1 0362000000000 Y 38075 zona pellucida sperm-binding protein 3 receptor-like isoform X3 [Thamnophis elegans]
317 1050 ETE72142.1 60.64 8 0008000000000 0 1 1 0001000000000 N 24461 Ribonuclease T2 [Ophiophagus hannah]
248 1938 LAB36464.1 59.68 2 0000000000020 2.7719E6 1 1 0000000000030 N 97420 hypothetical protein [Micrurus spixii]
256 4301 XP_015686076.1 59.64 5 0005000000000 1.2509E7 1 1 0003000000000 N 23560 serum amyloid P-component-like, partial [Protobothrops mucrosquamatus]
238 2072 XP_034262785.1 58.50 1 0110000000000 1.4943E68.1117E5 1 1 0320000000000 N 113116 lysosomal alpha-mannosidase [Pantherophis guttatus]
238 2782 LAB27223.1 58.50 1 0110000000000 1.4943E68.1117E5 1 1 0320000000000 N 113239 hypothetical protein, partial [Micrurus spixii]
238 2982 XP_026537394.1 58.50 1 0110000000000 1.4943E68.1117E5 1 1 0320000000000 N 111874 lysosomal alpha-mannosidase-like [Notechis scutatus]
238 2983 XP_026537257.1 58.50 1 0110000000000 1.4943E68.1117E5 1 1 0320000000000 N 111925 lysosomal alpha-mannosidase-like [Notechis scutatus]
238 2984 XP_026552070.1 58.50 1 0110000000000 1.4943E68.1117E5 1 1 0320000000000 N 112008 lysosomal alpha-mannosidase [Pseudonaja textilis]
238 3485 LAB59085.1 58.50 4 0440000000000 1.4943E68.1117E5 1 1 0320000000000 N 37828 hypothetical protein, partial [Micrurus surinamensis]
238 3486 LAB59082.1 58.50 3 0330000000000 1.4943E68.1117E5 1 1 0320000000000 N 53569 hypothetical protein, partial [Micrurus surinamensis]
238 3542 LAA55510.1 58.50 3 0330000000000 1.4943E68.1117E5 1 1 0320000000000 N 55498 hypothetical protein, partial [Micrurus corallinus]
238 3942 LAB59086.1 58.50 4 0440000000000 1.4943E68.1117E5 1 1 0320000000000 N 37555 hypothetical protein, partial [Micrurus surinamensis]
259 2188 ADI47719.1 57.47 4 0004000000000 8.4323E5 1 1 0002000000000 N 37367 metalloproteinase, partial [Echis carinatus sochureki]
259 2205 ADI47718.1 57.47 6 0006000000000 8.4323E5 1 1 0002000000000 N 27679 metalloproteinase, partial [Echis carinatus sochureki]
267 2372 JAA95034.1 57.46 8 8000000000000 3.2728E6 1 1 1000000000000 N 30806 Voltage-dependent anion-selective channel protein 1-like protein [Crotalus horridus]
267 2642 XP_032066440.1 57.46 7 7000000000000 3.2728E6 1 1 1000000000000 N 34999 voltage-dependent anion-selective channel protein 1 [Thamnophis elegans]
458 1018 XP_015680353.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33502 cathepsin Z [Protobothrops mucrosquamatus]
458 1059 XP_032073085.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33380 cathepsin Z-like [Thamnophis elegans]
458 1291 JAA97490.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33544 Cathepsin Z-like protein [Crotalus horridus]
458 1292 JAG45445.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33525 Cathepsin Z-like protein [Crotalus horridus]
458 1304 XP_034289001.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33408 cathepsin Z-like [Pantherophis guttatus]
458 1335 XP_026520698.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33585 cathepsin Z [Notechis scutatus]
458 2669 LAA68286.1 54.64 5 0005000000000 5.9741E5 1 1 0001000000000 Y 36128 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
458 2946 XP_026553211.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 34145 cathepsin Z isoform X1 [Pseudonaja textilis]
458 3056 XP_032074969.1 54.64 5 0005000000000 5.9741E5 1 1 0001000000000 Y 34490 cathepsin Z-like [Thamnophis elegans]
458 3355 XP_026553213.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 33561 cathepsin Z isoform X2 [Pseudonaja textilis]
458 3762 XP_034289002.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 32467 cathepsin Z-like [Pantherophis guttatus]
458 4305 LAB21704.1 54.64 13 00013000000000 5.9741E5 1 1 0001000000000 Y 14536 hypothetical protein, partial [Micrurus spixii]
458 4306 XP_015685975.1 54.64 12 00012000000000 5.9741E5 1 1 0001000000000 Y 15743 cathepsin Z-like, partial [Protobothrops mucrosquamatus]
458 4307 LAA25473.1 54.64 10 00010000000000 5.9741E5 1 1 0001000000000 Y 19121 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
458 4308 XP_015679450.1 54.64 8 0008000000000 5.9741E5 1 1 0001000000000 Y 24752 cathepsin Z, partial [Protobothrops mucrosquamatus]
458 4309 XP_026520697.1 54.64 6 0006000000000 5.9741E5 1 1 0001000000000 Y 34179 cathepsin Z-like [Notechis scutatus]
203 3138 LAA93895.1 53.72 5 0005550005000 1.1234E69.9306E53.8362E55.7822E5 1 1 0002310001000 N 19716 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
474 2633 AFJ50537.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36788 Malate dehydrogenase, cytoplasmic-like [Crotalus adamanteus]
474 2634 JAI12652.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36788 Malate dehydrogenase, cytoplasmic-like protein [Crotalus adamanteus]
474 2635 JAV50078.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36728 Malate dehydrogenase, cytoplasmic-like protein [Agkistrodon contortrix contortrix]
474 2636 JAA96599.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36816 Malate dehydrogenase, cytoplasmic-like protein [Crotalus horridus]
474 2637 JAG44071.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36816 Malate dehydrogenase, cytoplasmic-like protein [Crotalus horridus]
474 2638 JAG46413.1 53.67 6 6000000000000 3.364E5 1 1 1000000000000 N 36816 Malate dehydrogenase, cytoplasmic-like protein [Crotalus horridus]
344 1093 LAB38707.1 53.63 3 0000000003000 2.8031E6 1 1 0000000001000 Y 51122 hypothetical protein, partial [Micrurus spixii]
344 1095 LAB61292.1 53.63 3 0000000003000 2.8031E6 1 1 0000000001000 Y 51312 hypothetical protein, partial [Micrurus surinamensis]
344 1097 XP_026529938.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41834 protein CYR61 [Notechis scutatus]
344 1098 ETE65500.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41174 Protein CYR61 [Ophiophagus hannah]
344 1099 LAA35956.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41684 hypothetical protein [Micrurus lemniscatus carvalhoi]
344 1100 XP_026556047.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41498 protein CYR61 [Pseudonaja textilis]
344 1587 JAG68264.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41736 Cyr61 protein [Boiga irregularis]
344 1633 XP_032074982.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41543 CCN family member 1 [Thamnophis elegans]
344 1647 XP_013913807.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41596 PREDICTED: protein CYR61 [Thamnophis sirtalis]
344 1648 XP_034293020.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41891 CCN family member 1 [Pantherophis guttatus]
344 1653 JAC95858.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41729 protein CYR61 [Hypsiglena sp. JMG-2014]
344 1660 XP_007444773.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41726 protein CYR61 [Python bivittatus]
344 1682 LAA35964.1 53.63 12 00000000012000 2.8031E6 1 1 0000000001000 Y 12702 hypothetical protein [Micrurus lemniscatus carvalhoi]
344 2204 XP_015674483.1 53.63 4 0000000004000 2.8031E6 1 1 0000000001000 Y 41672 protein CYR61 [Protobothrops mucrosquamatus]
252 1985 ETE57293.1 53.44 7 0700000000007 1.4409E64.0652E6 1 1 0100000000002 N 17619 Major histocompatibility complex class I-related protein, partial [Ophiophagus hannah]
252 2283 XP_015683643.1 53.44 3 0300000000003 1.4409E64.0652E6 1 1 0100000000002 N 40693 major histocompatibility complex class I-related gene protein-like [Protobothrops mucrosquamatus]
252 2323 XP_032065690.1 53.44 3 0300000000003 1.4409E64.0652E6 1 1 0100000000002 N 41122 major histocompatibility complex class I-related gene protein-like [Thamnophis elegans]
252 2327 XP_032065704.1 53.44 3 0300000000003 1.4409E64.0652E6 1 1 0100000000002 N 38503 major histocompatibility complex class I-related gene protein-like isoform X1 [Thamnophis elegans]
252 2336 XP_032065705.1 53.44 3 0300000000003 1.4409E64.0652E6 1 1 0100000000002 N 38501 major histocompatibility complex class I-related gene protein-like isoform X2 [Thamnophis elegans]
252 2337 XP_032065706.1 53.44 3 0300000000003 1.4409E64.0652E6 1 1 0100000000002 N 38529 major histocompatibility complex class I-related gene protein-like isoform X3 [Thamnophis elegans]
247 1801 XP_034291155.1 53.27 1 0000001110000 8.9276E64.6145E68.6948E6 1 1 0000001110000 N 188004 inactive ubiquitin carboxyl-terminal hydrolase 54 isoform X1 [Pantherophis guttatus]
473 2351 XP_026531535.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 58696 brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X2 [Notechis scutatus]
473 2352 XP_026531534.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 60215 brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X1 [Notechis scutatus]
473 2841 ETE74005.1 52.58 3 0003000000000 8.0879E4 1 1 0001000000000 N 53391 Brain-specific angiogenesis inhibitor 1-associated protein 2, partial [Ophiophagus hannah]
473 2842 JAB54701.1 52.58 3 0003000000000 8.0879E4 1 1 0001000000000 N 57090 Brain-specific angiogenesis inhibitor 1-associated protein 2 [Micrurus fulvius]
473 2843 XP_026557565.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 58744 brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X2 [Pseudonaja textilis]
473 2844 LAB18462.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 59460 hypothetical protein, partial [Micrurus spixii]
473 2845 XP_026557564.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 60263 brain-specific angiogenesis inhibitor 1-associated protein 2 isoform X1 [Pseudonaja textilis]
473 2846 LAA60085.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 61049 hypothetical protein [Micrurus corallinus]
473 2847 LAB18463.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 60994 hypothetical protein, partial [Micrurus spixii]
473 2848 LAA60082.1 52.58 2 0002000000000 8.0879E4 1 1 0001000000000 N 62569 hypothetical protein [Micrurus corallinus]
473 4048 LAA19315.1 52.58 7 0007000000000 8.0879E4 1 1 0001000000000 N 19568 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
473 4049 LAA19316.1 52.58 6 0006000000000 8.0879E4 1 1 0001000000000 N 23658 hypothetical protein, partial [Micrurus lemniscatus carvalhoi]
315 3746 AAT91068.1 51.75 6 0006000000000 1.2405E6 1 1 0002000000000 Y 18094 factor X activator light chain 2 [Macrovipera lebetina]
315 3747 Q696W1.1 51.75 6 0006000000000 1.2405E6 1 1 0002000000000 Y 18094 RecName: Full=Snaclec coagulation factor X-activating enzyme light chain 2; AltName: Full=VL factor X activator light chain 2; Short=VLFXA light chain 2; Flags: Precursor
315 4316 ADJ67473.1 51.75 6 0006000000000 1.2405E6 1 1 0002000000000 Y 18273 factor X activator light chain 2 [Daboia russelii russelii]
499 3048 XP_026572109.1 49.86 2 2000000000000 2.9152E5 1 1 1000000000000 N 113983 NAD(P) transhydrogenase, mitochondrial [Pseudonaja textilis]
499 3280 XP_032070506.1 49.86 2 2000000000000 2.9152E5 1 1 1000000000000 N 114140 NAD(P) transhydrogenase, mitochondrial [Thamnophis elegans]
265 1249 XP_034260774.1 49.84 2 0002000000000 3.2782E6 1 1 0002000000000 N 40023 H-2 class I histocompatibility antigen, Q9 alpha chain-like [Pantherophis guttatus]
262 1674 XP_034289344.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 140635 fibronectin-like [Pantherophis guttatus]
262 1733 XP_013916282.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 250820 PREDICTED: fibronectin [Thamnophis sirtalis]
262 1734 XP_032094866.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 247750 fibronectin isoform X4 [Thamnophis elegans]
262 1735 XP_032094851.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 252633 fibronectin isoform X2 [Thamnophis elegans]
262 1736 XP_032094842.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 252761 fibronectin isoform X1 [Thamnophis elegans]
262 1737 XP_032094874.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 251827 fibronectin isoform X5 [Thamnophis elegans]
262 1738 XP_032094858.1 48.34 1 0001000000000 1.1177E5 1 1 0001000000000 N 251955 fibronectin isoform X3 [Thamnophis elegans]
261 1229 XP_026542806.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 96457 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Notechis scutatus]
261 1244 XP_026580482.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 92634 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Pseudonaja textilis]
261 1245 XP_026580485.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 92634 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Pseudonaja textilis]
261 1620 JAV49206.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114644 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform a [Agkistrodon contortrix contortrix]
261 1626 XP_015684492.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 97509 sarcoplasmic/endoplasmic reticulum calcium ATPase 2, partial [Protobothrops mucrosquamatus]
261 1628 JAI11473.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114668 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Crotalus adamanteus]
261 1655 XP_034284638.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 109765 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform X2 [Pantherophis guttatus]
261 1656 XP_034284637.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114798 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform X1 [Pantherophis guttatus]
261 1661 XP_025025635.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 95653 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform X1 [Python bivittatus]
261 1662 XP_007433335.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 100560 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 isoform X2 [Python bivittatus]
261 1696 JAB54287.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114706 sarcoplasmic/endoplasmic reticulum calcium ATPase 2a [Micrurus fulvius]
261 1709 JAG66604.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114711 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Boiga irregularis]
261 1954 XP_032085178.1 47.72 2 2000000000000 1.7359E6 1 1 2000000000000 N 114797 sarcoplasmic/endoplasmic reticulum calcium ATPase 2 [Thamnophis elegans]
261 3661 LAB57412.1 47.72 10 10000000000000 1.7359E6 1 1 2000000000000 N 17527 hypothetical protein, partial [Micrurus surinamensis]
261 3662 LAB57416.1 47.72 10 10000000000000 1.7359E6 1 1 2000000000000 N 17527 hypothetical protein, partial [Micrurus surinamensis]
261 3663 LAA36529.1 47.72 5 5000000000000 1.7359E6 1 1 2000000000000 N 39001 hypothetical protein, partial [Micrurus corallinus]
241 2823 JAC94981.1 47.55 7 0700000000000 1.441E7 1 1 0300000000000 N 15892 Cystatin E/M [Opheodrys aestivus]
313 4415 XP_015678946.1 46.46 3 0003000000000 4.1362E6 1 1 0002000000000 N 26257 serum amyloid P-component-like [Protobothrops mucrosquamatus]
314 4371 XP_032064447.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 21987 peroxiredoxin-2 [Thamnophis elegans]
314 4372 XP_026537276.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 22065 peroxiredoxin-2-like [Notechis scutatus]
314 4373 XP_015670807.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 21997 peroxiredoxin-2 isoform X2 [Protobothrops mucrosquamatus]
314 4374 XP_007421035.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 22036 peroxiredoxin-2 [Python bivittatus]
314 4375 XP_026552097.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 22051 peroxiredoxin-2 [Pseudonaja textilis]
314 4376 XP_032064446.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 21987 peroxiredoxin-2 [Thamnophis elegans]
314 4377 XP_013928980.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 21987 PREDICTED: peroxiredoxin-2 [Thamnophis sirtalis]
314 4378 XP_026537409.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 22065 peroxiredoxin-2-like [Notechis scutatus]
314 4379 XP_015670805.1 46.08 6 0000060000000 1.2045E5 1 1 0000010000000 N 21997 peroxiredoxin-2 isoform X1 [Protobothrops mucrosquamatus]
234 2136 AAG17443.1 45.43 6 0000000066000 2.7171E63.4765E7 1 1 0000000011000 Y 16641 phospholipase A2 [Ophiophagus hannah]
234 2137 Q9DF56.1 45.43 6 0000000066000 2.7171E63.4765E7 1 1 0000000011000 Y 16641 RecName: Full=Acidic phospholipase A2; Short=svPLA2; AltName: Full=Phosphatidylcholine 2-acylhydrolase; Flags: Precursor
485 2732 XP_026558429.1 45.05 1 0010000000000 1.8019E5 1 1 0010000000000 N 121887 dyslexia-associated protein KIAA0319-like protein homolog isoform X1 [Pseudonaja textilis]
485 2970 JAB54031.1 45.05 1 0010000000000 1.8019E5 1 1 0010000000000 N 122551 KIAA0319-like protein [Micrurus fulvius]
498 2807 XP_026544668.1 44.91 6 0006000000000 1.1359E6 1 1 0001000000000 N 30609 serum amyloid P-component-like, partial [Notechis scutatus]
210 4471 JAA75006.1 44.86 10 00000001000000 1.2644E8 1 1 0000000200000 Y 10504 3FTx-Ver-5 [Vermicella annulata]
495 2619 XP_015666657.1 44.69 6 0060000000000 2.6513E5 1 1 0010000000000 N 25001 mammalian ependymin-related protein 1 [Protobothrops mucrosquamatus]
495 3871 ETE58174.1 44.69 6 0060000000000 2.6513E5 1 1 0010000000000 N 24063 Mammalian ependymin-related protein 1, partial [Ophiophagus hannah]
433 2701 XP_026544778.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 62803 liver carboxylesterase 1 isoform X2 [Notechis scutatus]
433 2736 XP_013920173.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 62622 PREDICTED: liver carboxylesterase 1 [Thamnophis sirtalis]
433 2749 XP_032086793.1 44.50 1 0001000000000 7.2941E5 1 1 0001000000000 N 84309 LOW QUALITY PROTEIN: fatty acyl-CoA hydrolase precursor, medium chain-like [Thamnophis elegans]
433 2928 XP_034281500.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 62740 fatty acyl-CoA hydrolase precursor, medium chain-like [Pantherophis guttatus]
433 2929 XP_034281501.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 62740 fatty acyl-CoA hydrolase precursor, medium chain-like [Pantherophis guttatus]
433 3316 XP_026544777.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 62773 liver carboxylesterase 1 isoform X1 [Notechis scutatus]
433 3619 XP_026570249.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 52765 fatty acyl-CoA hydrolase precursor, medium chain-like isoform X1 [Pseudonaja textilis]
433 3620 XP_026570250.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 52795 fatty acyl-CoA hydrolase precursor, medium chain-like isoform X2 [Pseudonaja textilis]
433 3862 LAA68381.1 44.50 5 0005000000000 7.2941E5 1 1 0001000000000 N 27008 hypothetical protein, partial [Micrurus lemniscatus lemniscatus]
433 3914 XP_029139218.1 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 65042 LOW QUALITY PROTEIN: fatty acyl-CoA hydrolase precursor, medium chain-like [Protobothrops mucrosquamatus]
433 4133 XP_025028950.1 44.50 3 0003000000000 7.2941E5 1 1 0001000000000 N 37660 putative inactive carboxylesterase 4 isoform X2 [Python bivittatus]
433 4369 XP_007438289.2 44.50 2 0002000000000 7.2941E5 1 1 0001000000000 N 53443 fatty acyl-CoA hydrolase precursor, medium chain-like isoform X1 [Python bivittatus]
437 1958 XP_034279548.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 75325 amyloid-like protein 1 isoform X1 [Pantherophis guttatus]
437 1968 XP_034279549.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 76186 amyloid-like protein 1 isoform X2 [Pantherophis guttatus]
437 2105 XP_029140167.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 76188 amyloid-like protein 1 [Protobothrops mucrosquamatus]
437 2123 XP_026558172.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 80173 amyloid-like protein 1 [Pseudonaja textilis]
437 2127 XP_007441538.2 44.11 2 0000000200000 0 1 1 0000000100000 Y 77187 amyloid-like protein 1 isoform X1 [Python bivittatus]
437 2146 ETE66347.1 44.11 3 0000000300000 0 1 1 0000000100000 Y 57192 Amyloid-like protein 1 [Ophiophagus hannah]
437 2147 XP_026535207.1 44.11 3 0000000300000 0 1 1 0000000100000 Y 65333 amyloid-like protein 1 [Notechis scutatus]
437 2148 XP_007441537.2 44.11 2 0000000200000 0 1 1 0000000100000 Y 76326 amyloid-like protein 2 isoform X2 [Python bivittatus]
437 2369 XP_032084106.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 79520 amyloid-like protein 1 isoform X2 [Thamnophis elegans]
437 2370 XP_032084105.1 44.11 2 0000000200000 0 1 1 0000000100000 Y 80365 amyloid-like protein 1 isoform X1 [Thamnophis elegans]
437 2420 XP_013924423.1 44.11 3 0000000300000 0 1 1 0000000100000 Y 66589 PREDICTED: amyloid-like protein 1 [Thamnophis sirtalis]
437 2514 XP_015685842.1 44.11 7 0000000700000 0 1 1 0000000100000 Y 25758 amyloid-beta A4 protein-like, partial [Protobothrops mucrosquamatus]
359 2177 XP_026519977.1 42.97 0 0000000000000 3.9466E5 1 1 0000001000000 N 291780 protein SON isoform X4 [Notechis scutatus]
359 2178 XP_026519976.1 42.97 0 0000000000000 3.9466E5 1 1 0000001000000 N 313728 protein SON isoform X3 [Notechis scutatus]
359 2179 XP_026519975.1 42.97 0 0000000000000 3.9466E5 1 1 0000001000000 N 315606 protein SON isoform X2 [Notechis scutatus]
359 2181 XP_026519974.1 42.97 0 0000000000000 3.9466E5 1 1 0000001000000 N 330544 protein SON isoform X1 [Notechis scutatus]
388 2264 QGC85377.1 42.88 3 0000300000000 4.1894E5 1 1 0000100000000 N 55494 metalloproteinase, partial [Dispholidus typus]
273 1274 XP_032078280.1 42.65 7 0000700000000 1.5541E6 1 1 0000100000000 Y 15886 lymphocyte antigen 86 isoform X2 [Thamnophis elegans]
273 1275 XP_032078278.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 18124 lymphocyte antigen 86 isoform X1 [Thamnophis elegans]
273 1276 XP_032078279.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 18124 lymphocyte antigen 86 isoform X1 [Thamnophis elegans]
273 1277 LAB44273.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 17981 hypothetical protein [Micrurus spixii]
273 3247 LAA56518.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 17452 hypothetical protein, partial [Micrurus corallinus]
273 3248 XP_026570835.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 19799 lymphocyte antigen 86 [Pseudonaja textilis]
273 3249 XP_026532440.1 42.65 6 0000600000000 1.5541E6 1 1 0000100000000 Y 19701 lymphocyte antigen 86 [Notechis scutatus]
288 4170 XP_015673175.1 42.36 6 0060000000000 2.6866E6 1 1 0010000000000 Y 22501 testis-expressed protein 36 [Protobothrops mucrosquamatus]
total 681 proteins

2GIZ
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 85 98 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 52 66 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 67 84 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 67 84 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 113 126 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 29 51 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 39 51 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 140 156 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 15 26 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 39 51 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 66 84 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 177 188 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 143 156 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 70 84 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 28 38 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 38 51 PEAKS DB
NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 1 10 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 87 98 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 175 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 17 26 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 84 98 PEAKS DB
NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 1 11 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 208 217 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 116 126 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 85 94 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 67 82 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 55 66 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 29 38 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 163 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 117 126 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 144 156 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 28 38 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 29 38 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 19 26 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 40 51 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 2 10 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 173 188 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 57 66 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 85 99 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 69 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 67 82 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 162 188 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 119 126 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 85 95 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 118 126 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 89 98 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 88 98 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 67 78 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 170 188 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 66 84 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 28 51 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 15 23 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 85 93 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 36 51 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 114 126 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 29 51 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
1XX5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 85 98 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 52 66 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 67 84 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 67 84 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 113 126 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 29 51 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 39 51 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 140 156 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 15 26 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 39 51 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 66 84 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 177 188 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 143 156 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 70 84 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 28 38 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 38 51 PEAKS DB
NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 1 10 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 87 98 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 175 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 17 26 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 84 98 PEAKS DB
NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 1 11 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 208 217 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 116 126 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 85 94 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 67 82 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 55 66 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 29 38 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 163 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 117 126 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 144 156 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 28 38 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 29 38 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 19 26 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 40 51 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 2 10 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 173 188 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 57 66 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 85 99 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 69 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 67 82 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 162 188 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 119 126 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 85 95 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 118 126 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 89 98 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 88 98 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 67 78 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 170 188 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 66 84 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 28 51 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 15 23 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 85 93 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 36 51 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 114 126 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 29 51 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
3MZ8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 85 98 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 52 66 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 67 84 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 67 84 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 113 126 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 29 51 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 39 51 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 140 156 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 15 26 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 39 51 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 66 84 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 177 188 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 143 156 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 70 84 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 28 38 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 38 51 PEAKS DB
NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 1 10 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 87 98 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 175 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 17 26 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 84 98 PEAKS DB
NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 1 11 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 208 217 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 116 126 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 85 94 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 67 82 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 55 66 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 29 38 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 163 188 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 117 126 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 144 156 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 28 38 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 29 38 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 19 26 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 40 51 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 2 10 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 173 188 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 57 66 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 85 99 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 69 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 67 82 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 162 188 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 119 126 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 85 95 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 118 126 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 89 98 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 88 98 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 67 78 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 170 188 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 66 84 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 28 51 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 15 23 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 85 93 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 36 51 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 114 126 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 29 51 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
Q7T1K6.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 103 116 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 70 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 85 102 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 85 102 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 131 144 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 47 69 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 160 174 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 158 174 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 33 44 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 84 102 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 195 206 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 161 174 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 88 102 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 46 56 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 56 69 PEAKS DB
G.NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 19 28 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 105 116 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 193 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 35 44 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 102 116 PEAKS DB
G.NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 19 29 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 226 235 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 134 144 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 103 112 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 85 100 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 73 84 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 47 56 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 181 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 135 144 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 162 174 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 46 56 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 47 56 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 37 44 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 20 28 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 191 206 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 75 84 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 103 117 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 87 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 85 100 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 180 206 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 137 144 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 103 113 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 136 144 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 107 116 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 106 116 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 85 96 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 188 206 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 84 102 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 46 69 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 33 41 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 103 111 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 54 69 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 132 144 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 47 69 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
AAP85301.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 103 116 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 70 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 85 102 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 85 102 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 131 144 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 47 69 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 160 174 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 158 174 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 33 44 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 84 102 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 195 206 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 161 174 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 88 102 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 46 56 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 56 69 PEAKS DB
G.NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 19 28 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 105 116 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 193 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 35 44 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 102 116 PEAKS DB
G.NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 19 29 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 226 235 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 134 144 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 103 112 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 85 100 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 73 84 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 47 56 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 181 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 135 144 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 162 174 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 46 56 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 47 56 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 37 44 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 20 28 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 191 206 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 75 84 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 103 117 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 87 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 85 100 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 180 206 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 137 144 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 103 113 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 136 144 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 107 116 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 106 116 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 85 96 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 188 206 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 84 102 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 46 69 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 33 41 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 103 111 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 54 69 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 132 144 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 47 69 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
ACH73167.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 103 116 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 70 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 85 102 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 85 102 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 131 144 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 47 69 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 160 174 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 158 174 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 33 44 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 84 102 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 195 206 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 161 174 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 88 102 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 46 56 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 56 69 PEAKS DB
G.NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 19 28 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 105 116 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 193 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 35 44 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 102 116 PEAKS DB
G.NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 19 29 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 226 235 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 134 144 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 103 112 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 85 100 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 73 84 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 47 56 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 181 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 135 144 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 162 174 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 46 56 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 47 56 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 37 44 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 20 28 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 191 206 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 75 84 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 103 117 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 87 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 85 100 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 180 206 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 137 144 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 103 113 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 136 144 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 107 116 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 106 116 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 85 96 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 188 206 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 84 102 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 46 69 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 33 41 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 103 111 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 54 69 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 132 144 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 47 69 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
P84805.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TWTEIIHLWHDEYK.N Y 96.42 1869.9049 14 0.2 935.9600 2 67.88 4 F4:47092 NaNaKA16_F12.raw 1.192E101.3265E7 7 0005200000000 103 116 PEAKS DB
R.WANTC(+57.02)SLNHSPDNLR.V Y 95.37 1783.8060 15 -0.2 892.9102 2 20.57 4 F4:6149 NaNaKA16_F12.raw 2.5809E107.535E61.8333E5 20 00016300000100 70 84 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSNAR.T Y 94.89 2012.9296 18 0.0 1007.4721 2 61.49 4 F4:39775 NaNaKA16_F12.raw 5.2943E63.3626E77.5365E91.1193E70 16 0129400000000 85 102 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 91.90 2028.9244 18 -0.3 1015.4692 2 47.15 4 F4:28194 NaNaKA16_F12.raw 1.6305E54.9762E61.1167E91.3064E6 10 0117100000000 85 102 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
V.TGHYTQIVWYQTYR.A Y 79.15 1814.8740 14 0.5 908.4447 2 44.15 4 F4:25452 NaNaKA16_F12.raw 1.3608E8 2 0002000000000 131 144 PEAKS DB
R.VSPTASNMLKMEWYPEAASNAER.W N 79.04 2581.1941 23 2.4 861.4074 3 60.50 4 F4:38986 NaNaKA16_F12.raw 7.3936E7 2 0002000000000 47 69 PEAKS DB
Y.FYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 77.96 1853.7865 15 -0.4 927.9001 2 45.62 4 F4:26578 NaNaKA16_F12.raw 2.3019E7 1 0001000000000 160 174 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
W.SYFYVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 76.97 2103.8818 17 0.0 1052.9482 2 56.99 4 F4:35993 NaNaKA16_F12.raw 2.0613E7 1 0001000000000 158 174 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.QKEIVDLHNSLR.R N 76.76 1450.7892 12 -0.1 726.4018 2 11.75 4 F4:2056 NaNaKA16_F12.raw 8.0169E7 7 0007000000000 33 44 PEAKS DB
K.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYMSSNAR.T Y 75.04 2169.0308 19 -0.9 724.0169 3 42.93 4 F4:24321 NaNaKA16_F12.raw 1.5612E63.8584E6 2 0011000000000 84 102 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
N.GLC(+57.02)TNPC(+57.02)TIYNK.L Y 73.43 1439.6537 12 0.2 720.8342 2 27.20 4 F4:10879 NaNaKA16_F12.raw 3.9014E7 1 0001000000000 195 206 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
F.YVC(+57.02)QYC(+57.02)PSGNFQGK.T Y 71.81 1706.7181 14 0.0 854.3663 2 25.92 4 F4:10821 NaNaKA16_F12.raw 4.1439E8 1 0001000000000 161 174 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.GIQC(+57.02)GESIYMSSNAR.T Y 70.11 1671.7345 15 0.6 836.8750 2 29.85 4 F4:13323 NaNaKA16_F12.raw 1.3244E6 1 0001000000000 88 102 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNMLK.M Y 69.72 1202.6442 11 0.3 602.3295 2 11.45 4 F4:1801 NaNaKA16_F12.raw 1.7511E7 2 0002000000000 46 56 PEAKS DB
L.KMEWYPEAASNAER.W N 69.69 1680.7566 14 -0.9 561.2590 3 29.03 4 F4:12760 NaNaKA16_F12.raw 3.1822E7 2 0002000000000 56 69 PEAKS DB
G.NVDFNSESTR.R N 69.40 1167.5156 10 0.6 584.7654 2 12.15 4 F4:2376 NaNaKA16_F12.raw 8.6869E7 1 0001000000000 19 28 PEAKS DB
W.TEIIHLWHDEYK.N Y 68.88 1582.7780 12 0.3 528.6001 3 38.63 4 F4:20823 NaNaKA16_F12.raw 1.545E7 4 0004000000000 105 116 PEAKS DB
C.DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 68.73 1668.7236 14 0.5 835.3695 2 36.61 4 F4:19046 NaNaKA16_F12.raw 6.9202E67.9009E6 3 0001000020000 193 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.EIVDLHNSLR.R N 66.53 1194.6356 10 -0.4 598.3248 2 26.22 4 F4:11038 NaNaKA16_F12.raw 2.0613E59.1517E81.6717E6 7 0015100000000 35 44 PEAKS DB
A.RTWTEIIHLWHDEYK.N Y 65.27 2026.0061 15 -0.1 507.5088 4 59.52 4 F4:38212 NaNaKA16_F12.raw 2.6065E6 1 0001000000000 102 116 PEAKS DB
G.NVDFNSESTRR.K N 65.26 1323.6167 11 -0.1 662.8156 2 11.44 4 F4:1806 NaNaKA16_F12.raw 6.0739E6 2 0002000000000 19 29 PEAKS DB
K.SNC(+57.02)PASC(+57.02)FC(+57.02)R.N N 62.02 1257.4689 10 0.2 629.7418 2 12.25 4 F4:2426 NaNaKA16_F12.raw 6.4924E79.521E3 2 0001100000000 226 235 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYQTYR.A Y 61.61 1519.7460 11 0.1 760.8804 2 55.75 4 F4:34986 NaNaKA16_F12.raw 1.6068E8 2 0002000000000 134 144 PEAKS DB
R.TWTEIIHLWH.D Y 60.78 1334.6771 10 0.3 668.3461 2 73.98 4 F4:49966 NaNaKA16_F12.raw 4.783E6 1 0001000000000 103 112 PEAKS DB
R.VLEGIQC(+57.02)GESIYMSSN.A Y 58.92 1785.7914 16 -0.4 893.9026 2 68.70 4 F4:45706 NaNaKA16_F12.raw 1.3545E8 1 0001000000000 85 100 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)SLNHSPDNLR.V Y 56.85 1412.6466 12 0.5 707.3309 2 11.48 4 F4:1809 NaNaKA16_F12.raw 4.5467E6 2 0002000000000 73 84 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 47 56 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
K.LGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 56.61 2940.1970 26 1.2 981.0742 3 49.74 4 F4:29707 NaNaKA16_F12.raw 9.9063E8 2 0002000000000 181 206 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYQTYR.A Y 56.03 1356.6826 10 0.6 679.3490 2 49.37 4 F4:29565 NaNaKA16_F12.raw 3.2787E7 1 0001000000000 135 144 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PSGNFQGK.T Y 54.51 1543.6548 13 -0.3 772.8344 2 11.76 4 F4:2117 NaNaKA16_F12.raw 1.3951E6 1 0001000000000 162 174 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
R.RVSPTASNM(+15.99)LK.M Y 54.31 1218.6390 11 0.7 407.2206 3 11.48 4 F4:1808 NaNaKA16_F12.raw 4.4814E5 1 0001000000000 46 56 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
R.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 47 56 PEAKS DB
I.VDLHNSLR.R N 53.27 952.5090 8 0.1 477.2618 2 26.22 4 F4:10364 NaNaKA16_F12.raw 3.6616E7 1 0001000000000 37 44 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
N.VDFNSESTR.R N 52.01 1053.4727 9 0.6 527.7439 2 11.66 4 F4:1931 NaNaKA16_F12.raw 9.3775E6 1 0001000000000 20 28 PEAKS DB
S.AC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 51.74 1899.7914 16 -0.3 950.9027 2 33.35 4 F4:16304 NaNaKA16_F12.raw 3.0888E6 1 0001000000000 191 206 Carbamidomethylation C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.SLNHSPDNLR.V Y 50.57 1151.5684 10 -0.3 384.8633 3 11.45 4 F4:1803 NaNaKA16_F12.raw 3.3986E6 2 0002000000000 75 84 PEAKS DB
R.TWTEIIHLWHDEYKN.F Y 49.28 1983.9479 15 -0.2 496.9941 4 67.43 4 F4:44938 NaNaKA16_F12.raw 1.7614E7 2 0002000000000 103 117 PEAKS DB
L.EGIQC(+57.02)GESIYMSSNAR.T Y 48.30 1800.7771 16 0.9 901.3966 2 35.87 4 F4:18384 NaNaKA16_F12.raw 0 0 0000000000000 87 102 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.VLEGIQC(+57.02)GESIYM(+15.99)SSN.A Y 48.10 1801.7863 16 0.0 901.9004 2 59.91 4 F4:38428 NaNaKA16_F12.raw 1.9592E7 1 0001000000000 85 100 Carbamidomethylation; Oxidation (M) C7:Carbamidomethylation:1000.00;M13:Oxidation (M):1000.00 PEAKS DB
Y.KLGPPC(+57.02)GDC(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 48.02 3068.2917 27 1.2 1023.7724 3 40.46 4 F4:22361 NaNaKA16_F12.raw 7.6949E6 1 0001000000000 180 206 Carbamidomethylation C6:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
Q.IVWYQTYR.A Y 47.45 1127.5764 8 -5.9 564.7922 2 43.62 4 F4:24799 NaNaKA16_F12.raw 3.1475E7 2 0002000000000 137 144 PEAKS DB
R.TWTEIIHLWHD.E Y 47.44 1449.7041 11 0.4 484.2422 3 76.70 4 F4:52262 NaNaKA16_F12.raw 2.7409E6 1 0001000000000 103 113 PEAKS DB
T.QIVWYQTYR.A Y 46.03 1255.6349 9 0.0 628.8247 2 47.28 4 F4:27952 NaNaKA16_F12.raw 5.8793E6 1 0001000000000 136 144 PEAKS DB
E.IIHLWHDEYK.N N 45.95 1352.6877 10 -0.5 451.9030 3 26.85 4 F4:10987 NaNaKA16_F12.raw 8.808E5 1 0001000000000 107 116 PEAKS DB
T.EIIHLWHDEYK.N Y 44.66 1481.7302 11 0.1 494.9174 3 34.79 4 F4:17343 NaNaKA16_F12.raw 4.613E5 1 0001000000000 106 116 PEAKS DB
R.VLEGIQC(+57.02)GESIY.M Y 44.56 1366.6438 12 0.4 684.3295 2 64.32 4 F4:42048 NaNaKA16_F12.raw 1.267E8 1 0001000000000 85 96 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
D.C(+57.02)PSAC(+57.02)DNGLC(+57.02)TNPC(+57.02)TIYNK.L Y 44.19 2243.9067 19 0.6 1122.9613 2 36.03 4 F4:18539 NaNaKA16_F12.raw 1.1206E6 1 0001000000000 188 206 Carbamidomethylation C1:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
L.RVLEGIQC(+57.02)GESIYM(+15.99)SSNAR.T Y 43.71 2185.0256 19 0.8 729.3497 3 36.11 4 F4:18487 NaNaKA16_F12.raw 6.1752E5 1 0001000000000 84 102 Carbamidomethylation; Oxidation (M) C8:Carbamidomethylation:1000.00;M14:Oxidation (M):1000.00 PEAKS DB
R.RVSPTASNMLKMEWYPEAASNAER.W Y 43.34 2737.2952 24 1.4 685.3320 4 51.07 4 F4:31143 NaNaKA16_F12.raw 1.6942E6 1 0001000000000 46 69 PEAKS DB
K.QKEIVDLHN.S N 43.18 1094.5720 9 -0.5 548.2930 2 11.57 4 F4:1902 NaNaKA16_F12.raw 1.3713E5 1 0001000000000 33 41 PEAKS DB
R.TWTEIIHLW.H Y 42.97 1197.6183 9 0.1 599.8165 2 92.08 4 F4:64706 NaNaKA16_F12.raw 2.1391E6 1 0001000000000 103 111 PEAKS DB
N.MLKMEWYPEAASNAER.W N 42.97 1924.8811 16 0.5 642.6346 3 48.79 4 F4:29214 NaNaKA16_F12.raw 1.0448E6 1 0001000000000 54 69 PEAKS DB
T.GHYTQIVWYQTYR.A Y 42.91 1713.8263 13 -0.2 572.2826 3 43.93 4 F4:25228 NaNaKA16_F12.raw 2.5056E6 1 0001000000000 132 144 PEAKS DB
R.VSPTASNMLKM(+15.99)EWYPEAASNAER.W N 41.81 2597.1890 23 -0.1 866.7368 3 60.59 4 F4:38922 NaNaKA16_F12.raw 1.7447E6 1 0001000000000 47 69 Oxidation (M) M11:Oxidation (M):22.34 PEAKS DB
total 57 peptides
AVX27607.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLAGAGHK.V N 116.89 2234.1992 24 0.4 745.7407 3 62.90 13 F13:39164 NaNaKA16_F9.raw 1.1179E81.0168E77.8612E64.7423E62.5143E7 12 0322000000023 54 77 PEAKS DB
K.TC(+57.02)ADIVINDLSLIHDLPK.R N 85.41 2036.0612 18 1.1 679.6951 3 82.21 3 F3:55460 NaNaKA16_F11.raw 6.8273E62.6259E61.2527E7 5 0212000000000 405 422 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.TFVTADYVIVC(+57.02)STSR.A N 84.19 1717.8345 15 0.1 859.9246 2 61.23 4 F4:39837 NaNaKA16_F12.raw 1.1036E61.0862E61.2599E78.2211E55.3578E5 6 0112100000010 300 314 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.FHGWIDSTIMTGLR.A Y 83.58 1632.8082 14 0.3 817.4116 2 67.68 4 F4:45214 NaNaKA16_F12.raw 3.2243E78.0897E56.2437E78.2725E62.2165E7 17 02110000000022 478 491 PEAKS DB
H.VVVVGAGMAGLSAAYVLAGAGHK.V N 76.18 2097.1404 23 0.9 700.0547 3 74.20 2 F2:49558 NaNaKA16_F10.raw 1.7277E6 1 0100000000000 55 77 PEAKS DB
F.TPYQFQDYFESAAAPVGR.I Y 75.29 2045.9482 18 0.0 1023.9814 2 72.61 4 F4:48939 NaNaKA16_F12.raw 1.9418E6 1 0001000000000 450 467 PEAKS DB
R.IYFEPPLPPK.K N 75.25 1199.6589 10 0.1 600.8368 2 57.78 4 F4:36626 NaNaKA16_F12.raw 3.3521E64.7257E62.469E72.9029E79.7178E6 7 0111100300000 319 328 PEAKS DB
Y.VLADDSDFFQALDTK.T N 75.15 1683.7991 15 0.9 842.9075 2 76.95 5 F5:31672 NaNaKA16_F13.raw 1.2528E7 1 0000100000000 390 404 PEAKS DB
K.REIQALC(+57.02)YPSIK.K N 74.57 1476.7759 12 -0.3 493.2658 3 32.85 4 F4:15922 NaNaKA16_F12.raw 1.3566E72.8894E62.7998E5 4 0002100000001 423 434 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
A.DIVINDLSLIHDLPK.R N 73.95 1703.9458 15 0.6 852.9807 2 80.37 4 F4:55290 NaNaKA16_F12.raw 2.9714E79.3836E63.0023E76.9266E5 7 0222000000010 408 422 PEAKS DB
Y.QFQDYFESAAAPVGR.I Y 73.75 1684.7844 15 1.1 843.4004 2 59.42 4 F4:38157 NaNaKA16_F12.raw 1.1155E77.003E6 6 0003300000000 453 467 PEAKS DB
R.EIQALC(+57.02)YPSIK.K N 73.42 1320.6747 11 -0.2 661.3445 2 47.89 3 F3:27602 NaNaKA16_F11.raw 01.5106E73.3878E72.1775E73.2256E6 4 0011100000001 424 434 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.HVVVVGAGM(+15.99)AGLSAAYVLAGAGHK.V N 72.68 2250.1943 24 0.0 563.5558 4 52.57 2 F2:30632 NaNaKA16_F10.raw 4.3956E62.4715E52.5443E6 4 0201000000001 54 77 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
A.DDSDFFQALDTK.T N 70.63 1400.6095 12 0.5 701.3124 2 73.59 4 F4:49585 NaNaKA16_F12.raw 6.7842E67.1261E5 2 0001000001000 393 404 PEAKS DB
K.SASQLYQESLR.K Y 67.47 1280.6360 11 -2.1 641.3239 2 26.70 6 F6:12667 NaNaKA16_F2.raw 4.263E72.3745E73.3503E6 3 0000110010000 171 181 PEAKS DB
Q.DYFESAAAPVGR.I Y 66.83 1281.5989 12 0.8 641.8073 2 43.00 6 F6:26794 NaNaKA16_F2.raw 1.3876E65.1422E51.2058E7 3 0110010000000 456 467 PEAKS DB
R.RIYFEPPLPPK.K N 66.53 1355.7601 11 0.2 452.9274 3 43.83 4 F4:25641 NaNaKA16_F12.raw 5.7564E51.1183E64.1789E63.0828E6 6 0311100000000 318 328 PEAKS DB
K.KFWEADGIHGGK.S N 66.46 1343.6622 12 -0.8 448.8943 3 17.58 5 F5:3842 NaNaKA16_F13.raw 2.6107E6 2 0000200000000 351 362 PEAKS DB
R.EGWYVNMGPMR.L N 63.13 1338.5850 11 0.2 670.2999 2 58.22 9 F9:38419 NaNaKA16_F5.raw 2.3017E63.4741E68.3473E61.0741E71.8901E64.3579E52.2555E6 7 0111100011010 99 109 PEAKS DB
N.DLSLIHDLPK.R N 62.72 1149.6393 10 1.4 575.8277 2 52.52 3 F3:29824 NaNaKA16_F11.raw 1.6899E67.7612E64.7179E6 4 0112000000000 413 422 PEAKS DB
R.FHGWIDSTIM(+15.99)TGLR.A Y 60.71 1648.8031 14 -0.3 550.6082 3 55.70 4 F4:35031 NaNaKA16_F12.raw 5.7355E52.9168E6 2 0101000000000 478 491 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
K.HVVVVGAGMAGLSAAY.V N 59.94 1500.7759 16 0.4 751.3955 2 61.71 5 F5:25523 NaNaKA16_F13.raw 6.9379E5 1 0000100000000 54 69 PEAKS DB
R.IHFAGEYTGR.F Y 59.47 1149.5566 10 1.4 384.1934 3 17.69 5 F5:3877 NaNaKA16_F13.raw 01.8101E7 2 0000200000000 468 477 PEAKS DB
K.FWEADGIHGGK.S N 57.27 1215.5673 11 -0.2 608.7908 2 22.40 5 F5:5921 NaNaKA16_F13.raw 1.8542E7 2 0000200000000 352 362 PEAKS DB
G.SITSFTPYQFQDYFESAAAPVGR.I Y 55.78 2581.2124 23 0.6 861.4119 3 92.74 4 F4:65226 NaNaKA16_F12.raw 6.4315E5 1 0001000000000 445 467 PEAKS DB
K.SDALFSYEK.R N 53.51 1058.4919 9 1.2 530.2539 2 36.12 5 F5:13813 NaNaKA16_F13.raw 1.7934E62.9321E7 2 0001100000000 242 250 PEAKS DB
R.EGWYVNM(+15.99)GPMR.L N 53.18 1354.5798 11 0.0 678.2972 2 41.87 4 F4:23544 NaNaKA16_F12.raw 1.2884E61.7705E6 2 0001100000000 99 109 Oxidation (M) M7:Oxidation (M):38.16 PEAKS DB
R.IYFEPPLPPKK.A N 51.41 1327.7539 11 0.3 664.8844 2 40.66 5 F5:16431 NaNaKA16_F13.raw 7.8644E57.4644E5 2 0001100000000 319 329 PEAKS DB
L.DKYTMGSITSFTPYQFQDYFESAAAPVGR.I Y 50.86 3276.5073 29 1.2 1093.1777 3 94.70 4 F4:66626 NaNaKA16_F12.raw 3.1812E6 1 0001000000000 439 467 PEAKS DB
I.YFEPPLPPK.K N 50.02 1086.5750 9 -0.2 544.2946 2 44.20 6 F6:28085 NaNaKA16_F2.raw 8.7131E6 1 0000010000000 320 328 PEAKS DB
A.DIVINDLSLIHDLPKR.E N 48.00 1860.0469 16 0.2 621.0230 3 65.80 2 F2:42289 NaNaKA16_F10.raw 7.1576E5 1 0100000000000 408 423 PEAKS DB
R.EGWYVNMGPM(+15.99)R.L N 47.08 1354.5798 11 0.3 678.2974 2 42.61 5 F5:17152 NaNaKA16_F13.raw 1.7705E6 1 0000100000000 99 109 Oxidation (M) M10:Oxidation (M):20.70 PEAKS DB
K.SASQLYQESLRK.V Y 45.54 1408.7310 12 0.0 470.5843 3 12.22 6 F6:2235 NaNaKA16_F2.raw 1.4677E6 1 0000010000000 171 182 PEAKS DB
S.FTPYQFQDYFESAAAPVGR.I Y 45.47 2193.0166 19 0.0 1097.5156 2 83.82 12 F12:59508 NaNaKA16_F8.raw 1.6948E6 1 0000000000010 449 467 PEAKS DB
K.VTLLEASER.V N 44.72 1016.5502 9 0.2 509.2825 2 26.63 5 F5:8576 NaNaKA16_F13.raw 4.1415E7 1 0000100000000 78 86 PEAKS DB
W.IDSTIMTGLR.A Y 43.99 1105.5801 10 6.1 553.7977 2 42.74 8 F8:23703 NaNaKA16_F4.raw 8.2584E5 1 0000000100000 482 491 PEAKS DB
K.YTMGSITSFTPYQFQDYFESAAAPVGR.I Y 43.77 3033.3855 27 0.6 1012.1364 3 100.71 4 F4:70262 NaNaKA16_F12.raw 7.0268E5 1 0001000000000 441 467 PEAKS DB
D.IVINDLSLIHDLPK.R N 42.85 1588.9188 14 -0.1 530.6469 3 68.04 4 F4:45149 NaNaKA16_F12.raw 0 0 0000000000000 409 422 PEAKS DB
total 38 peptides
5Z2G
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLAGAGHK.V N 116.89 2234.1992 24 0.4 745.7407 3 62.90 13 F13:39164 NaNaKA16_F9.raw 1.1179E81.0168E77.8612E64.7423E62.5143E7 12 0322000000023 54 77 PEAKS DB
K.TC(+57.02)ADIVINDLSLIHDLPK.R N 85.41 2036.0612 18 1.1 679.6951 3 82.21 3 F3:55460 NaNaKA16_F11.raw 6.8273E62.6259E61.2527E7 5 0212000000000 405 422 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.TFVTADYVIVC(+57.02)STSR.A N 84.19 1717.8345 15 0.1 859.9246 2 61.23 4 F4:39837 NaNaKA16_F12.raw 1.1036E61.0862E61.2599E78.2211E55.3578E5 6 0112100000010 300 314 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.FHGWIDSTIMTGLR.A Y 83.58 1632.8082 14 0.3 817.4116 2 67.68 4 F4:45214 NaNaKA16_F12.raw 3.2243E78.0897E56.2437E78.2725E62.2165E7 17 02110000000022 478 491 PEAKS DB
H.VVVVGAGMAGLSAAYVLAGAGHK.V N 76.18 2097.1404 23 0.9 700.0547 3 74.20 2 F2:49558 NaNaKA16_F10.raw 1.7277E6 1 0100000000000 55 77 PEAKS DB
F.TPYQFQDYFESAAAPVGR.I Y 75.29 2045.9482 18 0.0 1023.9814 2 72.61 4 F4:48939 NaNaKA16_F12.raw 1.9418E6 1 0001000000000 450 467 PEAKS DB
R.IYFEPPLPPK.K N 75.25 1199.6589 10 0.1 600.8368 2 57.78 4 F4:36626 NaNaKA16_F12.raw 3.3521E64.7257E62.469E72.9029E79.7178E6 7 0111100300000 319 328 PEAKS DB
Y.VLADDSDFFQALDTK.T N 75.15 1683.7991 15 0.9 842.9075 2 76.95 5 F5:31672 NaNaKA16_F13.raw 1.2528E7 1 0000100000000 390 404 PEAKS DB
K.REIQALC(+57.02)YPSIK.K N 74.57 1476.7759 12 -0.3 493.2658 3 32.85 4 F4:15922 NaNaKA16_F12.raw 1.3566E72.8894E62.7998E5 4 0002100000001 423 434 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
A.DIVINDLSLIHDLPK.R N 73.95 1703.9458 15 0.6 852.9807 2 80.37 4 F4:55290 NaNaKA16_F12.raw 2.9714E79.3836E63.0023E76.9266E5 7 0222000000010 408 422 PEAKS DB
Y.QFQDYFESAAAPVGR.I Y 73.75 1684.7844 15 1.1 843.4004 2 59.42 4 F4:38157 NaNaKA16_F12.raw 1.1155E77.003E6 6 0003300000000 453 467 PEAKS DB
R.EIQALC(+57.02)YPSIK.K N 73.42 1320.6747 11 -0.2 661.3445 2 47.89 3 F3:27602 NaNaKA16_F11.raw 01.5106E73.3878E72.1775E73.2256E6 4 0011100000001 424 434 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.HVVVVGAGM(+15.99)AGLSAAYVLAGAGHK.V N 72.68 2250.1943 24 0.0 563.5558 4 52.57 2 F2:30632 NaNaKA16_F10.raw 4.3956E62.4715E52.5443E6 4 0201000000001 54 77 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
A.DDSDFFQALDTK.T N 70.63 1400.6095 12 0.5 701.3124 2 73.59 4 F4:49585 NaNaKA16_F12.raw 6.7842E67.1261E5 2 0001000001000 393 404 PEAKS DB
K.SASQLYQESLR.K Y 67.47 1280.6360 11 -2.1 641.3239 2 26.70 6 F6:12667 NaNaKA16_F2.raw 4.263E72.3745E73.3503E6 3 0000110010000 171 181 PEAKS DB
Q.DYFESAAAPVGR.I Y 66.83 1281.5989 12 0.8 641.8073 2 43.00 6 F6:26794 NaNaKA16_F2.raw 1.3876E65.1422E51.2058E7 3 0110010000000 456 467 PEAKS DB
R.RIYFEPPLPPK.K N 66.53 1355.7601 11 0.2 452.9274 3 43.83 4 F4:25641 NaNaKA16_F12.raw 5.7564E51.1183E64.1789E63.0828E6 6 0311100000000 318 328 PEAKS DB
K.KFWEADGIHGGK.S N 66.46 1343.6622 12 -0.8 448.8943 3 17.58 5 F5:3842 NaNaKA16_F13.raw 2.6107E6 2 0000200000000 351 362 PEAKS DB
R.EGWYVNMGPMR.L N 63.13 1338.5850 11 0.2 670.2999 2 58.22 9 F9:38419 NaNaKA16_F5.raw 2.3017E63.4741E68.3473E61.0741E71.8901E64.3579E52.2555E6 7 0111100011010 99 109 PEAKS DB
N.DLSLIHDLPK.R N 62.72 1149.6393 10 1.4 575.8277 2 52.52 3 F3:29824 NaNaKA16_F11.raw 1.6899E67.7612E64.7179E6 4 0112000000000 413 422 PEAKS DB
R.FHGWIDSTIM(+15.99)TGLR.A Y 60.71 1648.8031 14 -0.3 550.6082 3 55.70 4 F4:35031 NaNaKA16_F12.raw 5.7355E52.9168E6 2 0101000000000 478 491 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
K.HVVVVGAGMAGLSAAY.V N 59.94 1500.7759 16 0.4 751.3955 2 61.71 5 F5:25523 NaNaKA16_F13.raw 6.9379E5 1 0000100000000 54 69 PEAKS DB
R.IHFAGEYTGR.F Y 59.47 1149.5566 10 1.4 384.1934 3 17.69 5 F5:3877 NaNaKA16_F13.raw 01.8101E7 2 0000200000000 468 477 PEAKS DB
K.FWEADGIHGGK.S N 57.27 1215.5673 11 -0.2 608.7908 2 22.40 5 F5:5921 NaNaKA16_F13.raw 1.8542E7 2 0000200000000 352 362 PEAKS DB
G.SITSFTPYQFQDYFESAAAPVGR.I Y 55.78 2581.2124 23 0.6 861.4119 3 92.74 4 F4:65226 NaNaKA16_F12.raw 6.4315E5 1 0001000000000 445 467 PEAKS DB
K.SDALFSYEK.R N 53.51 1058.4919 9 1.2 530.2539 2 36.12 5 F5:13813 NaNaKA16_F13.raw 1.7934E62.9321E7 2 0001100000000 242 250 PEAKS DB
R.EGWYVNM(+15.99)GPMR.L N 53.18 1354.5798 11 0.0 678.2972 2 41.87 4 F4:23544 NaNaKA16_F12.raw 1.2884E61.7705E6 2 0001100000000 99 109 Oxidation (M) M7:Oxidation (M):38.16 PEAKS DB
R.IYFEPPLPPKK.A N 51.41 1327.7539 11 0.3 664.8844 2 40.66 5 F5:16431 NaNaKA16_F13.raw 7.8644E57.4644E5 2 0001100000000 319 329 PEAKS DB
L.DKYTMGSITSFTPYQFQDYFESAAAPVGR.I Y 50.86 3276.5073 29 1.2 1093.1777 3 94.70 4 F4:66626 NaNaKA16_F12.raw 3.1812E6 1 0001000000000 439 467 PEAKS DB
I.YFEPPLPPK.K N 50.02 1086.5750 9 -0.2 544.2946 2 44.20 6 F6:28085 NaNaKA16_F2.raw 8.7131E6 1 0000010000000 320 328 PEAKS DB
A.DIVINDLSLIHDLPKR.E N 48.00 1860.0469 16 0.2 621.0230 3 65.80 2 F2:42289 NaNaKA16_F10.raw 7.1576E5 1 0100000000000 408 423 PEAKS DB
R.EGWYVNMGPM(+15.99)R.L N 47.08 1354.5798 11 0.3 678.2974 2 42.61 5 F5:17152 NaNaKA16_F13.raw 1.7705E6 1 0000100000000 99 109 Oxidation (M) M10:Oxidation (M):20.70 PEAKS DB
K.SASQLYQESLRK.V Y 45.54 1408.7310 12 0.0 470.5843 3 12.22 6 F6:2235 NaNaKA16_F2.raw 1.4677E6 1 0000010000000 171 182 PEAKS DB
S.FTPYQFQDYFESAAAPVGR.I Y 45.47 2193.0166 19 0.0 1097.5156 2 83.82 12 F12:59508 NaNaKA16_F8.raw 1.6948E6 1 0000000000010 449 467 PEAKS DB
K.VTLLEASER.V N 44.72 1016.5502 9 0.2 509.2825 2 26.63 5 F5:8576 NaNaKA16_F13.raw 4.1415E7 1 0000100000000 78 86 PEAKS DB
W.IDSTIMTGLR.A Y 43.99 1105.5801 10 6.1 553.7977 2 42.74 8 F8:23703 NaNaKA16_F4.raw 8.2584E5 1 0000000100000 482 491 PEAKS DB
K.YTMGSITSFTPYQFQDYFESAAAPVGR.I Y 43.77 3033.3855 27 0.6 1012.1364 3 100.71 4 F4:70262 NaNaKA16_F12.raw 7.0268E5 1 0001000000000 441 467 PEAKS DB
D.IVINDLSLIHDLPK.R N 42.85 1588.9188 14 -0.1 530.6469 3 68.04 4 F4:45149 NaNaKA16_F12.raw 0 0 0000000000000 409 422 PEAKS DB
total 38 peptides
A8QL58.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HVVVVGAGMAGLSAAYVLAGAGHK.V N 116.89 2234.1992 24 0.4 745.7407 3 62.90 13 F13:39164 NaNaKA16_F9.raw 1.1179E81.0168E77.8612E64.7423E62.5143E7 12 0322000000023 54 77 PEAKS DB
K.TC(+57.02)ADIVINDLSLIHDLPK.R N 85.41 2036.0612 18 1.1 679.6951 3 82.21 3 F3:55460 NaNaKA16_F11.raw 6.8273E62.6259E61.2527E7 5 0212000000000 405 422 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.TFVTADYVIVC(+57.02)STSR.A N 84.19 1717.8345 15 0.1 859.9246 2 61.23 4 F4:39837 NaNaKA16_F12.raw 1.1036E61.0862E61.2599E78.2211E55.3578E5 6 0112100000010 300 314 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.FHGWIDSTIMTGLR.A Y 83.58 1632.8082 14 0.3 817.4116 2 67.68 4 F4:45214 NaNaKA16_F12.raw 3.2243E78.0897E56.2437E78.2725E62.2165E7 17 02110000000022 478 491 PEAKS DB
H.VVVVGAGMAGLSAAYVLAGAGHK.V N 76.18 2097.1404 23 0.9 700.0547 3 74.20 2 F2:49558 NaNaKA16_F10.raw 1.7277E6 1 0100000000000 55 77 PEAKS DB
F.TPYQFQDYFESAAAPVGR.I Y 75.29 2045.9482 18 0.0 1023.9814 2 72.61 4 F4:48939 NaNaKA16_F12.raw 1.9418E6 1 0001000000000 450 467 PEAKS DB
R.IYFEPPLPPK.K N 75.25 1199.6589 10 0.1 600.8368 2 57.78 4 F4:36626 NaNaKA16_F12.raw 3.3521E64.7257E62.469E72.9029E79.7178E6 7 0111100300000 319 328 PEAKS DB
Y.VLADDSDFFQALDTK.T N 75.15 1683.7991 15 0.9 842.9075 2 76.95 5 F5:31672 NaNaKA16_F13.raw 1.2528E7 1 0000100000000 390 404 PEAKS DB
K.REIQALC(+57.02)YPSIK.K N 74.57 1476.7759 12 -0.3 493.2658 3 32.85 4 F4:15922 NaNaKA16_F12.raw 1.3566E72.8894E62.7998E5 4 0002100000001 423 434 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
A.DIVINDLSLIHDLPK.R N 73.95 1703.9458 15 0.6 852.9807 2 80.37 4 F4:55290 NaNaKA16_F12.raw 2.9714E79.3836E63.0023E76.9266E5 7 0222000000010 408 422 PEAKS DB
Y.QFQDYFESAAAPVGR.I Y 73.75 1684.7844 15 1.1 843.4004 2 59.42 4 F4:38157 NaNaKA16_F12.raw 1.1155E77.003E6 6 0003300000000 453 467 PEAKS DB
R.EIQALC(+57.02)YPSIK.K N 73.42 1320.6747 11 -0.2 661.3445 2 47.89 3 F3:27602 NaNaKA16_F11.raw 01.5106E73.3878E72.1775E73.2256E6 4 0011100000001 424 434 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.HVVVVGAGM(+15.99)AGLSAAYVLAGAGHK.V N 72.68 2250.1943 24 0.0 563.5558 4 52.57 2 F2:30632 NaNaKA16_F10.raw 4.3956E62.4715E52.5443E6 4 0201000000001 54 77 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
A.DDSDFFQALDTK.T N 70.63 1400.6095 12 0.5 701.3124 2 73.59 4 F4:49585 NaNaKA16_F12.raw 6.7842E67.1261E5 2 0001000001000 393 404 PEAKS DB
K.SASQLYQESLR.K Y 67.47 1280.6360 11 -2.1 641.3239 2 26.70 6 F6:12667 NaNaKA16_F2.raw 4.263E72.3745E73.3503E6 3 0000110010000 171 181 PEAKS DB
Q.DYFESAAAPVGR.I Y 66.83 1281.5989 12 0.8 641.8073 2 43.00 6 F6:26794 NaNaKA16_F2.raw 1.3876E65.1422E51.2058E7 3 0110010000000 456 467 PEAKS DB
R.RIYFEPPLPPK.K N 66.53 1355.7601 11 0.2 452.9274 3 43.83 4 F4:25641 NaNaKA16_F12.raw 5.7564E51.1183E64.1789E63.0828E6 6 0311100000000 318 328 PEAKS DB
K.KFWEADGIHGGK.S N 66.46 1343.6622 12 -0.8 448.8943 3 17.58 5 F5:3842 NaNaKA16_F13.raw 2.6107E6 2 0000200000000 351 362 PEAKS DB
R.EGWYVNMGPMR.L N 63.13 1338.5850 11 0.2 670.2999 2 58.22 9 F9:38419 NaNaKA16_F5.raw 2.3017E63.4741E68.3473E61.0741E71.8901E64.3579E52.2555E6 7 0111100011010 99 109 PEAKS DB
N.DLSLIHDLPK.R N 62.72 1149.6393 10 1.4 575.8277 2 52.52 3 F3:29824 NaNaKA16_F11.raw 1.6899E67.7612E64.7179E6 4 0112000000000 413 422 PEAKS DB
R.FHGWIDSTIM(+15.99)TGLR.A Y 60.71 1648.8031 14 -0.3 550.6082 3 55.70 4 F4:35031 NaNaKA16_F12.raw 5.7355E52.9168E6 2 0101000000000 478 491 Oxidation (M) M10:Oxidation (M):1000.00 PEAKS DB
K.HVVVVGAGMAGLSAAY.V N 59.94 1500.7759 16 0.4 751.3955 2 61.71 5 F5:25523 NaNaKA16_F13.raw 6.9379E5 1 0000100000000 54 69 PEAKS DB
R.IHFAGEYTGR.F Y 59.47 1149.5566 10 1.4 384.1934 3 17.69 5 F5:3877 NaNaKA16_F13.raw 01.8101E7 2 0000200000000 468 477 PEAKS DB
K.FWEADGIHGGK.S N 57.27 1215.5673 11 -0.2 608.7908 2 22.40 5 F5:5921 NaNaKA16_F13.raw 1.8542E7 2 0000200000000 352 362 PEAKS DB
G.SITSFTPYQFQDYFESAAAPVGR.I Y 55.78 2581.2124 23 0.6 861.4119 3 92.74 4 F4:65226 NaNaKA16_F12.raw 6.4315E5 1 0001000000000 445 467 PEAKS DB
K.SDALFSYEK.R N 53.51 1058.4919 9 1.2 530.2539 2 36.12 5 F5:13813 NaNaKA16_F13.raw 1.7934E62.9321E7 2 0001100000000 242 250 PEAKS DB
R.EGWYVNM(+15.99)GPMR.L N 53.18 1354.5798 11 0.0 678.2972 2 41.87 4 F4:23544 NaNaKA16_F12.raw 1.2884E61.7705E6 2 0001100000000 99 109 Oxidation (M) M7:Oxidation (M):38.16 PEAKS DB
R.IYFEPPLPPKK.A N 51.41 1327.7539 11 0.3 664.8844 2 40.66 5 F5:16431 NaNaKA16_F13.raw 7.8644E57.4644E5 2 0001100000000 319 329 PEAKS DB
L.DKYTMGSITSFTPYQFQDYFESAAAPVGR.I Y 50.86 3276.5073 29 1.2 1093.1777 3 94.70 4 F4:66626 NaNaKA16_F12.raw 3.1812E6 1 0001000000000 439 467 PEAKS DB
I.YFEPPLPPK.K N 50.02 1086.5750 9 -0.2 544.2946 2 44.20 6 F6:28085 NaNaKA16_F2.raw 8.7131E6 1 0000010000000 320 328 PEAKS DB
A.DIVINDLSLIHDLPKR.E N 48.00 1860.0469 16 0.2 621.0230 3 65.80 2 F2:42289 NaNaKA16_F10.raw 7.1576E5 1 0100000000000 408 423 PEAKS DB
R.EGWYVNMGPM(+15.99)R.L N 47.08 1354.5798 11 0.3 678.2974 2 42.61 5 F5:17152 NaNaKA16_F13.raw 1.7705E6 1 0000100000000 99 109 Oxidation (M) M10:Oxidation (M):20.70 PEAKS DB
K.SASQLYQESLRK.V Y 45.54 1408.7310 12 0.0 470.5843 3 12.22 6 F6:2235 NaNaKA16_F2.raw 1.4677E6 1 0000010000000 171 182 PEAKS DB
S.FTPYQFQDYFESAAAPVGR.I Y 45.47 2193.0166 19 0.0 1097.5156 2 83.82 12 F12:59508 NaNaKA16_F8.raw 1.6948E6 1 0000000000010 449 467 PEAKS DB
K.VTLLEASER.V N 44.72 1016.5502 9 0.2 509.2825 2 26.63 5 F5:8576 NaNaKA16_F13.raw 4.1415E7 1 0000100000000 78 86 PEAKS DB
W.IDSTIMTGLR.A Y 43.99 1105.5801 10 6.1 553.7977 2 42.74 8 F8:23703 NaNaKA16_F4.raw 8.2584E5 1 0000000100000 482 491 PEAKS DB
K.YTMGSITSFTPYQFQDYFESAAAPVGR.I Y 43.77 3033.3855 27 0.6 1012.1364 3 100.71 4 F4:70262 NaNaKA16_F12.raw 7.0268E5 1 0001000000000 441 467 PEAKS DB
D.IVINDLSLIHDLPK.R N 42.85 1588.9188 14 -0.1 530.6469 3 68.04 4 F4:45149 NaNaKA16_F12.raw 0 0 0000000000000 409 422 PEAKS DB
total 38 peptides
CAA45372.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 58 80 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 67 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLKAR.C N 86.87 2583.2539 23 0.0 862.0919 3 62.98 12 F12:41772 NaNaKA16_F8.raw 4.515E62.8262E71.4923E71.4692E7 5 0000000001211 96 118 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 82.29 2356.1157 21 -2.1 1179.0626 2 73.79 11 F11:49962 NaNaKA16_F7.raw 2.7376E82.6984E77.0178E76.5633E63.1038E72.7883E94.7656E102.4584E92.4535E10 74 0442200012231125 96 116 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 17 31 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 18 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLK.A N 74.44 1552.7157 13 0.1 777.3652 2 38.38 4 F4:20647 NaNaKA16_F12.raw 1.0864E77.8409E61.7533E76.5956E51.5969E73.4996E92.5425E91.4323E84.1292E8 10 0111100011112 104 116 PEAKS DB
F.AGAPYNDNNYNIDLK.A N 74.15 1680.7743 15 0.8 841.3951 2 39.58 12 F12:22604 NaNaKA16_F8.raw 1.9233E69.618E53.9059E64.7877E82.5646E84.8059E71.8544E9 9 0111000001311 102 116 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 71.67 2512.2168 22 0.3 838.4131 3 61.74 11 F11:40640 NaNaKA16_F7.raw 5.8961E77.0057E73.3382E7 4 0000000000211 95 116 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDNNYNIDLK.A N 70.87 1827.8428 16 0.3 914.9290 2 51.38 13 F13:29549 NaNaKA16_F9.raw 3.3389E76.5117E78.1033E62.2994E8 5 0000000001112 101 116 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 58 66 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 81 95 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLKAR.C N 70.03 1779.8540 15 0.1 594.2920 3 28.22 11 F11:14195 NaNaKA16_F7.raw 3.8065E61.1348E7 3 0000000001200 104 118 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 55 66 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 32 43 PEAKS DB
M.NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 2 17 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 68 80 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 69 80 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.IC(+57.02)FAGAPYNDNNYNIDLK.A N 61.89 2100.9575 18 0.5 1051.4866 2 63.78 13 F13:39698 NaNaKA16_F9.raw 9.6858E61.8845E76.9038E63.858E7 4 0000000001111 99 116 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 18 32 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNDNNYNIDLK.A N 61.56 2171.9946 19 1.2 1087.0059 2 65.58 13 F13:41436 NaNaKA16_F9.raw 1.0912E71.9483E7 2 0000000000101 98 116 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 33 43 PEAKS DB
A.GAPYNDNNYNIDLK.A N 58.77 1609.7372 14 -0.1 805.8758 2 38.63 10 F10:22911 NaNaKA16_F6.raw 4.2863E62.6962E61.5111E7 3 0000000001101 103 116 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KGDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L Y 58.08 3362.3003 29 0.4 1121.7745 3 27.28 11 F11:13291 NaNaKA16_F7.raw 6.9673E71.4844E7 2 0000000001100 67 95 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 22 31 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 18 43 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 19 31 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.AAIC(+57.02)FAGAPYNDNNYNIDLK.A N 56.55 2243.0317 20 -0.4 1122.5227 2 66.82 13 F13:42492 NaNaKA16_F9.raw 1.837E7 1 0000000000001 97 116 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
M.NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 2 11 PEAKS DB
P.YNDNNYNIDLK.A N 54.97 1384.6259 11 -5.4 693.3165 2 32.55 10 F10:17533 NaNaKA16_F6.raw 8.5654E7 1 0000000001000 106 116 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 65 80 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 96 107 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 59 66 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 57 66 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 20 31 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 21 31 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 8 17 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.PYNDNNYNIDLK.A N 48.26 1481.6786 12 0.7 741.8471 2 34.63 13 F13:15900 NaNaKA16_F9.raw 1.9835E62.598E6 2 0000000000101 105 116 PEAKS DB
K.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 12 31 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
M.NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 2 11 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 18 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 34 43 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 67 81 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 18 28 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
N.DNNYNIDLK.A N 44.51 1107.5197 9 1.1 554.7677 2 32.05 10 F10:17657 NaNaKA16_F6.raw 4.8851E79.5595E6 3 0000000002100 108 116 PEAKS DB
F.AGAPYNDNNYNIDLKAR.C N 42.93 1907.9126 17 0.4 636.9784 3 29.66 13 F13:11769 NaNaKA16_F9.raw 8.9691E5 1 0000000000001 102 118 PEAKS DB
total 46 peptides
1A3F
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLKAR.C N 86.87 2583.2539 23 0.0 862.0919 3 62.98 12 F12:41772 NaNaKA16_F8.raw 4.515E62.8262E71.4923E71.4692E7 5 0000000001211 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 82.29 2356.1157 21 -2.1 1179.0626 2 73.79 11 F11:49962 NaNaKA16_F7.raw 2.7376E82.6984E77.0178E76.5633E63.1038E72.7883E94.7656E102.4584E92.4535E10 74 0442200012231125 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLK.A N 74.44 1552.7157 13 0.1 777.3652 2 38.38 4 F4:20647 NaNaKA16_F12.raw 1.0864E77.8409E61.7533E76.5956E51.5969E73.4996E92.5425E91.4323E84.1292E8 10 0111100011112 103 115 PEAKS DB
F.AGAPYNDNNYNIDLK.A N 74.15 1680.7743 15 0.8 841.3951 2 39.58 12 F12:22604 NaNaKA16_F8.raw 1.9233E69.618E53.9059E64.7877E82.5646E84.8059E71.8544E9 9 0111000001311 101 115 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 71.67 2512.2168 22 0.3 838.4131 3 61.74 11 F11:40640 NaNaKA16_F7.raw 5.8961E77.0057E73.3382E7 4 0000000000211 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDNNYNIDLK.A N 70.87 1827.8428 16 0.3 914.9290 2 51.38 13 F13:29549 NaNaKA16_F9.raw 3.3389E76.5117E78.1033E62.2994E8 5 0000000001112 100 115 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLKAR.C N 70.03 1779.8540 15 0.1 594.2920 3 28.22 11 F11:14195 NaNaKA16_F7.raw 3.8065E61.1348E7 3 0000000001200 103 117 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.IC(+57.02)FAGAPYNDNNYNIDLK.A N 61.89 2100.9575 18 0.5 1051.4866 2 63.78 13 F13:39698 NaNaKA16_F9.raw 9.6858E61.8845E76.9038E63.858E7 4 0000000001111 98 115 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNDNNYNIDLK.A N 61.56 2171.9946 19 1.2 1087.0059 2 65.58 13 F13:41436 NaNaKA16_F9.raw 1.0912E71.9483E7 2 0000000000101 97 115 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
A.GAPYNDNNYNIDLK.A N 58.77 1609.7372 14 -0.1 805.8758 2 38.63 10 F10:22911 NaNaKA16_F6.raw 4.2863E62.6962E61.5111E7 3 0000000001101 102 115 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KGDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L Y 58.08 3362.3003 29 0.4 1121.7745 3 27.28 11 F11:13291 NaNaKA16_F7.raw 6.9673E71.4844E7 2 0000000001100 66 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.AAIC(+57.02)FAGAPYNDNNYNIDLK.A N 56.55 2243.0317 20 -0.4 1122.5227 2 66.82 13 F13:42492 NaNaKA16_F9.raw 1.837E7 1 0000000000001 96 115 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
P.YNDNNYNIDLK.A N 54.97 1384.6259 11 -5.4 693.3165 2 32.55 10 F10:17533 NaNaKA16_F6.raw 8.5654E7 1 0000000001000 105 115 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.PYNDNNYNIDLK.A N 48.26 1481.6786 12 0.7 741.8471 2 34.63 13 F13:15900 NaNaKA16_F9.raw 1.9835E62.598E6 2 0000000000101 104 115 PEAKS DB
K.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
N.DNNYNIDLK.A N 44.51 1107.5197 9 1.1 554.7677 2 32.05 10 F10:17657 NaNaKA16_F6.raw 4.8851E79.5595E6 3 0000000002100 107 115 PEAKS DB
F.AGAPYNDNNYNIDLKAR.C N 42.93 1907.9126 17 0.4 636.9784 3 29.66 13 F13:11769 NaNaKA16_F9.raw 8.9691E5 1 0000000000001 101 117 PEAKS DB
total 46 peptides
1A3D
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLKAR.C N 86.87 2583.2539 23 0.0 862.0919 3 62.98 12 F12:41772 NaNaKA16_F8.raw 4.515E62.8262E71.4923E71.4692E7 5 0000000001211 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 82.29 2356.1157 21 -2.1 1179.0626 2 73.79 11 F11:49962 NaNaKA16_F7.raw 2.7376E82.6984E77.0178E76.5633E63.1038E72.7883E94.7656E102.4584E92.4535E10 74 0442200012231125 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLK.A N 74.44 1552.7157 13 0.1 777.3652 2 38.38 4 F4:20647 NaNaKA16_F12.raw 1.0864E77.8409E61.7533E76.5956E51.5969E73.4996E92.5425E91.4323E84.1292E8 10 0111100011112 103 115 PEAKS DB
F.AGAPYNDNNYNIDLK.A N 74.15 1680.7743 15 0.8 841.3951 2 39.58 12 F12:22604 NaNaKA16_F8.raw 1.9233E69.618E53.9059E64.7877E82.5646E84.8059E71.8544E9 9 0111000001311 101 115 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 71.67 2512.2168 22 0.3 838.4131 3 61.74 11 F11:40640 NaNaKA16_F7.raw 5.8961E77.0057E73.3382E7 4 0000000000211 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDNNYNIDLK.A N 70.87 1827.8428 16 0.3 914.9290 2 51.38 13 F13:29549 NaNaKA16_F9.raw 3.3389E76.5117E78.1033E62.2994E8 5 0000000001112 100 115 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLKAR.C N 70.03 1779.8540 15 0.1 594.2920 3 28.22 11 F11:14195 NaNaKA16_F7.raw 3.8065E61.1348E7 3 0000000001200 103 117 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.IC(+57.02)FAGAPYNDNNYNIDLK.A N 61.89 2100.9575 18 0.5 1051.4866 2 63.78 13 F13:39698 NaNaKA16_F9.raw 9.6858E61.8845E76.9038E63.858E7 4 0000000001111 98 115 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNDNNYNIDLK.A N 61.56 2171.9946 19 1.2 1087.0059 2 65.58 13 F13:41436 NaNaKA16_F9.raw 1.0912E71.9483E7 2 0000000000101 97 115 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
A.GAPYNDNNYNIDLK.A N 58.77 1609.7372 14 -0.1 805.8758 2 38.63 10 F10:22911 NaNaKA16_F6.raw 4.2863E62.6962E61.5111E7 3 0000000001101 102 115 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KGDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L Y 58.08 3362.3003 29 0.4 1121.7745 3 27.28 11 F11:13291 NaNaKA16_F7.raw 6.9673E71.4844E7 2 0000000001100 66 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.AAIC(+57.02)FAGAPYNDNNYNIDLK.A N 56.55 2243.0317 20 -0.4 1122.5227 2 66.82 13 F13:42492 NaNaKA16_F9.raw 1.837E7 1 0000000000001 96 115 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
P.YNDNNYNIDLK.A N 54.97 1384.6259 11 -5.4 693.3165 2 32.55 10 F10:17533 NaNaKA16_F6.raw 8.5654E7 1 0000000001000 105 115 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.PYNDNNYNIDLK.A N 48.26 1481.6786 12 0.7 741.8471 2 34.63 13 F13:15900 NaNaKA16_F9.raw 1.9835E62.598E6 2 0000000000101 104 115 PEAKS DB
K.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
N.DNNYNIDLK.A N 44.51 1107.5197 9 1.1 554.7677 2 32.05 10 F10:17657 NaNaKA16_F6.raw 4.8851E79.5595E6 3 0000000002100 107 115 PEAKS DB
F.AGAPYNDNNYNIDLKAR.C N 42.93 1907.9126 17 0.4 636.9784 3 29.66 13 F13:11769 NaNaKA16_F9.raw 8.9691E5 1 0000000000001 101 117 PEAKS DB
total 46 peptides
P15445.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLKAR.C N 86.87 2583.2539 23 0.0 862.0919 3 62.98 12 F12:41772 NaNaKA16_F8.raw 4.515E62.8262E71.4923E71.4692E7 5 0000000001211 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 82.29 2356.1157 21 -2.1 1179.0626 2 73.79 11 F11:49962 NaNaKA16_F7.raw 2.7376E82.6984E77.0178E76.5633E63.1038E72.7883E94.7656E102.4584E92.4535E10 74 0442200012231125 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLK.A N 74.44 1552.7157 13 0.1 777.3652 2 38.38 4 F4:20647 NaNaKA16_F12.raw 1.0864E77.8409E61.7533E76.5956E51.5969E73.4996E92.5425E91.4323E84.1292E8 10 0111100011112 103 115 PEAKS DB
F.AGAPYNDNNYNIDLK.A N 74.15 1680.7743 15 0.8 841.3951 2 39.58 12 F12:22604 NaNaKA16_F8.raw 1.9233E69.618E53.9059E64.7877E82.5646E84.8059E71.8544E9 9 0111000001311 101 115 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 71.67 2512.2168 22 0.3 838.4131 3 61.74 11 F11:40640 NaNaKA16_F7.raw 5.8961E77.0057E73.3382E7 4 0000000000211 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDNNYNIDLK.A N 70.87 1827.8428 16 0.3 914.9290 2 51.38 13 F13:29549 NaNaKA16_F9.raw 3.3389E76.5117E78.1033E62.2994E8 5 0000000001112 100 115 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLKAR.C N 70.03 1779.8540 15 0.1 594.2920 3 28.22 11 F11:14195 NaNaKA16_F7.raw 3.8065E61.1348E7 3 0000000001200 103 117 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.IC(+57.02)FAGAPYNDNNYNIDLK.A N 61.89 2100.9575 18 0.5 1051.4866 2 63.78 13 F13:39698 NaNaKA16_F9.raw 9.6858E61.8845E76.9038E63.858E7 4 0000000001111 98 115 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNDNNYNIDLK.A N 61.56 2171.9946 19 1.2 1087.0059 2 65.58 13 F13:41436 NaNaKA16_F9.raw 1.0912E71.9483E7 2 0000000000101 97 115 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
A.GAPYNDNNYNIDLK.A N 58.77 1609.7372 14 -0.1 805.8758 2 38.63 10 F10:22911 NaNaKA16_F6.raw 4.2863E62.6962E61.5111E7 3 0000000001101 102 115 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KGDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L Y 58.08 3362.3003 29 0.4 1121.7745 3 27.28 11 F11:13291 NaNaKA16_F7.raw 6.9673E71.4844E7 2 0000000001100 66 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.AAIC(+57.02)FAGAPYNDNNYNIDLK.A N 56.55 2243.0317 20 -0.4 1122.5227 2 66.82 13 F13:42492 NaNaKA16_F9.raw 1.837E7 1 0000000000001 96 115 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
P.YNDNNYNIDLK.A N 54.97 1384.6259 11 -5.4 693.3165 2 32.55 10 F10:17533 NaNaKA16_F6.raw 8.5654E7 1 0000000001000 105 115 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.PYNDNNYNIDLK.A N 48.26 1481.6786 12 0.7 741.8471 2 34.63 13 F13:15900 NaNaKA16_F9.raw 1.9835E62.598E6 2 0000000000101 104 115 PEAKS DB
K.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
N.DNNYNIDLK.A N 44.51 1107.5197 9 1.1 554.7677 2 32.05 10 F10:17657 NaNaKA16_F6.raw 4.8851E79.5595E6 3 0000000002100 107 115 PEAKS DB
F.AGAPYNDNNYNIDLKAR.C N 42.93 1907.9126 17 0.4 636.9784 3 29.66 13 F13:11769 NaNaKA16_F9.raw 8.9691E5 1 0000000000001 101 117 PEAKS DB
total 46 peptides
1PSH
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLKAR.C N 86.87 2583.2539 23 0.0 862.0919 3 62.98 12 F12:41772 NaNaKA16_F8.raw 4.515E62.8262E71.4923E71.4692E7 5 0000000001211 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 82.29 2356.1157 21 -2.1 1179.0626 2 73.79 11 F11:49962 NaNaKA16_F7.raw 2.7376E82.6984E77.0178E76.5633E63.1038E72.7883E94.7656E102.4584E92.4535E10 74 0442200012231125 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLK.A N 74.44 1552.7157 13 0.1 777.3652 2 38.38 4 F4:20647 NaNaKA16_F12.raw 1.0864E77.8409E61.7533E76.5956E51.5969E73.4996E92.5425E91.4323E84.1292E8 10 0111100011112 103 115 PEAKS DB
F.AGAPYNDNNYNIDLK.A N 74.15 1680.7743 15 0.8 841.3951 2 39.58 12 F12:22604 NaNaKA16_F8.raw 1.9233E69.618E53.9059E64.7877E82.5646E84.8059E71.8544E9 9 0111000001311 101 115 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDNNYNIDLK.A N 71.67 2512.2168 22 0.3 838.4131 3 61.74 11 F11:40640 NaNaKA16_F7.raw 5.8961E77.0057E73.3382E7 4 0000000000211 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDNNYNIDLK.A N 70.87 1827.8428 16 0.3 914.9290 2 51.38 13 F13:29549 NaNaKA16_F9.raw 3.3389E76.5117E78.1033E62.2994E8 5 0000000001112 100 115 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDNNYNIDLKAR.C N 70.03 1779.8540 15 0.1 594.2920 3 28.22 11 F11:14195 NaNaKA16_F7.raw 3.8065E61.1348E7 3 0000000001200 103 117 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
A.IC(+57.02)FAGAPYNDNNYNIDLK.A N 61.89 2100.9575 18 0.5 1051.4866 2 63.78 13 F13:39698 NaNaKA16_F9.raw 9.6858E61.8845E76.9038E63.858E7 4 0000000001111 98 115 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
A.AIC(+57.02)FAGAPYNDNNYNIDLK.A N 61.56 2171.9946 19 1.2 1087.0059 2 65.58 13 F13:41436 NaNaKA16_F9.raw 1.0912E71.9483E7 2 0000000000101 97 115 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
A.GAPYNDNNYNIDLK.A N 58.77 1609.7372 14 -0.1 805.8758 2 38.63 10 F10:22911 NaNaKA16_F6.raw 4.2863E62.6962E61.5111E7 3 0000000001101 102 115 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KGDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L Y 58.08 3362.3003 29 0.4 1121.7745 3 27.28 11 F11:13291 NaNaKA16_F7.raw 6.9673E71.4844E7 2 0000000001100 66 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C20:Carbamidomethylation:1000.00;C25:Carbamidomethylation:1000.00;C27:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
L.AAIC(+57.02)FAGAPYNDNNYNIDLK.A N 56.55 2243.0317 20 -0.4 1122.5227 2 66.82 13 F13:42492 NaNaKA16_F9.raw 1.837E7 1 0000000000001 96 115 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
P.YNDNNYNIDLK.A N 54.97 1384.6259 11 -5.4 693.3165 2 32.55 10 F10:17533 NaNaKA16_F6.raw 8.5654E7 1 0000000001000 105 115 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.PYNDNNYNIDLK.A N 48.26 1481.6786 12 0.7 741.8471 2 34.63 13 F13:15900 NaNaKA16_F9.raw 1.9835E62.598E6 2 0000000000101 104 115 PEAKS DB
K.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
N.DNNYNIDLK.A N 44.51 1107.5197 9 1.1 554.7677 2 32.05 10 F10:17657 NaNaKA16_F6.raw 4.8851E79.5595E6 3 0000000002100 107 115 PEAKS DB
F.AGAPYNDNNYNIDLKAR.C N 42.93 1907.9126 17 0.4 636.9784 3 29.66 13 F13:11769 NaNaKA16_F9.raw 8.9691E5 1 0000000000001 101 117 PEAKS DB
total 46 peptides
1YI5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
4AEA
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
1CTX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
2CTX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
P01391.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
1LXH
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
1LXG
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 97.32 2369.0198 20 5.0 1185.5167 2 30.34 8 F8:13936 NaNaKA16_F4.raw 5.2751E61.4938E64.2829E81.4347E91.578E93.3235E73.1822E66.4482E6 17 0110003541101 50 69 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 94.74 2240.9248 19 1.1 1121.4709 2 44.69 3 F3:24754 NaNaKA16_F11.raw 1.6333E87.7958E77.513E76.0306E65.3603E83.7554E105.9156E106.2024E103.6074E98.3057E72.6489E73.5028E8 108 0222221935303227 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.GVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 89.23 2139.8772 18 4.9 1070.9458 2 42.08 7 F7:20869 NaNaKA16_F3.raw 1.8625E71.2871E72.0018E7 5 0000001130000 51 68 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.VDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 86.06 2082.8557 17 5.7 1042.4355 2 40.37 8 F8:21741 NaNaKA16_F4.raw 9.4539E62.0548E74.7809E7 4 0000001120000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.IQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 84.44 1868.7604 15 0.1 935.3876 2 26.32 9 F9:12175 NaNaKA16_F5.raw 8.3412E66.6128E61.3076E62.197E83.1221E8 9 1000011330000 54 68 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 83.87 1983.7874 16 6.2 992.9019 2 37.25 8 F8:19226 NaNaKA16_F4.raw 8.8806E61.0298E71.017E75.0018E83.4519E7 9 0000011142000 53 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
Q.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 73.92 2369.0198 20 -0.3 1185.5168 2 30.58 9 F9:15182 NaNaKA16_F5.raw 4.0817E81.4066E91.5575E9 5 0000001220000 49 68 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRKRP Y 58.58 2622.1738 22 5.5 656.5510 4 25.48 7 F7:7710 NaNaKA16_F3.raw 01.7072E7 2 0000000020000 50 71 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
V.DIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 52.18 2111.8823 17 0.2 704.9682 3 22.55 9 F9:9549 NaNaKA16_F5.raw 3.3337E6 1 0000000010000 53 69 Carbamidomethylation C4:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPT.R Y 50.82 2084.8237 18 7.4 1043.4213 2 61.82 8 F8:39511 NaNaKA16_F4.raw 1.4461E81.6598E81.2556E91.4388E8 4 0000001111000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DAFC(+57.02)SIR.G N 50.20 1314.5486 10 0.4 658.2819 2 55.05 9 F9:35981 NaNaKA16_F5.raw 1.2559E7 1 0000000010000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
I.QC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 47.30 1755.6764 14 1.0 878.8463 2 22.00 1 F1:7265 NaNaKA16_F1.raw 8.1149E5 1 1000000000000 55 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
A.TC(+57.02)PTVKTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 44.77 2927.2671 25 -7.1 976.7509 3 63.76 8 F8:41290 NaNaKA16_F4.raw 7.0141E6 1 0000000100000 44 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.KTGVDIQC(+57.02)C(+57.02)STDNC(+57.02)NPFPTRK.R Y 42.67 2497.1147 21 5.2 625.2859 4 20.10 8 F8:6040 NaNaKA16_F4.raw 1.4274E6 1 0000000100000 49 69 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 31 peptides
AAS94269.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.GIDSSHWNSYC(+57.02)TETDTFIK.A N 103.21 2259.9744 19 0.4 1130.9949 2 51.96 13 F13:29726 NaNaKA16_F9.raw 3.1367E81.2423E77.064E62.5623E91.1361E71.4907E73.8727E8 19 0221000008114 193 211 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.EDHPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 97.91 2602.1870 23 0.9 868.4037 3 37.09 12 F12:20537 NaNaKA16_F8.raw 2.7036E86.8592E64.8528E64.7202E91.5853E77.7354E78.6437E8 30 04310000011335 126 148 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVMENVNLDNKVYK.Q N 89.49 2767.4062 25 0.1 923.4761 3 46.76 10 F10:30493 NaNaKA16_F6.raw 2.6398E66.2672E7 3 0100000002000 149 173 PEAKS DB
N.LGEHSVC(+57.02)DSVSAWVTK.T N 86.52 1773.8356 16 0.4 887.9254 2 46.38 2 F2:26570 NaNaKA16_F10.raw 1.1807E82.8318E6 4 0300000001000 133 148 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
E.DHPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 84.83 2473.1445 22 -0.1 825.3887 3 37.67 10 F10:21732 NaNaKA16_F6.raw 1.5802E84.8658E65.1183E7 8 0000000003014 127 148 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.GNTVTVMENVNLDNK.V N 83.96 1646.7933 15 0.6 824.4044 2 40.84 13 F13:21057 NaNaKA16_F9.raw 5.4691E72.4265E65.4824E62.2522E94.1291E64.3163E61.0123E8 18 0211000009212 156 170 PEAKS DB
K.GNTVTVM(+15.99)ENVNLDNK.V N 81.84 1662.7883 15 -0.2 832.4012 2 39.33 10 F10:25249 NaNaKA16_F6.raw 3.5104E8 11 00000000011000 156 170 Oxidation (M) M7:Oxidation (M):1000.00 PEAKS DB
K.ALTMEGNQASWR.F N 80.49 1362.6350 12 0.5 682.3251 2 33.00 11 F11:18088 NaNaKA16_F7.raw 1.1026E61.0384E71.8628E53.7415E95.9758E66.0181E61.0381E7 10 0101100003112 212 223 PEAKS DB
K.ALTM(+15.99)EGNQASWR.F N 77.54 1378.6299 12 -0.1 690.3221 2 19.80 10 F10:7091 NaNaKA16_F6.raw 3.2429E8 6 0000000006000 212 223 Oxidation (M) M4:Oxidation (M):1000.00 PEAKS DB
R.IDTAC(+57.02)VC(+57.02)VITK.K N 77.37 1278.6312 11 0.1 640.3229 2 33.63 10 F10:18937 NaNaKA16_F6.raw 4.3837E58.3453E62.1819E61.6909E94.6903E69.8784E6 8 0101010002102 227 237 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.TVTVMENVNLDNK.V N 76.68 1475.7290 13 -0.1 738.8717 2 38.38 10 F10:22544 NaNaKA16_F6.raw 5.0544E7 1 0000000001000 158 170 PEAKS DB
D.HPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 76.11 2358.1174 21 -0.2 590.5365 4 31.29 13 F13:13388 NaNaKA16_F9.raw 3.1467E66.048E74.5368E61.0948E7 5 0100000002011 128 148 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
P.VHNLGEHSVC(+57.02)DSVSAWVTK.T N 74.21 2124.0059 19 0.2 709.0094 3 38.53 2 F2:19930 NaNaKA16_F10.raw 6.7215E62.2348E6 2 0100000000001 130 148 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVMENVNLDNK.V N 72.26 2377.1794 22 0.7 793.4010 3 46.61 13 F13:25988 NaNaKA16_F9.raw 5.7149E79.9295E71.6066E67.6356E6 5 0100000002101 149 170 PEAKS DB
K.GNTVTVMENVNLDNKVYK.Q N 68.33 2037.0200 18 0.0 680.0140 3 40.94 10 F10:25126 NaNaKA16_F6.raw 1.592E61.2605E79.7102E5 4 0100000002001 156 173 PEAKS DB
H.NLGEHSVC(+57.02)DSVSAWVTK.T N 64.92 1887.8785 17 0.6 944.9471 2 47.73 2 F2:27755 NaNaKA16_F10.raw 2.3917E6 1 0100000000000 132 148 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.FIRIDTAC(+57.02)VC(+57.02)VITK.K N 63.81 1694.8848 14 -0.9 565.9684 3 50.26 10 F10:33096 NaNaKA16_F6.raw 2.9114E6 1 0000000001000 224 237 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
N.SYC(+57.02)TETDTFIK.A N 61.32 1363.5966 11 0.1 682.8056 2 33.68 10 F10:18512 NaNaKA16_F6.raw 2.51E66.55E82.6358E6 3 0001000001001 201 211 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.RIDTAC(+57.02)VC(+57.02)VITK.K N 59.60 1434.7323 12 -0.1 718.3734 2 24.70 6 F6:11037 NaNaKA16_F2.raw 1.966E71.6159E64.9245E5 5 0000020210000 226 237 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VYKQYFFETK.C Y 58.39 1351.6812 10 0.5 451.5679 3 28.15 10 F10:14035 NaNaKA16_F6.raw 7.2994E6 1 0000000001000 171 180 PEAKS DB
R.FIRIDTAC(+57.02)VC(+57.02)VITKK.T N 56.47 1822.9797 15 -0.4 456.7520 4 38.55 10 F10:22920 NaNaKA16_F6.raw 3.6578E6 1 0000000001000 224 238 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVM(+15.99)ENVNLDNK.V N 55.48 2393.1743 22 0.9 798.7328 3 32.04 10 F10:17489 NaNaKA16_F6.raw 6.6667E6 1 0000000001000 149 170 Oxidation (M) M14:Oxidation (M):1000.00 PEAKS DB
R.GIDSSHWNSY.C N 54.59 1164.4836 10 0.3 583.2493 2 32.17 10 F10:17444 NaNaKA16_F6.raw 1.7494E7 1 0000000001000 193 202 PEAKS DB
K.QYFFETK.C Y 54.39 961.4545 7 0.7 481.7349 2 34.22 9 F9:18329 NaNaKA16_F5.raw 2.1402E62.8298E61.9246E97.0917E5 6 0001000013001 174 180 PEAKS DB
K.REDHPVHNLGEHSVC(+57.02)DSVSAWVTK.T Y 46.52 2758.2881 24 -1.2 690.5785 4 33.98 10 F10:19035 NaNaKA16_F6.raw 0 0 0000000000000 125 148 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
K.GNTVTVMENVNL.D N 42.39 1289.6285 12 0.5 645.8219 2 65.97 10 F10:46212 NaNaKA16_F6.raw 1.2191E7 1 0000000001000 156 167 PEAKS DB
D.SSHWNSYC(+57.02)TETDTFIK.A N 42.21 1974.8418 16 0.0 659.2878 3 38.84 10 F10:22969 NaNaKA16_F6.raw 1.017E7 1 0000000001000 196 211 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 27 peptides
Q5YF89.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.GIDSSHWNSYC(+57.02)TETDTFIK.A N 103.21 2259.9744 19 0.4 1130.9949 2 51.96 13 F13:29726 NaNaKA16_F9.raw 3.1367E81.2423E77.064E62.5623E91.1361E71.4907E73.8727E8 19 0221000008114 193 211 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.EDHPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 97.91 2602.1870 23 0.9 868.4037 3 37.09 12 F12:20537 NaNaKA16_F8.raw 2.7036E86.8592E64.8528E64.7202E91.5853E77.7354E78.6437E8 30 04310000011335 126 148 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVMENVNLDNKVYK.Q N 89.49 2767.4062 25 0.1 923.4761 3 46.76 10 F10:30493 NaNaKA16_F6.raw 2.6398E66.2672E7 3 0100000002000 149 173 PEAKS DB
N.LGEHSVC(+57.02)DSVSAWVTK.T N 86.52 1773.8356 16 0.4 887.9254 2 46.38 2 F2:26570 NaNaKA16_F10.raw 1.1807E82.8318E6 4 0300000001000 133 148 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
E.DHPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 84.83 2473.1445 22 -0.1 825.3887 3 37.67 10 F10:21732 NaNaKA16_F6.raw 1.5802E84.8658E65.1183E7 8 0000000003014 127 148 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.GNTVTVMENVNLDNK.V N 83.96 1646.7933 15 0.6 824.4044 2 40.84 13 F13:21057 NaNaKA16_F9.raw 5.4691E72.4265E65.4824E62.2522E94.1291E64.3163E61.0123E8 18 0211000009212 156 170 PEAKS DB
K.GNTVTVM(+15.99)ENVNLDNK.V N 81.84 1662.7883 15 -0.2 832.4012 2 39.33 10 F10:25249 NaNaKA16_F6.raw 3.5104E8 11 00000000011000 156 170 Oxidation (M) M7:Oxidation (M):1000.00 PEAKS DB
K.ALTMEGNQASWR.F N 80.49 1362.6350 12 0.5 682.3251 2 33.00 11 F11:18088 NaNaKA16_F7.raw 1.1026E61.0384E71.8628E53.7415E95.9758E66.0181E61.0381E7 10 0101100003112 212 223 PEAKS DB
K.ALTM(+15.99)EGNQASWR.F N 77.54 1378.6299 12 -0.1 690.3221 2 19.80 10 F10:7091 NaNaKA16_F6.raw 3.2429E8 6 0000000006000 212 223 Oxidation (M) M4:Oxidation (M):1000.00 PEAKS DB
R.IDTAC(+57.02)VC(+57.02)VITK.K N 77.37 1278.6312 11 0.1 640.3229 2 33.63 10 F10:18937 NaNaKA16_F6.raw 4.3837E58.3453E62.1819E61.6909E94.6903E69.8784E6 8 0101010002102 227 237 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.TVTVMENVNLDNK.V N 76.68 1475.7290 13 -0.1 738.8717 2 38.38 10 F10:22544 NaNaKA16_F6.raw 5.0544E7 1 0000000001000 158 170 PEAKS DB
D.HPVHNLGEHSVC(+57.02)DSVSAWVTK.T N 76.11 2358.1174 21 -0.2 590.5365 4 31.29 13 F13:13388 NaNaKA16_F9.raw 3.1467E66.048E74.5368E61.0948E7 5 0100000002011 128 148 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
P.VHNLGEHSVC(+57.02)DSVSAWVTK.T N 74.21 2124.0059 19 0.2 709.0094 3 38.53 2 F2:19930 NaNaKA16_F10.raw 6.7215E62.2348E6 2 0100000000001 130 148 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVMENVNLDNK.V N 72.26 2377.1794 22 0.7 793.4010 3 46.61 13 F13:25988 NaNaKA16_F9.raw 5.7149E79.9295E71.6066E67.6356E6 5 0100000002101 149 170 PEAKS DB
K.GNTVTVMENVNLDNKVYK.Q N 68.33 2037.0200 18 0.0 680.0140 3 40.94 10 F10:25126 NaNaKA16_F6.raw 1.592E61.2605E79.7102E5 4 0100000002001 156 173 PEAKS DB
H.NLGEHSVC(+57.02)DSVSAWVTK.T N 64.92 1887.8785 17 0.6 944.9471 2 47.73 2 F2:27755 NaNaKA16_F10.raw 2.3917E6 1 0100000000000 132 148 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.FIRIDTAC(+57.02)VC(+57.02)VITK.K N 63.81 1694.8848 14 -0.9 565.9684 3 50.26 10 F10:33096 NaNaKA16_F6.raw 2.9114E6 1 0000000001000 224 237 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
N.SYC(+57.02)TETDTFIK.A N 61.32 1363.5966 11 0.1 682.8056 2 33.68 10 F10:18512 NaNaKA16_F6.raw 2.51E66.55E82.6358E6 3 0001000001001 201 211 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
I.RIDTAC(+57.02)VC(+57.02)VITK.K N 59.60 1434.7323 12 -0.1 718.3734 2 24.70 6 F6:11037 NaNaKA16_F2.raw 1.966E71.6159E64.9245E5 5 0000020210000 226 237 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VYKQYFFETK.C Y 58.39 1351.6812 10 0.5 451.5679 3 28.15 10 F10:14035 NaNaKA16_F6.raw 7.2994E6 1 0000000001000 171 180 PEAKS DB
R.FIRIDTAC(+57.02)VC(+57.02)VITKK.T N 56.47 1822.9797 15 -0.4 456.7520 4 38.55 10 F10:22920 NaNaKA16_F6.raw 3.6578E6 1 0000000001000 224 238 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.TTATDIKGNTVTVM(+15.99)ENVNLDNK.V N 55.48 2393.1743 22 0.9 798.7328 3 32.04 10 F10:17489 NaNaKA16_F6.raw 6.6667E6 1 0000000001000 149 170 Oxidation (M) M14:Oxidation (M):1000.00 PEAKS DB
R.GIDSSHWNSY.C N 54.59 1164.4836 10 0.3 583.2493 2 32.17 10 F10:17444 NaNaKA16_F6.raw 1.7494E7 1 0000000001000 193 202 PEAKS DB
K.QYFFETK.C Y 54.39 961.4545 7 0.7 481.7349 2 34.22 9 F9:18329 NaNaKA16_F5.raw 2.1402E62.8298E61.9246E97.0917E5 6 0001000013001 174 180 PEAKS DB
K.REDHPVHNLGEHSVC(+57.02)DSVSAWVTK.T Y 46.52 2758.2881 24 -1.2 690.5785 4 33.98 10 F10:19035 NaNaKA16_F6.raw 0 0 0000000000000 125 148 Carbamidomethylation C15:Carbamidomethylation:1000.00 PEAKS DB
K.GNTVTVMENVNL.D N 42.39 1289.6285 12 0.5 645.8219 2 65.97 10 F10:46212 NaNaKA16_F6.raw 1.2191E7 1 0000000001000 156 167 PEAKS DB
D.SSHWNSYC(+57.02)TETDTFIK.A N 42.21 1974.8418 16 0.0 659.2878 3 38.84 10 F10:22969 NaNaKA16_F6.raw 1.017E7 1 0000000001000 196 211 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 27 peptides
Q9PVK7.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 91.95 2982.2793 26 1.7 995.1021 3 54.73 9 F9:35402 NaNaKA16_F5.raw 1.7077E81.5002E84.1894E7 4 0000100021000 456 481 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 90.56 2712.1101 23 1.2 1357.0640 2 72.09 9 F9:50509 NaNaKA16_F5.raw 9.0813E74.1609E76.0829E6 6 0000200022000 459 481 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.LQGEIYFIEPLK.I Y 79.49 1448.7915 12 -0.4 725.4027 2 71.80 12 F12:49303 NaNaKA16_F8.raw 7.7381E69.8751E51.0165E61.432E79.2872E72.2471E7 6 0111000000111 124 135 PEAKS DB
K.C(+57.02)PIMTNQC(+57.02)IALR.G N 77.27 1475.7047 12 0.2 738.8598 2 38.95 9 F9:22183 NaNaKA16_F5.raw 5.0717E53.2472E51.9097E82.1736E84.0241E73.7147E64.6756E6 12 0011300022021 497 508 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.DPSYGMVEPGTK.C N 77.06 1279.5754 12 0.6 640.7954 2 29.06 10 F10:14931 NaNaKA16_F6.raw 4.4389E8 1 0000000001000 570 581 PEAKS DB
K.C(+57.02)PIM(+15.99)TNQC(+57.02)IALR.G N 75.90 1491.6996 12 -0.8 746.8564 2 29.62 9 F9:14662 NaNaKA16_F5.raw 3.2733E78.8589E62.9095E6 7 0000400021000 497 508 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M4:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NSMIC(+57.02)NC(+57.02)SISPR.D N 75.66 1437.6163 12 0.1 719.8155 2 24.50 5 F5:7209 NaNaKA16_F13.raw 6.4703E72.8886E62.2986E61.2892E5 4 0000100011100 558 569 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.TPVGLAYIGSIC(+57.02)NPK.T N 73.67 1588.8282 15 0.1 795.4215 2 60.14 12 F12:39283 NaNaKA16_F8.raw 1.0459E64.5255E6 2 0000000000110 293 307 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
N.GTPVGLAYIGSIC(+57.02)NPK.T N 73.11 1645.8497 16 0.4 823.9325 2 60.77 11 F11:39960 NaNaKA16_F7.raw 1.4933E63.1956E62.0263E7 3 0000100000110 292 307 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.DPSYGM(+15.99)VEPGTK.C N 69.32 1295.5703 12 -0.5 648.7921 2 28.08 10 F10:14794 NaNaKA16_F6.raw 6.1916E7 9 0000000009000 570 581 Oxidation (M) M6:Oxidation (M):1000.00 PEAKS DB
K.TSAAVVQDYSK.S Y 68.03 1167.5771 11 0.0 584.7958 2 17.55 5 F5:3663 NaNaKA16_F13.raw 1.026E7 2 0000200000000 308 318 PEAKS DB
R.TKPAYQFSSC(+57.02)SVR.E N 67.55 1529.7296 13 -0.1 765.8720 2 12.28 5 F5:2284 NaNaKA16_F13.raw 2.3942E8 2 0000200000000 358 370 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.ATLDLFGEWR.E N 65.68 1206.6033 10 0.9 604.3094 2 78.42 2 F2:53296 NaNaKA16_F10.raw 2.2448E63.9536E51.1467E75.6872E66.3509E51.6325E61.5953E6 8 0101200001111 260 269 PEAKS DB
R.NSM(+15.99)IC(+57.02)NC(+57.02)SISPR.D N 64.85 1453.6112 12 0.3 727.8131 2 22.81 5 F5:7058 NaNaKA16_F13.raw 7.9998E6 3 0000300000000 558 569 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.RTKPAYQFSSC(+57.02)SVR.E N 61.84 1685.8307 14 1.0 562.9514 3 11.85 5 F5:1803 NaNaKA16_F13.raw 1.7851E6 1 0000100000000 357 370 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 107 119 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.RNSMIC(+57.02)NC(+57.02)SISPR.D N 59.91 1593.7174 13 0.1 532.2465 3 12.17 5 F5:2067 NaNaKA16_F13.raw 7.3377E5 1 0000100000000 557 569 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.TGQSAEC(+57.02)PTDVFQR.N N 57.94 1594.7046 14 0.9 798.3603 2 31.39 5 F5:11052 NaNaKA16_F13.raw 8.9511E5 1 0000100000000 468 481 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.T N 57.18 1139.5029 9 0.1 570.7588 2 26.24 5 F5:8465 NaNaKA16_F13.raw 2.8674E88.7317E5 2 0000100001000 517 525 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.MVAITMAHEMGHNLGMNHDK.G Y 56.24 2236.0010 20 0.1 560.0076 4 33.19 12 F12:17336 NaNaKA16_F8.raw 3.3512E6 1 0000000000010 322 341 PEAKS DB
R.MVAITMAHEMGH.N N 55.46 1326.5883 12 0.8 664.3019 2 33.28 5 F5:12224 NaNaKA16_F13.raw 4.5918E6 1 0000100000000 322 333 PEAKS DB
W.SNINEINVQSDVK.A Y 55.08 1458.7314 13 0.2 730.3731 2 27.42 5 F5:8945 NaNaKA16_F13.raw 1.8809E6 1 0000100000000 247 259 PEAKS DB
K.PAYQFSSC(+57.02)SVR.E N 53.21 1300.5870 11 0.2 651.3009 2 25.11 5 F5:7381 NaNaKA16_F13.raw 5.016E7 1 0000100000000 360 370 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.TSLLTNTPEQDR.Y Y 51.47 1373.6787 12 0.4 687.8469 2 23.22 5 F5:6477 NaNaKA16_F13.raw 5.9896E5 1 0000100000000 176 187 PEAKS DB
K.C(+57.02)GDGMVC(+57.02)SNR.Q N 51.31 1154.4268 10 1.1 578.2213 2 11.85 5 F5:1806 NaNaKA16_F13.raw 4.5755E5 1 0000100000000 582 591 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.INEINVQSDVK.A Y 50.36 1257.6565 11 0.0 629.8355 2 23.51 5 F5:6491 NaNaKA16_F13.raw 2.41E6 1 0000100000000 249 259 PEAKS DB
Q.SAEC(+57.02)PTDVFQR.N N 49.48 1308.5768 11 0.4 655.2960 2 32.04 5 F5:11429 NaNaKA16_F13.raw 1.3941E7 1 0000100000000 471 481 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Y.MVVDNIMYR.H Y 48.66 1139.5468 9 0.0 570.7806 2 44.92 5 F5:18068 NaNaKA16_F13.raw 7.0995E7 1 0000100000000 199 207 PEAKS DB
S.NINEINVQSDVK.A Y 48.17 1371.6993 12 0.3 686.8572 2 27.44 5 F5:8958 NaNaKA16_F13.raw 1.1123E6 1 0000100000000 248 259 PEAKS DB
N.SMIC(+57.02)NC(+57.02)SISPR.D N 47.00 1323.5734 11 3.9 662.7966 2 23.55 5 F5:6539 NaNaKA16_F13.raw 0 0 0000000000000 559 569 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.LQHEAQC(+57.02)DSEEC(+57.02)C(+57.02)EK.C N 46.38 1921.7240 15 0.0 641.5820 3 11.83 5 F5:1808 NaNaKA16_F13.raw 2.9375E5 1 0000100000000 430 444 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 379 391 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGM(+15.99)VC(+57.02)SNR.Q N 45.27 1170.4216 10 0.3 586.2183 2 11.84 5 F5:1815 NaNaKA16_F13.raw 9.9702E4 1 0000100000000 582 591 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M5:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
Y.MVVDNIM(+15.99)YR.H Y 41.81 1155.5416 9 -0.2 578.7780 2 32.88 5 F5:12042 NaNaKA16_F13.raw 6.8639E6 1 0000100000000 199 207 Oxidation (M) M7:Oxidation (M):95.35 PEAKS DB
total 34 peptides
AAF00693.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 91.95 2982.2793 26 1.7 995.1021 3 54.73 9 F9:35402 NaNaKA16_F5.raw 1.7077E81.5002E84.1894E7 4 0000100021000 456 481 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 90.56 2712.1101 23 1.2 1357.0640 2 72.09 9 F9:50509 NaNaKA16_F5.raw 9.0813E74.1609E76.0829E6 6 0000200022000 459 481 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.LQGEIYFIEPLK.I Y 79.49 1448.7915 12 -0.4 725.4027 2 71.80 12 F12:49303 NaNaKA16_F8.raw 7.7381E69.8751E51.0165E61.432E79.2872E72.2471E7 6 0111000000111 124 135 PEAKS DB
K.C(+57.02)PIMTNQC(+57.02)IALR.G N 77.27 1475.7047 12 0.2 738.8598 2 38.95 9 F9:22183 NaNaKA16_F5.raw 5.0717E53.2472E51.9097E82.1736E84.0241E73.7147E64.6756E6 12 0011300022021 497 508 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.DPSYGMVEPGTK.C N 77.06 1279.5754 12 0.6 640.7954 2 29.06 10 F10:14931 NaNaKA16_F6.raw 4.4389E8 1 0000000001000 570 581 PEAKS DB
K.C(+57.02)PIM(+15.99)TNQC(+57.02)IALR.G N 75.90 1491.6996 12 -0.8 746.8564 2 29.62 9 F9:14662 NaNaKA16_F5.raw 3.2733E78.8589E62.9095E6 7 0000400021000 497 508 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M4:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NSMIC(+57.02)NC(+57.02)SISPR.D N 75.66 1437.6163 12 0.1 719.8155 2 24.50 5 F5:7209 NaNaKA16_F13.raw 6.4703E72.8886E62.2986E61.2892E5 4 0000100011100 558 569 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.TPVGLAYIGSIC(+57.02)NPK.T N 73.67 1588.8282 15 0.1 795.4215 2 60.14 12 F12:39283 NaNaKA16_F8.raw 1.0459E64.5255E6 2 0000000000110 293 307 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
N.GTPVGLAYIGSIC(+57.02)NPK.T N 73.11 1645.8497 16 0.4 823.9325 2 60.77 11 F11:39960 NaNaKA16_F7.raw 1.4933E63.1956E62.0263E7 3 0000100000110 292 307 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.DPSYGM(+15.99)VEPGTK.C N 69.32 1295.5703 12 -0.5 648.7921 2 28.08 10 F10:14794 NaNaKA16_F6.raw 6.1916E7 9 0000000009000 570 581 Oxidation (M) M6:Oxidation (M):1000.00 PEAKS DB
K.TSAAVVQDYSK.S Y 68.03 1167.5771 11 0.0 584.7958 2 17.55 5 F5:3663 NaNaKA16_F13.raw 1.026E7 2 0000200000000 308 318 PEAKS DB
R.TKPAYQFSSC(+57.02)SVR.E N 67.55 1529.7296 13 -0.1 765.8720 2 12.28 5 F5:2284 NaNaKA16_F13.raw 2.3942E8 2 0000200000000 358 370 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.ATLDLFGEWR.E N 65.68 1206.6033 10 0.9 604.3094 2 78.42 2 F2:53296 NaNaKA16_F10.raw 2.2448E63.9536E51.1467E75.6872E66.3509E51.6325E61.5953E6 8 0101200001111 260 269 PEAKS DB
R.NSM(+15.99)IC(+57.02)NC(+57.02)SISPR.D N 64.85 1453.6112 12 0.3 727.8131 2 22.81 5 F5:7058 NaNaKA16_F13.raw 7.9998E6 3 0000300000000 558 569 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.RTKPAYQFSSC(+57.02)SVR.E N 61.84 1685.8307 14 1.0 562.9514 3 11.85 5 F5:1803 NaNaKA16_F13.raw 1.7851E6 1 0000100000000 357 370 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 107 119 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.RNSMIC(+57.02)NC(+57.02)SISPR.D N 59.91 1593.7174 13 0.1 532.2465 3 12.17 5 F5:2067 NaNaKA16_F13.raw 7.3377E5 1 0000100000000 557 569 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.TGQSAEC(+57.02)PTDVFQR.N N 57.94 1594.7046 14 0.9 798.3603 2 31.39 5 F5:11052 NaNaKA16_F13.raw 8.9511E5 1 0000100000000 468 481 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.T N 57.18 1139.5029 9 0.1 570.7588 2 26.24 5 F5:8465 NaNaKA16_F13.raw 2.8674E88.7317E5 2 0000100001000 517 525 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.MVAITMAHEMGHNLGMNHDK.G Y 56.24 2236.0010 20 0.1 560.0076 4 33.19 12 F12:17336 NaNaKA16_F8.raw 3.3512E6 1 0000000000010 322 341 PEAKS DB
R.MVAITMAHEMGH.N N 55.46 1326.5883 12 0.8 664.3019 2 33.28 5 F5:12224 NaNaKA16_F13.raw 4.5918E6 1 0000100000000 322 333 PEAKS DB
W.SNINEINVQSDVK.A Y 55.08 1458.7314 13 0.2 730.3731 2 27.42 5 F5:8945 NaNaKA16_F13.raw 1.8809E6 1 0000100000000 247 259 PEAKS DB
K.PAYQFSSC(+57.02)SVR.E N 53.21 1300.5870 11 0.2 651.3009 2 25.11 5 F5:7381 NaNaKA16_F13.raw 5.016E7 1 0000100000000 360 370 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.TSLLTNTPEQDR.Y Y 51.47 1373.6787 12 0.4 687.8469 2 23.22 5 F5:6477 NaNaKA16_F13.raw 5.9896E5 1 0000100000000 176 187 PEAKS DB
K.C(+57.02)GDGMVC(+57.02)SNR.Q N 51.31 1154.4268 10 1.1 578.2213 2 11.85 5 F5:1806 NaNaKA16_F13.raw 4.5755E5 1 0000100000000 582 591 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
N.INEINVQSDVK.A Y 50.36 1257.6565 11 0.0 629.8355 2 23.51 5 F5:6491 NaNaKA16_F13.raw 2.41E6 1 0000100000000 249 259 PEAKS DB
Q.SAEC(+57.02)PTDVFQR.N N 49.48 1308.5768 11 0.4 655.2960 2 32.04 5 F5:11429 NaNaKA16_F13.raw 1.3941E7 1 0000100000000 471 481 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Y.MVVDNIMYR.H Y 48.66 1139.5468 9 0.0 570.7806 2 44.92 5 F5:18068 NaNaKA16_F13.raw 7.0995E7 1 0000100000000 199 207 PEAKS DB
S.NINEINVQSDVK.A Y 48.17 1371.6993 12 0.3 686.8572 2 27.44 5 F5:8958 NaNaKA16_F13.raw 1.1123E6 1 0000100000000 248 259 PEAKS DB
N.SMIC(+57.02)NC(+57.02)SISPR.D N 47.00 1323.5734 11 3.9 662.7966 2 23.55 5 F5:6539 NaNaKA16_F13.raw 0 0 0000000000000 559 569 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.LQHEAQC(+57.02)DSEEC(+57.02)C(+57.02)EK.C N 46.38 1921.7240 15 0.0 641.5820 3 11.83 5 F5:1808 NaNaKA16_F13.raw 2.9375E5 1 0000100000000 430 444 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 379 391 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGM(+15.99)VC(+57.02)SNR.Q N 45.27 1170.4216 10 0.3 586.2183 2 11.84 5 F5:1815 NaNaKA16_F13.raw 9.9702E4 1 0000100000000 582 591 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M5:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
Y.MVVDNIM(+15.99)YR.H Y 41.81 1155.5416 9 -0.2 578.7780 2 32.88 5 F5:12042 NaNaKA16_F13.raw 6.8639E6 1 0000100000000 199 207 Oxidation (M) M7:Oxidation (M):95.35 PEAKS DB
total 34 peptides
XP_026544671.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGAYSYIESHPWQAGIFVK.N N 101.78 2109.0320 19 -0.3 1055.5229 2 65.05 4 F4:42731 NaNaKA16_F12.raw 5.8839E61.1656E75.0772E801.9031E6 10 0126000000001 292 310 PEAKS DB
I.KGGAYSYIESHPWQAGIFVK.N N 92.59 2237.1270 20 0.8 746.7169 3 55.07 4 F4:34289 NaNaKA16_F12.raw 2.0972E63.4652E7 3 0012000000000 291 310 PEAKS DB
Q.LPDWTEC(+57.02)EVSGYGK.H N 89.52 1639.7188 14 0.4 820.8669 2 53.18 4 F4:33245 NaNaKA16_F12.raw 2.4114E61.7456E75.2898E85.0846E5 6 0113100000000 416 429 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Y.SYIESHPWQAGIFVK.N N 86.86 1760.8885 15 0.0 881.4515 2 54.37 4 F4:33882 NaNaKA16_F12.raw 1.4376E7 2 0002000000000 296 310 PEAKS DB
K.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 77 95 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.Q N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 463 475 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.GTWSTTESGAEC(+57.02)VNWK.T N 79.36 1811.7784 16 0.6 906.8970 2 40.11 11 F11:23748 NaNaKA16_F7.raw 3.6435E62.669E79.2931E6 3 0001000001100 115 130 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
R.LYPDSFC(+57.02)TSAR.L N 69.84 1315.5867 11 0.6 658.8010 2 33.08 4 F4:16532 NaNaKA16_F12.raw 5.6231E86.5311E5 2 0001100000000 448 458 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 150 159 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.Q N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 463 475 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Q.IKGGAYSYIESHPWQAGIFVK.N N 64.84 2350.2109 21 0.7 588.5604 4 57.69 4 F4:36700 NaNaKA16_F12.raw 1.8752E61.979E7 3 0012000000000 290 310 PEAKS DB
K.HEMSSPFHSER.L Y 63.71 1342.5724 11 -0.1 448.5314 3 11.45 4 F4:1812 NaNaKA16_F12.raw 1.6186E6 1 0001000000000 430 440 PEAKS DB
K.SSKPWC(+57.02)HVLK.R N 63.39 1240.6387 10 0.1 414.5535 3 12.10 11 F11:1845 NaNaKA16_F7.raw 2.6656E6 1 0000000000100 164 173 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.HEM(+15.99)SSPFHSER.L Y 63.34 1358.5674 11 -0.2 453.8630 3 11.45 4 F4:1807 NaNaKA16_F12.raw 4.1513E5 1 0001000000000 430 440 Oxidation (M) M3:Oxidation (M):1000.00 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 83 95 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 85 95 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 380 389 PEAKS DB
K.GGAYSYIESHPWQAGIFVKNR.G N 56.73 2379.1760 21 0.6 595.8016 4 55.04 4 F4:34397 NaNaKA16_F12.raw 1.2222E6 1 0001000000000 292 312 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 80 95 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.H N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 380 391 PEAKS DB
Y.IESHPWQAGIFVK.N N 45.33 1510.7932 13 0.4 504.6052 3 44.51 4 F4:25555 NaNaKA16_F12.raw 7.3497E5 1 0001000000000 298 310 PEAKS DB
K.QAYNWKESWLR.R Y 43.79 1479.7258 11 0.4 494.2494 3 39.94 11 F11:23494 NaNaKA16_F7.raw 8.9589E5 1 0000000000100 27 37 PEAKS DB
I.ESHPWQAGIFVK.N N 42.01 1397.7091 12 -1.2 699.8610 2 39.12 13 F13:19537 NaNaKA16_F9.raw 6.7594E5 1 0000000000001 299 310 PEAKS DB
total 23 peptides
ACH73168.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.IGC(+57.02)GENLFMSSQPYAWSR.V Y 91.49 2101.9351 18 0.0 1051.9749 2 72.04 3 F3:46337 NaNaKA16_F11.raw 1.3602E73.9929E83.8506E7 6 0222000000000 90 107 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 91.36 2550.2288 22 1.1 1276.1230 2 83.73 3 F3:56509 NaNaKA16_F11.raw 2.391E77.701E74.861E7 8 0242000000000 158 179 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 89.24 1848.8247 16 -0.1 925.4196 2 49.03 3 F3:28088 NaNaKA16_F11.raw 9.3217E71.2893E98.3194E7 10 0172000000000 54 69 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 83.61 1864.8196 16 0.5 933.4175 2 35.34 3 F3:18162 NaNaKA16_F11.raw 2.1836E81.6881E7 9 0063000000000 54 69 Oxidation (M) M5:Oxidation (M):78.06 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 82.80 1864.8196 16 2.7 933.4196 2 48.27 3 F3:27735 NaNaKA16_F11.raw 2.3687E88.0538E6 9 0081000000000 54 69 Oxidation (M) M2:Oxidation (M):91.37 PEAKS DB
Q.YC(+57.02)PAGNIIGSIATPYK.S N 81.36 1723.8604 16 0.9 862.9382 2 63.36 3 F3:39220 NaNaKA16_F11.raw 2.5562E7 2 0020000000000 164 179 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYNSHLLGC(+57.02)GAAK.C Y 80.75 2080.0200 18 -0.1 1041.0172 2 55.41 3 F3:32205 NaNaKA16_F11.raw 2.0551E71.9181E6 3 0021000000000 135 152 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.IGC(+57.02)GENLFM(+15.99)SSQPYAWSR.V Y 79.45 2117.9299 18 1.3 1059.9736 2 64.65 3 F3:40437 NaNaKA16_F11.raw 1.0083E88.4481E86.9317E7 9 0234000000000 90 107 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
C.QYC(+57.02)PAGNIIGSIATPYK.S N 76.59 1851.9188 17 0.8 926.9674 2 64.28 3 F3:39934 NaNaKA16_F11.raw 6.9974E6 3 0030000000000 163 179 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)PAGNIIGSIATPYK.S N 75.44 1560.7970 15 0.4 781.4061 2 55.64 3 F3:32530 NaNaKA16_F11.raw 1.6565E72.6149E6 5 0032000000000 165 179 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGH.Y N 74.39 1569.7939 16 0.1 785.9044 2 54.74 4 F4:34170 NaNaKA16_F12.raw 1.3128E62.8221E76.0658E6 3 0111000000000 119 134 PEAKS DB
R.NMLQMEWNSNAAQNAKR.W N 70.72 2004.9258 17 -0.1 669.3158 3 36.44 3 F3:17827 NaNaKA16_F11.raw 4.2399E6 1 0010000000000 54 70 PEAKS DB
Q.IVWYNSHLLGC(+57.02)GAAK.C Y 66.82 1687.8505 15 -0.1 563.6240 3 45.96 3 F3:25859 NaNaKA16_F11.raw 1.167E7 2 0020000000000 138 152 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.H N 64.25 2406.9482 22 2.2 803.3251 3 33.04 3 F3:14934 NaNaKA16_F11.raw 4.4345E73.0856E6 2 0011000000000 180 201 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
N.PPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 63.95 2824.4119 26 1.2 707.1111 4 68.85 3 F3:43871 NaNaKA16_F11.raw 2.0238E66.4925E6 2 0110000000000 127 152 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 61.96 1734.7817 15 0.2 868.3983 2 42.10 3 F3:22578 NaNaKA16_F11.raw 1.0377E7 1 0010000000000 55 69 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 60.72 2111.0181 19 0.5 1056.5168 2 67.50 3 F3:42701 NaNaKA16_F11.raw 3.3686E62.1087E6 2 0011000000000 161 179 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
A.GNIIGSIATPYK.S N 58.43 1232.6765 12 -0.2 617.3454 2 46.96 3 F3:26760 NaNaKA16_F11.raw 2.4959E6 1 0010000000000 168 179 PEAKS DB
K.QNAC(+57.02)QTEWMK.S Y 58.40 1294.5435 10 0.1 648.2791 2 41.31 3 F3:21944 NaNaKA16_F11.raw 4.4811E5 1 0010000000000 215 224 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHY.T N 57.66 1732.8573 17 1.1 867.4369 2 61.67 3 F3:37669 NaNaKA16_F11.raw 5.3586E6 1 0010000000000 119 135 PEAKS DB
C.PAGNIIGSIATPYK.S N 56.00 1400.7664 14 0.0 701.3904 2 51.58 3 F3:29077 NaNaKA16_F11.raw 7.112E5 1 0010000000000 166 179 PEAKS DB
K.FVYGVGANPPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 54.12 3631.8035 34 0.9 908.9590 4 82.67 4 F4:57037 NaNaKA16_F12.raw 5.2429E61.58E7 2 0101000000000 119 152 Carbamidomethylation C30:Carbamidomethylation:1000.00 PEAKS DB
R.VIQSWYDENKK.F N 54.01 1408.6986 11 -0.3 705.3564 2 11.80 3 F3:2163 NaNaKA16_F11.raw 6.7786E61.1269E6 3 0021000000000 108 118 PEAKS DB
R.C(+57.02)SFAHSPPHLR.T N 52.64 1307.6193 11 0.9 436.8807 3 11.47 4 F4:1824 NaNaKA16_F12.raw 3.3923E5 1 0001000000000 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGN.I N 48.44 1506.6272 12 0.2 754.3210 2 57.46 3 F3:34059 NaNaKA16_F11.raw 1.5296E74.5046E6 2 0011000000000 158 169 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYNSHLLGC(+57.02)GAAK.C Y 46.64 1916.9567 17 1.2 639.9936 3 50.10 3 F3:28369 NaNaKA16_F11.raw 0 0 0000000000000 136 152 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHYTQ.I N 45.19 1961.9635 19 1.6 981.9906 2 60.19 3 F3:36550 NaNaKA16_F11.raw 4.6839E6 1 0010000000000 119 137 PEAKS DB
total 27 peptides
P84808.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.IGC(+57.02)GENLFMSSQPYAWSR.V Y 91.49 2101.9351 18 0.0 1051.9749 2 72.04 3 F3:46337 NaNaKA16_F11.raw 1.3602E73.9929E83.8506E7 6 0222000000000 90 107 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 91.36 2550.2288 22 1.1 1276.1230 2 83.73 3 F3:56509 NaNaKA16_F11.raw 2.391E77.701E74.861E7 8 0242000000000 158 179 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 89.24 1848.8247 16 -0.1 925.4196 2 49.03 3 F3:28088 NaNaKA16_F11.raw 9.3217E71.2893E98.3194E7 10 0172000000000 54 69 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 83.61 1864.8196 16 0.5 933.4175 2 35.34 3 F3:18162 NaNaKA16_F11.raw 2.1836E81.6881E7 9 0063000000000 54 69 Oxidation (M) M5:Oxidation (M):78.06 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 82.80 1864.8196 16 2.7 933.4196 2 48.27 3 F3:27735 NaNaKA16_F11.raw 2.3687E88.0538E6 9 0081000000000 54 69 Oxidation (M) M2:Oxidation (M):91.37 PEAKS DB
Q.YC(+57.02)PAGNIIGSIATPYK.S N 81.36 1723.8604 16 0.9 862.9382 2 63.36 3 F3:39220 NaNaKA16_F11.raw 2.5562E7 2 0020000000000 164 179 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYNSHLLGC(+57.02)GAAK.C Y 80.75 2080.0200 18 -0.1 1041.0172 2 55.41 3 F3:32205 NaNaKA16_F11.raw 2.0551E71.9181E6 3 0021000000000 135 152 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.IGC(+57.02)GENLFM(+15.99)SSQPYAWSR.V Y 79.45 2117.9299 18 1.3 1059.9736 2 64.65 3 F3:40437 NaNaKA16_F11.raw 1.0083E88.4481E86.9317E7 9 0234000000000 90 107 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
C.QYC(+57.02)PAGNIIGSIATPYK.S N 76.59 1851.9188 17 0.8 926.9674 2 64.28 3 F3:39934 NaNaKA16_F11.raw 6.9974E6 3 0030000000000 163 179 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)PAGNIIGSIATPYK.S N 75.44 1560.7970 15 0.4 781.4061 2 55.64 3 F3:32530 NaNaKA16_F11.raw 1.6565E72.6149E6 5 0032000000000 165 179 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGH.Y N 74.39 1569.7939 16 0.1 785.9044 2 54.74 4 F4:34170 NaNaKA16_F12.raw 1.3128E62.8221E76.0658E6 3 0111000000000 119 134 PEAKS DB
R.NMLQMEWNSNAAQNAKR.W N 70.72 2004.9258 17 -0.1 669.3158 3 36.44 3 F3:17827 NaNaKA16_F11.raw 4.2399E6 1 0010000000000 54 70 PEAKS DB
Q.IVWYNSHLLGC(+57.02)GAAK.C Y 66.82 1687.8505 15 -0.1 563.6240 3 45.96 3 F3:25859 NaNaKA16_F11.raw 1.167E7 2 0020000000000 138 152 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.H N 64.25 2406.9482 22 2.2 803.3251 3 33.04 3 F3:14934 NaNaKA16_F11.raw 4.4345E73.0856E6 2 0011000000000 180 201 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
N.PPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 63.95 2824.4119 26 1.2 707.1111 4 68.85 3 F3:43871 NaNaKA16_F11.raw 2.0238E66.4925E6 2 0110000000000 127 152 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 61.96 1734.7817 15 0.2 868.3983 2 42.10 3 F3:22578 NaNaKA16_F11.raw 1.0377E7 1 0010000000000 55 69 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 60.72 2111.0181 19 0.5 1056.5168 2 67.50 3 F3:42701 NaNaKA16_F11.raw 3.3686E62.1087E6 2 0011000000000 161 179 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
A.GNIIGSIATPYK.S N 58.43 1232.6765 12 -0.2 617.3454 2 46.96 3 F3:26760 NaNaKA16_F11.raw 2.4959E6 1 0010000000000 168 179 PEAKS DB
K.QNAC(+57.02)QTEWMK.S Y 58.40 1294.5435 10 0.1 648.2791 2 41.31 3 F3:21944 NaNaKA16_F11.raw 4.4811E5 1 0010000000000 215 224 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHY.T N 57.66 1732.8573 17 1.1 867.4369 2 61.67 3 F3:37669 NaNaKA16_F11.raw 5.3586E6 1 0010000000000 119 135 PEAKS DB
C.PAGNIIGSIATPYK.S N 56.00 1400.7664 14 0.0 701.3904 2 51.58 3 F3:29077 NaNaKA16_F11.raw 7.112E5 1 0010000000000 166 179 PEAKS DB
K.FVYGVGANPPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 54.12 3631.8035 34 0.9 908.9590 4 82.67 4 F4:57037 NaNaKA16_F12.raw 5.2429E61.58E7 2 0101000000000 119 152 Carbamidomethylation C30:Carbamidomethylation:1000.00 PEAKS DB
R.VIQSWYDENKK.F N 54.01 1408.6986 11 -0.3 705.3564 2 11.80 3 F3:2163 NaNaKA16_F11.raw 6.7786E61.1269E6 3 0021000000000 108 118 PEAKS DB
R.C(+57.02)SFAHSPPHLR.T N 52.64 1307.6193 11 0.9 436.8807 3 11.47 4 F4:1824 NaNaKA16_F12.raw 3.3923E5 1 0001000000000 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGN.I N 48.44 1506.6272 12 0.2 754.3210 2 57.46 3 F3:34059 NaNaKA16_F11.raw 1.5296E74.5046E6 2 0011000000000 158 169 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYNSHLLGC(+57.02)GAAK.C Y 46.64 1916.9567 17 1.2 639.9936 3 50.10 3 F3:28369 NaNaKA16_F11.raw 0 0 0000000000000 136 152 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHYTQ.I N 45.19 1961.9635 19 1.6 981.9906 2 60.19 3 F3:36550 NaNaKA16_F11.raw 4.6839E6 1 0010000000000 119 137 PEAKS DB
total 27 peptides
AHZ08822.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.IGC(+57.02)GENLFMSSQPYAWSR.V Y 91.49 2101.9351 18 0.0 1051.9749 2 72.04 3 F3:46337 NaNaKA16_F11.raw 1.3602E73.9929E83.8506E7 6 0222000000000 90 107 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 91.36 2550.2288 22 1.1 1276.1230 2 83.73 3 F3:56509 NaNaKA16_F11.raw 2.391E77.701E74.861E7 8 0242000000000 158 179 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NMLQMEWNSNAAQNAK.R N 89.24 1848.8247 16 -0.1 925.4196 2 49.03 3 F3:28088 NaNaKA16_F11.raw 9.3217E71.2893E98.3194E7 10 0172000000000 54 69 PEAKS DB
R.NMLQM(+15.99)EWNSNAAQNAK.R N 83.61 1864.8196 16 0.5 933.4175 2 35.34 3 F3:18162 NaNaKA16_F11.raw 2.1836E81.6881E7 9 0063000000000 54 69 Oxidation (M) M5:Oxidation (M):78.06 PEAKS DB
R.NM(+15.99)LQMEWNSNAAQNAK.R N 82.80 1864.8196 16 2.7 933.4196 2 48.27 3 F3:27735 NaNaKA16_F11.raw 2.3687E88.0538E6 9 0081000000000 54 69 Oxidation (M) M2:Oxidation (M):91.37 PEAKS DB
Q.YC(+57.02)PAGNIIGSIATPYK.S N 81.36 1723.8604 16 0.9 862.9382 2 63.36 3 F3:39220 NaNaKA16_F11.raw 2.5562E7 2 0020000000000 164 179 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
H.YTQIVWYNSHLLGC(+57.02)GAAK.C Y 80.75 2080.0200 18 -0.1 1041.0172 2 55.41 3 F3:32205 NaNaKA16_F11.raw 2.0551E71.9181E6 3 0021000000000 135 152 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
K.IGC(+57.02)GENLFM(+15.99)SSQPYAWSR.V Y 79.45 2117.9299 18 1.3 1059.9736 2 64.65 3 F3:40437 NaNaKA16_F11.raw 1.0083E88.4481E86.9317E7 9 0234000000000 90 107 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M9:Oxidation (M):1000.00 PEAKS DB
C.QYC(+57.02)PAGNIIGSIATPYK.S N 76.59 1851.9188 17 0.8 926.9674 2 64.28 3 F3:39934 NaNaKA16_F11.raw 6.9974E6 3 0030000000000 163 179 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)PAGNIIGSIATPYK.S N 75.44 1560.7970 15 0.4 781.4061 2 55.64 3 F3:32530 NaNaKA16_F11.raw 1.6565E72.6149E6 5 0032000000000 165 179 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGH.Y N 74.39 1569.7939 16 0.1 785.9044 2 54.74 4 F4:34170 NaNaKA16_F12.raw 1.3128E62.8221E76.0658E6 3 0111000000000 119 134 PEAKS DB
R.NMLQMEWNSNAAQNAKR.W N 70.72 2004.9258 17 -0.1 669.3158 3 36.44 3 F3:17827 NaNaKA16_F11.raw 4.2399E6 1 0010000000000 54 70 PEAKS DB
Q.IVWYNSHLLGC(+57.02)GAAK.C Y 66.82 1687.8505 15 -0.1 563.6240 3 45.96 3 F3:25859 NaNaKA16_F11.raw 1.167E7 2 0020000000000 138 152 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
K.SGPPC(+57.02)GDC(+57.02)PSAC(+57.02)VNGLC(+57.02)TNPC(+57.02)K.H N 64.25 2406.9482 22 2.2 803.3251 3 33.04 3 F3:14934 NaNaKA16_F11.raw 4.4345E73.0856E6 2 0011000000000 180 201 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
N.PPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 63.95 2824.4119 26 1.2 707.1111 4 68.85 3 F3:43871 NaNaKA16_F11.raw 2.0238E66.4925E6 2 0110000000000 127 152 Carbamidomethylation C22:Carbamidomethylation:1000.00 PEAKS DB
N.MLQMEWNSNAAQNAK.R N 61.96 1734.7817 15 0.2 868.3983 2 42.10 3 F3:22578 NaNaKA16_F11.raw 1.0377E7 1 0010000000000 55 69 PEAKS DB
Y.VC(+57.02)QYC(+57.02)PAGNIIGSIATPYK.S N 60.72 2111.0181 19 0.5 1056.5168 2 67.50 3 F3:42701 NaNaKA16_F11.raw 3.3686E62.1087E6 2 0011000000000 161 179 Carbamidomethylation C2:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
A.GNIIGSIATPYK.S N 58.43 1232.6765 12 -0.2 617.3454 2 46.96 3 F3:26760 NaNaKA16_F11.raw 2.4959E6 1 0010000000000 168 179 PEAKS DB
K.QNAC(+57.02)QTEWMK.S Y 58.40 1294.5435 10 0.1 648.2791 2 41.31 3 F3:21944 NaNaKA16_F11.raw 4.4811E5 1 0010000000000 215 224 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHY.T N 57.66 1732.8573 17 1.1 867.4369 2 61.67 3 F3:37669 NaNaKA16_F11.raw 5.3586E6 1 0010000000000 119 135 PEAKS DB
C.PAGNIIGSIATPYK.S N 56.00 1400.7664 14 0.0 701.3904 2 51.58 3 F3:29077 NaNaKA16_F11.raw 7.112E5 1 0010000000000 166 179 PEAKS DB
K.FVYGVGANPPGSVIGHYTQIVWYNSHLLGC(+57.02)GAAK.C Y 54.12 3631.8035 34 0.9 908.9590 4 82.67 4 F4:57037 NaNaKA16_F12.raw 5.2429E61.58E7 2 0101000000000 119 152 Carbamidomethylation C30:Carbamidomethylation:1000.00 PEAKS DB
R.VIQSWYDENKK.F N 54.01 1408.6986 11 -0.3 705.3564 2 11.80 3 F3:2163 NaNaKA16_F11.raw 6.7786E61.1269E6 3 0021000000000 108 118 PEAKS DB
R.C(+57.02)SFAHSPPHLR.T N 52.64 1307.6193 11 0.9 436.8807 3 11.47 4 F4:1824 NaNaKA16_F12.raw 3.3923E5 1 0001000000000 75 85 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YLYVC(+57.02)QYC(+57.02)PAGN.I N 48.44 1506.6272 12 0.2 754.3210 2 57.46 3 F3:34059 NaNaKA16_F11.raw 1.5296E74.5046E6 2 0011000000000 158 169 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.TQIVWYNSHLLGC(+57.02)GAAK.C Y 46.64 1916.9567 17 1.2 639.9936 3 50.10 3 F3:28369 NaNaKA16_F11.raw 0 0 0000000000000 136 152 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.FVYGVGANPPGSVIGHYTQ.I N 45.19 1961.9635 19 1.6 981.9906 2 60.19 3 F3:36550 NaNaKA16_F11.raw 4.6839E6 1 0010000000000 119 137 PEAKS DB
total 27 peptides
XP_034291085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGAYSYIESHPWQAGIFVK.N N 101.78 2109.0320 19 -0.3 1055.5229 2 65.05 4 F4:42731 NaNaKA16_F12.raw 5.8839E61.1656E75.0772E801.9031E6 10 0126000000001 315 333 PEAKS DB
I.KGGAYSYIESHPWQAGIFVK.N N 92.59 2237.1270 20 0.8 746.7169 3 55.07 4 F4:34289 NaNaKA16_F12.raw 2.0972E63.4652E7 3 0012000000000 314 333 PEAKS DB
Y.SYIESHPWQAGIFVK.N N 86.86 1760.8885 15 0.0 881.4515 2 54.37 4 F4:33882 NaNaKA16_F12.raw 1.4376E7 2 0002000000000 319 333 PEAKS DB
K.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 101 119 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.Q N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 486 498 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.LIGIISWGVGC(+57.02)GK.K N 71.96 1358.7380 13 -0.9 680.3757 2 73.70 4 F4:50270 NaNaKA16_F12.raw 8.0282E62.5854E71.9381E83.9035E51.3461E5 8 0114000000011 522 534 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.LYPDSFC(+57.02)TSAR.L N 69.84 1315.5867 11 0.6 658.8010 2 33.08 4 F4:16532 NaNaKA16_F12.raw 5.6231E86.5311E5 2 0001100000000 471 481 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 173 182 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.Q N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 486 498 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Q.IKGGAYSYIESHPWQAGIFVK.N N 64.84 2350.2109 21 0.7 588.5604 4 57.69 4 F4:36700 NaNaKA16_F12.raw 1.8752E61.979E7 3 0012000000000 313 333 PEAKS DB
R.VKSSVTEQIFQVER.Y Y 63.06 1648.8784 14 -0.2 550.6333 3 35.31 4 F4:17952 NaNaKA16_F12.raw 8.9659E6 2 0002000000000 379 392 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 107 119 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
M.KLIGIISWGVGC(+57.02)GK.K N 60.37 1486.8330 14 -0.3 496.6181 3 58.22 4 F4:37010 NaNaKA16_F12.raw 6.5528E5 1 0001000000000 521 534 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.SSVTEQIFQVER.Y Y 59.86 1421.7151 12 0.8 711.8654 2 49.80 4 F4:30233 NaNaKA16_F12.raw 01.4032E64.0689E8 4 0013000000000 381 392 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 109 119 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 403 412 PEAKS DB
K.GGAYSYIESHPWQAGIFVKNR.G N 56.73 2379.1760 21 0.6 595.8016 4 55.04 4 F4:34397 NaNaKA16_F12.raw 1.2222E6 1 0001000000000 315 335 PEAKS DB
C.DVPAC(+57.02)STC(+57.02)GLR.K N 54.02 1234.5435 11 -0.2 618.2789 2 11.74 4 F4:2088 NaNaKA16_F12.raw 3.2897E6 1 0001000000000 294 304 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 104 119 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.S N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 403 414 PEAKS DB
Y.IESHPWQAGIFVK.N N 45.33 1510.7932 13 0.4 504.6052 3 44.51 4 F4:25555 NaNaKA16_F12.raw 7.3497E5 1 0001000000000 321 333 PEAKS DB
I.ESHPWQAGIFVK.N N 42.01 1397.7091 12 -1.2 699.8610 2 39.12 13 F13:19537 NaNaKA16_F9.raw 6.7594E5 1 0000000000001 322 333 PEAKS DB
total 22 peptides
XP_034291087.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGAYSYIESHPWQAGIFVK.N N 101.78 2109.0320 19 -0.3 1055.5229 2 65.05 4 F4:42731 NaNaKA16_F12.raw 5.8839E61.1656E75.0772E801.9031E6 10 0126000000001 315 333 PEAKS DB
I.KGGAYSYIESHPWQAGIFVK.N N 92.59 2237.1270 20 0.8 746.7169 3 55.07 4 F4:34289 NaNaKA16_F12.raw 2.0972E63.4652E7 3 0012000000000 314 333 PEAKS DB
Y.SYIESHPWQAGIFVK.N N 86.86 1760.8885 15 0.0 881.4515 2 54.37 4 F4:33882 NaNaKA16_F12.raw 1.4376E7 2 0002000000000 319 333 PEAKS DB
K.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 101 119 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.Q N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 486 498 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.LIGIISWGVGC(+57.02)GK.K N 71.96 1358.7380 13 -0.9 680.3757 2 73.70 4 F4:50270 NaNaKA16_F12.raw 8.0282E62.5854E71.9381E83.9035E51.3461E5 8 0114000000011 522 534 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.LYPDSFC(+57.02)TSAR.L N 69.84 1315.5867 11 0.6 658.8010 2 33.08 4 F4:16532 NaNaKA16_F12.raw 5.6231E86.5311E5 2 0001100000000 471 481 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 173 182 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.Q N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 486 498 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Q.IKGGAYSYIESHPWQAGIFVK.N N 64.84 2350.2109 21 0.7 588.5604 4 57.69 4 F4:36700 NaNaKA16_F12.raw 1.8752E61.979E7 3 0012000000000 313 333 PEAKS DB
R.VKSSVTEQIFQVER.Y Y 63.06 1648.8784 14 -0.2 550.6333 3 35.31 4 F4:17952 NaNaKA16_F12.raw 8.9659E6 2 0002000000000 379 392 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 107 119 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
M.KLIGIISWGVGC(+57.02)GK.K N 60.37 1486.8330 14 -0.3 496.6181 3 58.22 4 F4:37010 NaNaKA16_F12.raw 6.5528E5 1 0001000000000 521 534 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.SSVTEQIFQVER.Y Y 59.86 1421.7151 12 0.8 711.8654 2 49.80 4 F4:30233 NaNaKA16_F12.raw 01.4032E64.0689E8 4 0013000000000 381 392 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 109 119 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 403 412 PEAKS DB
K.GGAYSYIESHPWQAGIFVKNR.G N 56.73 2379.1760 21 0.6 595.8016 4 55.04 4 F4:34397 NaNaKA16_F12.raw 1.2222E6 1 0001000000000 315 335 PEAKS DB
C.DVPAC(+57.02)STC(+57.02)GLR.K N 54.02 1234.5435 11 -0.2 618.2789 2 11.74 4 F4:2088 NaNaKA16_F12.raw 3.2897E6 1 0001000000000 294 304 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 104 119 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.S N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 403 414 PEAKS DB
Y.IESHPWQAGIFVK.N N 45.33 1510.7932 13 0.4 504.6052 3 44.51 4 F4:25555 NaNaKA16_F12.raw 7.3497E5 1 0001000000000 321 333 PEAKS DB
I.ESHPWQAGIFVK.N N 42.01 1397.7091 12 -1.2 699.8610 2 39.12 13 F13:19537 NaNaKA16_F9.raw 6.7594E5 1 0000000000001 322 333 PEAKS DB
total 22 peptides
XP_034291086.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGAYSYIESHPWQAGIFVK.N N 101.78 2109.0320 19 -0.3 1055.5229 2 65.05 4 F4:42731 NaNaKA16_F12.raw 5.8839E61.1656E75.0772E801.9031E6 10 0126000000001 315 333 PEAKS DB
I.KGGAYSYIESHPWQAGIFVK.N N 92.59 2237.1270 20 0.8 746.7169 3 55.07 4 F4:34289 NaNaKA16_F12.raw 2.0972E63.4652E7 3 0012000000000 314 333 PEAKS DB
Y.SYIESHPWQAGIFVK.N N 86.86 1760.8885 15 0.0 881.4515 2 54.37 4 F4:33882 NaNaKA16_F12.raw 1.4376E7 2 0002000000000 319 333 PEAKS DB
K.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 101 119 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.Q N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 486 498 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.LIGIISWGVGC(+57.02)GK.K N 71.96 1358.7380 13 -0.9 680.3757 2 73.70 4 F4:50270 NaNaKA16_F12.raw 8.0282E62.5854E71.9381E83.9035E51.3461E5 8 0114000000011 522 534 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
R.LYPDSFC(+57.02)TSAR.L N 69.84 1315.5867 11 0.6 658.8010 2 33.08 4 F4:16532 NaNaKA16_F12.raw 5.6231E86.5311E5 2 0001100000000 471 481 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 173 182 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.Q N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 486 498 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Q.IKGGAYSYIESHPWQAGIFVK.N N 64.84 2350.2109 21 0.7 588.5604 4 57.69 4 F4:36700 NaNaKA16_F12.raw 1.8752E61.979E7 3 0012000000000 313 333 PEAKS DB
R.VKSSVTEQIFQVER.Y Y 63.06 1648.8784 14 -0.2 550.6333 3 35.31 4 F4:17952 NaNaKA16_F12.raw 8.9659E6 2 0002000000000 379 392 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 107 119 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
M.KLIGIISWGVGC(+57.02)GK.K N 60.37 1486.8330 14 -0.3 496.6181 3 58.22 4 F4:37010 NaNaKA16_F12.raw 6.5528E5 1 0001000000000 521 534 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.SSVTEQIFQVER.Y Y 59.86 1421.7151 12 0.8 711.8654 2 49.80 4 F4:30233 NaNaKA16_F12.raw 01.4032E64.0689E8 4 0013000000000 381 392 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 109 119 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 403 412 PEAKS DB
K.GGAYSYIESHPWQAGIFVKNR.G N 56.73 2379.1760 21 0.6 595.8016 4 55.04 4 F4:34397 NaNaKA16_F12.raw 1.2222E6 1 0001000000000 315 335 PEAKS DB
C.DVPAC(+57.02)STC(+57.02)GLR.K N 54.02 1234.5435 11 -0.2 618.2789 2 11.74 4 F4:2088 NaNaKA16_F12.raw 3.2897E6 1 0001000000000 294 304 Carbamidomethylation C5:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 104 119 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.S N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 403 414 PEAKS DB
Y.IESHPWQAGIFVK.N N 45.33 1510.7932 13 0.4 504.6052 3 44.51 4 F4:25555 NaNaKA16_F12.raw 7.3497E5 1 0001000000000 321 333 PEAKS DB
I.ESHPWQAGIFVK.N N 42.01 1397.7091 12 -1.2 699.8610 2 39.12 13 F13:19537 NaNaKA16_F9.raw 6.7594E5 1 0000000000001 322 333 PEAKS DB
total 22 peptides
3PRX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
3PVM
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
Q91132.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
AAA68989.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
CAI46845.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
6I2X
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
I51018
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KC(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.50 2286.8835 18 0.7 763.3023 3 20.65 9 F9:7758 NaNaKA16_F5.raw 5.1572E7 2 0000000020000 676 693 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPMGYTC(+57.02)EK.R Y 83.21 2158.7886 17 0.2 720.6036 3 31.20 9 F9:15937 NaNaKA16_F5.raw 5.0681E7 2 0000000020000 677 693 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.VNDDYLIWGSR.S Y 78.30 1336.6411 11 0.2 669.3279 2 59.90 4 F4:38472 NaNaKA16_F12.raw 6.8624E63.781E6 2 0001100000000 1577 1587 PEAKS DB
K.AC(+57.02)ETNVDYVYK.T Y 69.83 1360.5969 11 1.0 681.3064 2 23.73 5 F5:6621 NaNaKA16_F13.raw 5.6014E6 1 0000100000000 1515 1525 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.DDNEDGFIADSDIISR.S Y 69.48 1780.7751 16 1.0 891.3958 2 68.58 5 F5:27981 NaNaKA16_F13.raw 1.4552E6 2 0000200000000 733 748 PEAKS DB
R.QNQYVVVQVTGPQVR.L N 69.18 1713.9163 15 0.5 857.9658 2 44.31 5 F5:17897 NaNaKA16_F13.raw 1.095E61.2725E60 3 0001200000000 100 114 PEAKS DB
K.QLDIFVHDFPR.K N 68.50 1385.7091 11 0.5 462.9105 3 58.12 2 F2:35492 NaNaKA16_F10.raw 4.8609E64.087E6 3 0102000000000 53 63 PEAKS DB
K.GDNLIQMPGAAMK.I Y 68.40 1344.6530 13 0.9 673.3344 2 49.77 5 F5:20116 NaNaKA16_F13.raw 3.458E6 1 0000100000000 552 564 PEAKS DB
G.ALYTLITPAVLR.T N 67.00 1329.8020 12 0.9 665.9089 2 76.05 2 F2:51268 NaNaKA16_F10.raw 1.5845E72.1186E65.6852E63.5213E66.0544E54.0982E5 6 0111100000011 23 34 PEAKS DB
R.INYENALLAR.T Y 66.45 1175.6299 10 0.9 588.8228 2 45.80 5 F5:18665 NaNaKA16_F13.raw 1.5955E63.825E6 2 0001100000000 1292 1301 PEAKS DB
K.LNQDITVTASGDGK.A Y 66.30 1417.7048 14 0.8 709.8603 2 20.53 5 F5:5136 NaNaKA16_F13.raw 2.7531E6 1 0000100000000 1307 1320 PEAKS DB
R.VELLYNPAFC(+57.02)SASTK.G Y 65.11 1698.8286 15 0.9 850.4224 2 59.57 5 F5:24606 NaNaKA16_F13.raw 2.9621E54.7366E6 2 0001100000000 848 862 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
K.DLTEEPNSQGISSK.T Y 64.83 1503.7052 14 0.2 752.8600 2 21.48 5 F5:5531 NaNaKA16_F13.raw 5.0484E6 1 0000100000000 761 774 PEAKS DB
K.ASVQEALWSDGVR.K Y 64.04 1416.6997 13 0.6 709.3575 2 50.23 5 F5:20313 NaNaKA16_F13.raw 3.3991E6 1 0000100000000 898 910 PEAKS DB
K.DTC(+57.02)MGTLVVK.G N 63.96 1122.5414 10 1.1 562.2786 2 36.58 5 F5:14251 NaNaKA16_F13.raw 3.5107E6 1 0000100000000 542 551 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.GVGGTQLEVIK.A Y 62.39 1099.6237 11 -0.4 550.8189 2 32.10 5 F5:11471 NaNaKA16_F13.raw 3.5972E6 1 0000100000000 936 946 PEAKS DB
K.HFEVGFIQPGSVK.V N 61.71 1443.7510 13 0.1 722.8828 2 45.04 5 F5:18328 NaNaKA16_F13.raw 7.8322E51.9589E6 3 0001200000000 1445 1457 PEAKS DB
K.YFTYLILNK.G N 59.48 1173.6433 9 0.6 587.8293 2 64.63 4 F4:42455 NaNaKA16_F12.raw 3.9819E53.5813E5 2 0001100000000 478 486 PEAKS DB
R.WPHEDEC(+57.02)QEEEFQK.L Y 56.35 1889.7526 14 0.4 630.9250 3 23.79 4 F4:8642 NaNaKA16_F12.raw 4.157E63.5558E6 2 0001100000000 1610 1623 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.VYSYYNLDEK.C N 53.87 1292.5924 10 -0.2 647.3033 2 35.45 5 F5:13480 NaNaKA16_F13.raw 6.2293E6 1 0000100000000 1458 1467 PEAKS DB
R.IEEQDGNDIYVMDVLEVIK.Q Y 53.58 2221.0823 19 0.4 1111.5488 2 104.84 4 F4:72376 NaNaKA16_F12.raw 9.1078E5 1 0001000000000 1531 1549 PEAKS DB
K.C(+57.02)C(+57.02)EDVMHENPM(+15.99)GYTC(+57.02)EK.R Y 52.94 2174.7837 17 0.3 725.9354 3 19.23 9 F9:6612 NaNaKA16_F5.raw 4.2545E6 1 0000000010000 677 693 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;M11:Oxidation (M):62.41;C15:Carbamidomethylation:1000.00 PEAKS DB
R.IDVPLQIEK.A Y 52.36 1053.6069 9 1.3 527.8114 2 47.84 4 F4:28430 NaNaKA16_F12.raw 8.3958E66.968E6 2 0001100000000 1506 1514 PEAKS DB
K.GDNLIQM(+15.99)PGAAMK.I Y 51.92 1360.6479 13 -0.1 681.3312 2 30.12 5 F5:10521 NaNaKA16_F13.raw 7.1208E5 1 0000100000000 552 564 Oxidation (M) M7:Oxidation (M):35.03 PEAKS DB
K.YVLPSFEVR.L N 51.15 1108.5917 9 0.2 555.3032 2 58.46 4 F4:37268 NaNaKA16_F12.raw 1.8594E62.5932E6 2 0001100000000 219 227 PEAKS DB
K.LDDRVPDTEIETK.I Y 48.94 1529.7573 13 0.1 510.9265 3 24.23 5 F5:6922 NaNaKA16_F13.raw 2.685E5 1 0000100000000 950 962 PEAKS DB
R.AVPFVIVPLEQGLHDVEIK.A Y 48.75 2102.1775 19 0.1 701.7332 3 86.03 4 F4:59879 NaNaKA16_F12.raw 5.8004E5 1 0001000000000 879 897 PEAKS DB
H.ITPDLIPSFR.F N 47.01 1157.6444 10 0.6 579.8298 2 65.39 5 F5:26870 NaNaKA16_F13.raw 4.6001E5 1 0000100000000 510 519 PEAKS DB
R.IPIIDGDGK.A Y 46.67 926.5073 9 0.6 464.2612 2 33.77 5 F5:12591 NaNaKA16_F13.raw 5.1851E6 1 0000100000000 283 291 PEAKS DB
K.GIYTPGSPVLYR.V N 46.58 1321.7030 12 -0.9 661.8582 2 48.12 5 F5:19514 NaNaKA16_F13.raw 0 0 0000000000000 135 146 PEAKS DB
E.DGFIADSDIISR.S Y 45.89 1307.6357 12 0.4 654.8254 2 61.00 5 F5:25193 NaNaKA16_F13.raw 1.257E6 2 0000200000000 737 748 PEAKS DB
W.VVLAVSFTPTK.G Y 45.67 1160.6804 11 0.8 581.3480 2 52.57 5 F5:21349 NaNaKA16_F13.raw 9.857E4 1 0000100000000 788 798 PEAKS DB
K.GIC(+57.02)VAEPYEIR.V Y 45.63 1305.6387 11 0.3 653.8268 2 44.92 5 F5:18246 NaNaKA16_F13.raw 6.0645E6 1 0000100000000 799 809 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.IWDTIEK.S N 43.23 903.4702 7 0.6 452.7426 2 29.33 5 F5:9813 NaNaKA16_F13.raw 4.4002E6 1 0000100000000 598 604 PEAKS DB
K.VAVIIYLNK.V Y 42.64 1031.6379 9 0.3 516.8264 2 50.89 5 F5:20439 NaNaKA16_F13.raw 2.7389E5 1 0000100000000 1421 1429 PEAKS DB
total 35 peptides
ACN50006.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 91.95 2982.2793 26 1.7 995.1021 3 54.73 9 F9:35402 NaNaKA16_F5.raw 1.7077E81.5002E84.1894E7 4 0000100021000 468 493 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 90.56 2712.1101 23 1.2 1357.0640 2 72.09 9 F9:50509 NaNaKA16_F5.raw 9.0813E74.1609E76.0829E6 6 0000200022000 471 493 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.DPNYGMVEPGTK.C N 79.93 1306.5863 12 0.1 654.3005 2 28.66 10 F10:14262 NaNaKA16_F6.raw 4.8233E81.8661E74.1689E7 3 0000100011000 583 594 PEAKS DB
R.DPNYGM(+15.99)VEPGTK.C N 77.87 1322.5813 12 -0.3 662.2977 2 26.33 5 F5:10060 NaNaKA16_F13.raw 9.0917E7 5 0000500000000 583 594 Oxidation (M) M6:Oxidation (M):1000.00 PEAKS DB
K.C(+57.02)PIMTNQC(+57.02)IALR.G N 77.27 1475.7047 12 0.2 738.8598 2 38.95 9 F9:22183 NaNaKA16_F5.raw 5.0717E53.2472E51.9097E82.1736E84.0241E73.7147E64.6756E6 12 0011300022021 510 521 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PIM(+15.99)TNQC(+57.02)IALR.G N 75.90 1491.6996 12 -0.8 746.8564 2 29.62 9 F9:14662 NaNaKA16_F5.raw 3.2733E78.8589E62.9095E6 7 0000400021000 510 521 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M4:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NSMIC(+57.02)NC(+57.02)SISPR.D N 75.66 1437.6163 12 0.1 719.8155 2 24.50 5 F5:7209 NaNaKA16_F13.raw 6.4703E72.8886E62.2986E61.2892E5 4 0000100011100 571 582 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.TPVGLAYIGSIC(+57.02)NPK.T N 73.67 1588.8282 15 0.1 795.4215 2 60.14 12 F12:39283 NaNaKA16_F8.raw 1.0459E64.5255E6 2 0000000000110 305 319 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
N.GTPVGLAYIGSIC(+57.02)NPK.T N 73.11 1645.8497 16 0.4 823.9325 2 60.77 11 F11:39960 NaNaKA16_F7.raw 1.4933E63.1956E62.0263E7 3 0000100000110 304 319 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.TKPAYQFSSC(+57.02)SVR.E N 67.55 1529.7296 13 -0.1 765.8720 2 12.28 5 F5:2284 NaNaKA16_F13.raw 2.3942E8 2 0000200000000 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.NSM(+15.99)IC(+57.02)NC(+57.02)SISPR.D N 64.85 1453.6112 12 0.3 727.8131 2 22.81 5 F5:7058 NaNaKA16_F13.raw 7.9998E6 3 0000300000000 571 582 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.RTKPAYQFSSC(+57.02)SVR.E N 61.84 1685.8307 14 1.0 562.9514 3 11.85 5 F5:1803 NaNaKA16_F13.raw 1.7851E6 1 0000100000000 369 382 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
D.PNYGMVEPGTK.C N 60.45 1191.5593 11 1.0 596.7875 2 20.63 5 F5:5320 NaNaKA16_F13.raw 1.9113E6 1 0000100000000 584 594 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.RNSMIC(+57.02)NC(+57.02)SISPR.D N 59.91 1593.7174 13 0.1 532.2465 3 12.17 5 F5:2067 NaNaKA16_F13.raw 7.3377E5 1 0000100000000 570 582 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.TGQSAEC(+57.02)PTDVFQR.N N 57.94 1594.7046 14 0.9 798.3603 2 31.39 5 F5:11052 NaNaKA16_F13.raw 8.9511E5 1 0000100000000 480 493 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.T N 57.18 1139.5029 9 0.1 570.7588 2 26.24 5 F5:8465 NaNaKA16_F13.raw 2.8674E88.7317E5 2 0000100001000 530 538 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.NGLPC(+57.02)QNNQGYC(+57.02)YNGK.C N 55.77 1885.7836 16 0.8 943.8998 2 19.60 9 F9:6919 NaNaKA16_F5.raw 1.7165E66.1944E61.2392E6 3 0000100011000 494 509 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MVAITMAHEMGH.N N 55.46 1326.5883 12 0.8 664.3019 2 33.28 5 F5:12224 NaNaKA16_F13.raw 4.5918E6 1 0000100000000 334 345 PEAKS DB
K.PAYQFSSC(+57.02)SVR.E N 53.21 1300.5870 11 0.2 651.3009 2 25.11 5 F5:7381 NaNaKA16_F13.raw 5.016E7 1 0000100000000 372 382 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGMVC(+57.02)SNR.Q N 51.31 1154.4268 10 1.1 578.2213 2 11.85 5 F5:1806 NaNaKA16_F13.raw 4.5755E5 1 0000100000000 595 604 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
Q.SAEC(+57.02)PTDVFQR.N N 49.48 1308.5768 11 0.4 655.2960 2 32.04 5 F5:11429 NaNaKA16_F13.raw 1.3941E7 1 0000100000000 483 493 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
N.SMIC(+57.02)NC(+57.02)SISPR.D N 47.00 1323.5734 11 3.9 662.7966 2 23.55 5 F5:6539 NaNaKA16_F13.raw 0 0 0000000000000 572 582 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.LQHEAQC(+57.02)DSEEC(+57.02)C(+57.02)EK.C N 46.38 1921.7240 15 0.0 641.5820 3 11.83 5 F5:1808 NaNaKA16_F13.raw 2.9375E5 1 0000100000000 442 456 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGM(+15.99)VC(+57.02)SNR.Q N 45.27 1170.4216 10 0.3 586.2183 2 11.84 5 F5:1815 NaNaKA16_F13.raw 9.9702E4 1 0000100000000 595 604 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M5:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.DPNYGMVEPGTKC(+57.02)GDGMVC(+57.02)SNR.Q Y 43.23 2443.0024 22 -0.7 815.3408 3 34.89 5 F5:13136 NaNaKA16_F13.raw 0 0 0000000000000 583 604 Carbamidomethylation C13:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 27 peptides
D3TTC2.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 91.95 2982.2793 26 1.7 995.1021 3 54.73 9 F9:35402 NaNaKA16_F5.raw 1.7077E81.5002E84.1894E7 4 0000100021000 468 493 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDVFQR.N N 90.56 2712.1101 23 1.2 1357.0640 2 72.09 9 F9:50509 NaNaKA16_F5.raw 9.0813E74.1609E76.0829E6 6 0000200022000 471 493 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.DPNYGMVEPGTK.C N 79.93 1306.5863 12 0.1 654.3005 2 28.66 10 F10:14262 NaNaKA16_F6.raw 4.8233E81.8661E74.1689E7 3 0000100011000 583 594 PEAKS DB
R.DPNYGM(+15.99)VEPGTK.C N 77.87 1322.5813 12 -0.3 662.2977 2 26.33 5 F5:10060 NaNaKA16_F13.raw 9.0917E7 5 0000500000000 583 594 Oxidation (M) M6:Oxidation (M):1000.00 PEAKS DB
K.C(+57.02)PIMTNQC(+57.02)IALR.G N 77.27 1475.7047 12 0.2 738.8598 2 38.95 9 F9:22183 NaNaKA16_F5.raw 5.0717E53.2472E51.9097E82.1736E84.0241E73.7147E64.6756E6 12 0011300022021 510 521 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PIM(+15.99)TNQC(+57.02)IALR.G N 75.90 1491.6996 12 -0.8 746.8564 2 29.62 9 F9:14662 NaNaKA16_F5.raw 3.2733E78.8589E62.9095E6 7 0000400021000 510 521 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M4:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.NSMIC(+57.02)NC(+57.02)SISPR.D N 75.66 1437.6163 12 0.1 719.8155 2 24.50 5 F5:7209 NaNaKA16_F13.raw 6.4703E72.8886E62.2986E61.2892E5 4 0000100011100 571 582 Carbamidomethylation C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
G.TPVGLAYIGSIC(+57.02)NPK.T N 73.67 1588.8282 15 0.1 795.4215 2 60.14 12 F12:39283 NaNaKA16_F8.raw 1.0459E64.5255E6 2 0000000000110 305 319 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
N.GTPVGLAYIGSIC(+57.02)NPK.T N 73.11 1645.8497 16 0.4 823.9325 2 60.77 11 F11:39960 NaNaKA16_F7.raw 1.4933E63.1956E62.0263E7 3 0000100000110 304 319 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.TKPAYQFSSC(+57.02)SVR.E N 67.55 1529.7296 13 -0.1 765.8720 2 12.28 5 F5:2284 NaNaKA16_F13.raw 2.3942E8 2 0000200000000 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.NSM(+15.99)IC(+57.02)NC(+57.02)SISPR.D N 64.85 1453.6112 12 0.3 727.8131 2 22.81 5 F5:7058 NaNaKA16_F13.raw 7.9998E6 3 0000300000000 571 582 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C5:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.RTKPAYQFSSC(+57.02)SVR.E N 61.84 1685.8307 14 1.0 562.9514 3 11.85 5 F5:1803 NaNaKA16_F13.raw 1.7851E6 1 0000100000000 369 382 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
D.PNYGMVEPGTK.C N 60.45 1191.5593 11 1.0 596.7875 2 20.63 5 F5:5320 NaNaKA16_F13.raw 1.9113E6 1 0000100000000 584 594 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.RNSMIC(+57.02)NC(+57.02)SISPR.D N 59.91 1593.7174 13 0.1 532.2465 3 12.17 5 F5:2067 NaNaKA16_F13.raw 7.3377E5 1 0000100000000 570 582 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
C.TGQSAEC(+57.02)PTDVFQR.N N 57.94 1594.7046 14 0.9 798.3603 2 31.39 5 F5:11052 NaNaKA16_F13.raw 8.9511E5 1 0000100000000 480 493 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.DSC(+57.02)FTLNQR.T N 57.18 1139.5029 9 0.1 570.7588 2 26.24 5 F5:8465 NaNaKA16_F13.raw 2.8674E88.7317E5 2 0000100001000 530 538 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.NGLPC(+57.02)QNNQGYC(+57.02)YNGK.C N 55.77 1885.7836 16 0.8 943.8998 2 19.60 9 F9:6919 NaNaKA16_F5.raw 1.7165E66.1944E61.2392E6 3 0000100011000 494 509 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MVAITMAHEMGH.N N 55.46 1326.5883 12 0.8 664.3019 2 33.28 5 F5:12224 NaNaKA16_F13.raw 4.5918E6 1 0000100000000 334 345 PEAKS DB
K.PAYQFSSC(+57.02)SVR.E N 53.21 1300.5870 11 0.2 651.3009 2 25.11 5 F5:7381 NaNaKA16_F13.raw 5.016E7 1 0000100000000 372 382 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGMVC(+57.02)SNR.Q N 51.31 1154.4268 10 1.1 578.2213 2 11.85 5 F5:1806 NaNaKA16_F13.raw 4.5755E5 1 0000100000000 595 604 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
Q.SAEC(+57.02)PTDVFQR.N N 49.48 1308.5768 11 0.4 655.2960 2 32.04 5 F5:11429 NaNaKA16_F13.raw 1.3941E7 1 0000100000000 483 493 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
N.SMIC(+57.02)NC(+57.02)SISPR.D N 47.00 1323.5734 11 3.9 662.7966 2 23.55 5 F5:6539 NaNaKA16_F13.raw 0 0 0000000000000 572 582 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.LQHEAQC(+57.02)DSEEC(+57.02)C(+57.02)EK.C N 46.38 1921.7240 15 0.0 641.5820 3 11.83 5 F5:1808 NaNaKA16_F13.raw 2.9375E5 1 0000100000000 442 456 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGM(+15.99)VC(+57.02)SNR.Q N 45.27 1170.4216 10 0.3 586.2183 2 11.84 5 F5:1815 NaNaKA16_F13.raw 9.9702E4 1 0000100000000 595 604 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M5:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.DPNYGMVEPGTKC(+57.02)GDGMVC(+57.02)SNR.Q Y 43.23 2443.0024 22 -0.7 815.3408 3 34.89 5 F5:13136 NaNaKA16_F13.raw 0 0 0000000000000 583 604 Carbamidomethylation C13:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 27 peptides
P82942.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 96.36 2688.1213 23 1.5 897.0491 3 43.20 9 F9:25555 NaNaKA16_F5.raw 1.636E64.7159E61.008E63.2481E81.0386E91.5129E6 10 0101100042100 262 284 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALLGPHFTVSPK.G Y 92.22 2353.1921 21 0.7 785.4052 3 63.06 13 F13:39142 NaNaKA16_F9.raw 01.6577E64.7406E61.1748E71.7565E95.2146E77.1814E6 8 0011000013101 301 321 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.TAPAFQFSSC(+57.02)SIR.D N 80.42 1470.6925 13 0.6 736.3539 2 46.94 4 F4:27572 NaNaKA16_F12.raw 7.7695E67.0106E66.7741E67.3303E52.6381E6 5 0111100000001 178 190 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
D.LPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N N 78.21 2160.9780 19 0.3 1081.4966 2 44.94 10 F10:28461 NaNaKA16_F6.raw 2.2687E6 1 0000000001000 266 284 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALLGPH.F Y 73.45 1693.8280 15 1.1 847.9222 2 60.70 10 F10:41651 NaNaKA16_F6.raw 4.295E65.2604E6 3 0000000021000 301 315 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.QC(+57.02)IALLGPHFTVSPK.G Y 68.85 1666.8865 15 1.2 556.6368 3 49.77 10 F10:32665 NaNaKA16_F6.raw 5.0752E6 1 0000000001000 307 321 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
R.VYEMINAVNTK.F N 67.13 1280.6434 11 -0.4 641.3287 2 34.28 4 F4:17180 NaNaKA16_F12.raw 2.766E62.8909E6 2 0001100000000 41 51 PEAKS DB
P.TLTNQC(+57.02)IALLGPHFTVSPK.G Y 63.50 2096.1089 19 0.3 699.7104 3 59.91 10 F10:40892 NaNaKA16_F6.raw 1.6477E7 1 0000000001000 303 321 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.YYNYDKPAIK.I Y 61.87 1273.6343 10 0.3 637.8246 2 12.17 5 F5:2066 NaNaKA16_F13.raw 2.5131E6 2 0000200000000 29 38 PEAKS DB
Q.C(+57.02)IALLGPHFTVSPK.G Y 61.06 1538.8279 14 0.0 513.9499 3 50.06 10 F10:32795 NaNaKA16_F6.raw 4.7258E6 1 0000000001000 308 321 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.PTLTNQC(+57.02)IALLGPHFTVSPK.G Y 59.80 2193.1616 20 0.3 732.0613 3 62.40 10 F10:43172 NaNaKA16_F6.raw 2.4828E6 1 0000000001000 302 321 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.GQC(+57.02)VDVQTAY N 56.58 1139.4917 10 0.2 570.7532 2 32.85 10 F10:17935 NaNaKA16_F6.raw 2.4491E8 1 0000000001000 392 401 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.DYQEYLLR.D Y 55.85 1098.5345 8 0.1 550.2746 2 52.54 4 F4:32349 NaNaKA16_F12.raw 4.2836E66.5338E61.251E72.2766E6 5 0112100000000 191 198 PEAKS DB
C.IALLGPHFTVSPK.G Y 55.81 1378.7972 13 0.2 460.6064 3 46.93 10 F10:30261 NaNaKA16_F6.raw 2.2132E7 2 0000000002000 309 321 PEAKS DB
K.GC(+57.02)FDLNMR.G N 52.79 1011.4266 8 -0.1 506.7205 2 36.97 10 F10:21218 NaNaKA16_F6.raw 9.5883E8 1 0000000001000 322 329 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
T.LTNQC(+57.02)IALLGPHFTVSPK.G Y 49.25 1995.0612 18 0.5 666.0280 3 55.31 10 F10:37057 NaNaKA16_F6.raw 0 0 0000000000000 304 321 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 199 211 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)PTLTNQC(+57.02)IALLGPHF.T Y 43.82 1840.8964 16 0.4 921.4558 2 105.10 10 F10:78175 NaNaKA16_F6.raw 7.0352E5 1 0000000001000 301 316 Carbamidomethylation C1:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 18 peptides
764177A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVR.T N 95.85 1418.6646 13 4.9 710.3395 2 28.78 7 F7:10382 NaNaKA16_F3.raw 9.9972E67.1823E76.7682E66.8283E82.2422E98.9511E101.0067E114.7969E92.1963E71.6215E74.704E6 103 001212840415111 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVR.T N 81.66 1574.7657 14 0.8 788.3908 2 21.92 9 F9:8931 NaNaKA16_F5.raw 2.0401E61.4583E82.0841E81.8696E91.6734E101.4455E92.6335E71.2378E6 55 0000131013214201 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DGFC(+57.02)SSR.G N 68.51 1274.4808 10 5.8 638.2482 2 29.20 7 F7:11885 NaNaKA16_F3.raw 1.908E61.8858E61.7769E86.7555E83.8045E106.7549E91.7828E9 60 000122427213000 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVR.T N 53.82 1204.5692 11 5.0 603.2917 2 11.90 8 F8:2032 NaNaKA16_F4.raw 5.7193E52.9789E61.0924E6 5 0000001310000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.TGVDIQC(+57.02)C(+57.02)STDDC(+57.02)PFPTR.K Y 49.86 2127.8660 18 5.3 1064.9406 2 51.93 7 F7:29166 NaNaKA16_F3.raw 0 0 0000000000000 50 67 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTKTWC(+57.02)DGFC(+57.02)SSR.G N 47.50 2606.0195 21 5.3 652.5123 4 32.55 7 F7:13432 NaNaKA16_F3.raw 2.079E61.2197E6 2 0000001010000 13 33 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.R N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.KTWC(+57.02)DGFC(+57.02)SSR.G N 45.02 1402.5758 11 4.8 468.5323 3 12.27 8 F8:2350 NaNaKA16_F4.raw 1.5491E5 1 0000000100000 23 33 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.DLGC(+57.02)AATC(+57.02)PTVR.T N 41.93 1319.5962 12 0.1 660.8054 2 23.57 6 F6:10177 NaNaKA16_F2.raw 4.9836E5 1 0000010000000 38 49 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 17 peptides
P25668.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVR.T N 95.85 1418.6646 13 4.9 710.3395 2 28.78 7 F7:10382 NaNaKA16_F3.raw 9.9972E67.1823E76.7682E66.8283E82.2422E98.9511E101.0067E114.7969E92.1963E71.6215E74.704E6 103 001212840415111 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVR.T N 81.66 1574.7657 14 0.8 788.3908 2 21.92 9 F9:8931 NaNaKA16_F5.raw 2.0401E61.4583E82.0841E81.8696E91.6734E101.4455E92.6335E71.2378E6 55 0000131013214201 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.TGVDIQC(+57.02)C(+57.02)STDDC(+57.02)DPFPTR.K N 64.22 2242.8928 19 -1.9 1122.4456 2 55.16 8 F8:34181 NaNaKA16_F4.raw 2.6424E71.4048E86.7036E72.7519E7 8 0000001331000 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DGFC(+57.02)SIR.G Y 58.43 1300.5328 10 -2.3 651.2722 2 47.10 9 F9:29057 NaNaKA16_F5.raw 5.247E65.4239E68.3364E92.3412E101.7299E105.9718E82.0334E7 38 010001314135001 24 33 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVR.T N 53.82 1204.5692 11 5.0 603.2917 2 11.90 8 F8:2032 NaNaKA16_F4.raw 5.7193E52.9789E61.0924E6 5 0000001310000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
T.KTWC(+57.02)DGFC(+57.02)SIR.G Y 51.45 1428.6278 11 5.0 715.3209 2 30.42 8 F8:13777 NaNaKA16_F4.raw 1.2676E7 2 0000000200000 23 33 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.R N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
V.DLGC(+57.02)AATC(+57.02)PTVR.T N 41.93 1319.5962 12 0.1 660.8054 2 23.57 6 F6:10177 NaNaKA16_F2.raw 4.9836E5 1 0000010000000 38 49 Carbamidomethylation C4:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
P25672.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)FITPDITSKDC(+57.02)PNGHVC(+57.02)YTK.T N 97.70 2512.1184 21 -0.2 838.3799 3 32.91 9 F9:17528 NaNaKA16_F5.raw 1.3652E75.3048E71.1015E8 10 0000003430000 3 23 Carbamidomethylation C1:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTVK.T N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
G.ERVDLGC(+57.02)AATC(+57.02)PTVK.T Y 86.02 1675.8021 15 -0.2 838.9081 2 20.70 9 F9:7862 NaNaKA16_F5.raw 1.6699E61.2973E82.0806E7 5 0000000122000 35 49 Carbamidomethylation C7:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSK.D N 75.82 1180.5798 10 7.7 591.2988 2 43.13 7 F7:21737 NaNaKA16_F3.raw 2.2482E78.6587E77.912E77.0808E65.0807E86.1225E108.5353E101.2307E115.4499E91.0861E86.3864E72.9206E8 82 0424249211413225 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
IRC(+57.02)FITPDITSK.D N 67.07 1449.7650 12 0.1 484.2623 3 34.24 9 F9:18401 NaNaKA16_F5.raw 2.4051E77.2194E78.0035E7 10 0000003430000 1 12 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.TGVDIQC(+57.02)C(+57.02)STDDC(+57.02)DPFPTR.K N 64.22 2242.8928 19 -1.9 1122.4456 2 55.16 8 F8:34181 NaNaKA16_F4.raw 2.6424E71.4048E86.7036E72.7519E7 8 0000001331000 50 68 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.TWC(+57.02)DGFC(+57.02)R.I Y 58.38 1100.4167 8 5.0 551.2156 2 29.88 7 F7:11237 NaNaKA16_F3.raw 1.1563E79.3448E74.4944E91.1459E102.7255E8 27 00000228141000 24 31 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
R.GERVDLGC(+57.02)AATC(+57.02)PTVK.T Y 54.17 1732.8236 16 -0.5 578.6149 3 20.46 9 F9:7831 NaNaKA16_F5.raw 2.0096E69.0307E6 3 0000000120000 34 49 Carbamidomethylation C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)FITPDITSKD.C N 53.03 1295.6067 11 0.2 648.8107 2 44.47 9 F9:26660 NaNaKA16_F5.raw 7.9006E53.8625E61.7287E7 6 0000001230000 3 13 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.DC(+57.02)PNGHVC(+57.02)YTK.T N 50.09 1349.5493 11 -0.1 450.8570 3 15.59 9 F9:3959 NaNaKA16_F5.raw 0 0 0000000000000 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
D.LGC(+57.02)AATC(+57.02)PTVK.T N 49.50 1176.5631 11 4.9 589.2886 2 11.80 8 F8:1936 NaNaKA16_F4.raw 1.7287E5 1 0000000100000 39 49 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
I.RC(+57.02)FITPDITSK.D N 48.93 1336.6809 11 0.7 446.5679 3 25.75 9 F9:12007 NaNaKA16_F5.raw 8.2828E6 1 0000000010000 2 12 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
C.FITPDITSK.D N 45.76 1020.5491 9 -2.0 511.2808 2 35.97 9 F9:20225 NaNaKA16_F5.raw 2.3378E81.8E8 3 0000000210000 4 12 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
E.RVDLGC(+57.02)AATC(+57.02)PTVK.T N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
F.ITPDITSK.D N 42.90 873.4807 8 4.9 437.7476 2 11.46 7 F7:1934 NaNaKA16_F3.raw 1.0681E6 1 0000001000000 5 12 PEAKS DB
total 16 peptides
PSNJ3K
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
E.AEKISGC(+57.02)WPYFK.T N 69.57 1484.7122 12 0.0 743.3633 2 40.74 11 F11:24212 NaNaKA16_F7.raw 9.0796E65.2934E71.0921E7 9 0000000002520 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
N.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.N N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.SWWNFADYGC(+57.02)YC(+57.02)GR.G Y 52.83 1840.7086 14 1.2 921.3627 2 83.49 11 F11:58616 NaNaKA16_F7.raw 5.6525E6 2 0000000000200 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
E.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.G N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
S.WWNFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C Y 45.25 2923.2078 25 0.2 975.4101 3 93.13 13 F13:64247 NaNaKA16_F9.raw 5.4823E7 1 0000000000001 18 42 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 17 peptides
0508173A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.N N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.AGKISGC(+57.02)WPYFK.T Y 53.67 1412.6910 12 0.2 707.3530 2 38.00 11 F11:21893 NaNaKA16_F7.raw 2.0025E7 2 0000000000200 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
G.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
N.EAGKISGC(+57.02)WPYFK.T Y 47.71 1541.7336 13 1.4 514.9192 3 41.78 11 F11:24729 NaNaKA16_F7.raw 1.5282E6 1 0000000000100 53 65 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNNDNYNINLK.A Y 42.31 2355.1318 21 0.3 786.0515 3 71.00 13 F13:46181 NaNaKA16_F9.raw 3.7844E6 1 0000000000001 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.SWLDFANYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C Y 41.95 2937.2446 26 -6.4 980.0825 3 95.85 13 F13:66499 NaNaKA16_F9.raw 1.1072E7 1 0000000000001 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 21 peptides
P25498.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISGC(+57.02)WPYFKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.48 2835.2341 23 -1.5 946.0839 3 57.58 11 F11:37368 NaNaKA16_F7.raw 1.3653E77.0731E71.9929E76.9253E6 5 0000000001211 57 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00;C22:Carbamidomethylation:1000.00 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)K.G N 89.30 1696.7073 14 0.3 849.3611 2 21.20 9 F9:9021 NaNaKA16_F5.raw 7.5988E51.6097E76.3725E61.1263E62.9128E66.1482E83.4541E102.2713E99.1534E64.1844E8 46 010311014183212 66 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.ISGC(+57.02)WPYFK.T N 70.32 1156.5375 9 0.1 579.2761 2 68.82 11 F11:46583 NaNaKA16_F7.raw 3.6915E81.4139E86.9856E72.3823E63.6353E63.5126E82.1014E101.2727E111.9979E101.2073E10 71 01131001115171021 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
NLYQFKNMIKC(+57.02)TVPSR.S N 66.48 1998.0179 16 0.3 667.0134 3 40.68 12 F12:23498 NaNaKA16_F8.raw 3.4886E6 1 0000000000010 1 16 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
T.YSYEC(+57.02)SQGTLTC(+57.02)K.G N 65.61 1595.6595 13 -0.2 798.8369 2 19.78 10 F10:7072 NaNaKA16_F6.raw 9.5485E6 1 0000000001000 67 79 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
Y.SYEC(+57.02)SQGTLTC(+57.02)K.G N 65.06 1432.5963 12 0.7 717.3060 2 11.79 10 F10:1902 NaNaKA16_F6.raw 7.186E5 1 0000000001000 68 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
NLYQFKNMIK.C N 55.84 1297.6853 10 0.6 649.8503 2 34.48 11 F11:19260 NaNaKA16_F7.raw 2.422E71.1905E83.5531E75.6701E7 7 0000000002212 1 10 PEAKS DB
Y.FKTYSYEC(+57.02)SQGTLTC(+57.02)K.G N 54.26 1971.8706 16 0.6 658.2979 3 23.41 11 F11:10060 NaNaKA16_F7.raw 3.532E61.7096E6 2 0000000001100 64 79 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.N N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.SGC(+57.02)WPYFK.T N 53.87 1043.4535 8 -1.4 522.7333 2 44.38 11 F11:27176 NaNaKA16_F7.raw 8.1441E65.2634E6 2 0000000001100 58 65 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
E.AGKISGC(+57.02)WPYFK.T Y 53.67 1412.6910 12 0.2 707.3530 2 38.00 11 F11:21893 NaNaKA16_F7.raw 2.0025E7 2 0000000000200 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
G.KISGC(+57.02)WPYFK.T N 51.04 1284.6324 10 0.2 643.3236 2 38.26 11 F11:22081 NaNaKA16_F7.raw 3.8432E6 2 0000000000200 56 65 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.NMIKC(+57.02)TVPSR.S N 48.35 1204.6056 10 0.1 603.3101 2 12.09 11 F11:1822 NaNaKA16_F7.raw 1.7697E7 2 0000000000200 7 16 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
N.EAGKISGC(+57.02)WPYFK.T Y 47.71 1541.7336 13 1.4 514.9192 3 41.78 11 F11:24729 NaNaKA16_F7.raw 1.5282E6 1 0000000000100 53 65 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
NLYQFKNM(+15.99)IK.C N 46.70 1313.6802 10 0.4 657.8476 2 22.54 11 F11:9423 NaNaKA16_F7.raw 2.8165E6 1 0000000000100 1 10 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
K.TYSYEC(+57.02)SQGTLTC(+57.02)KG.D N 45.40 1753.7288 15 1.4 877.8729 2 21.92 10 F10:8643 NaNaKA16_F6.raw 0 0 0000000000000 66 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYNNDNYNINLK.A Y 42.31 2355.1318 21 0.3 786.0515 3 71.00 13 F13:46181 NaNaKA16_F9.raw 3.7844E6 1 0000000000001 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.SWLDFANYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C Y 41.95 2937.2446 26 -6.4 980.0825 3 95.85 13 F13:66499 NaNaKA16_F9.raw 1.1072E7 1 0000000000001 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 21 peptides
P82464.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.GC(+57.02)TFTC(+57.02)PELRPTGIYVYC(+57.02)C(+57.02)R.R Y 93.20 2509.1011 20 2.4 1255.5608 2 54.83 11 F11:35150 NaNaKA16_F7.raw 8.0424E63.6818E67.2338E61.7518E84.5165E97.8194E73.3354E7 14 0110000011721 40 59 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.TSETTEIC(+57.02)PDSWYFC(+57.02)YK.I Y 80.65 2185.8972 17 0.6 1093.9565 2 69.45 11 F11:47497 NaNaKA16_F7.raw 1.0809E87.9719E84.2967E67.6956E6 10 0000000003511 10 26 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
F.TC(+57.02)PELRPTGIYVYC(+57.02)C(+57.02)R.R Y 73.49 2043.9329 16 0.0 682.3182 3 40.54 11 F11:24086 NaNaKA16_F7.raw 3.7008E69.5751E7 3 0000000001200 44 59 Carbamidomethylation C2:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.PTGIYVYC(+57.02)C(+57.02)R.R Y 72.07 1287.5740 10 0.6 644.7947 2 31.86 11 F11:16896 NaNaKA16_F7.raw 9.518E61.4426E8 2 0000000001100 50 59 Carbamidomethylation C8:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELRPTGIYVY.C Y 70.60 2032.9386 17 0.4 1017.4770 2 69.56 9 F9:48347 NaNaKA16_F5.raw 4.2507E66.6478E71.6776E91.2673E78.2441E6 6 0000000011211 40 56 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELRPTGIYVYC(+57.02).C Y 67.43 2192.9692 18 -0.3 1097.4916 2 68.75 11 F11:46523 NaNaKA16_F7.raw 3.7504E83.4122E6 2 0000000000110 40 57 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELRPTGIY.V Y 63.58 1770.8069 15 0.3 886.4110 2 57.41 10 F10:38814 NaNaKA16_F6.raw 1.3319E7 1 0000000001000 40 54 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
C.TFTC(+57.02)PELRPTGIYVYC(+57.02)C(+57.02)R.R Y 63.50 2292.0488 18 -0.3 765.0233 3 53.86 11 F11:34667 NaNaKA16_F7.raw 0 0 0000000000000 42 59 Carbamidomethylation C4:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
P.ELRPTGIYVYC(+57.02)C(+57.02)R.R Y 62.65 1685.8018 13 -0.8 562.9407 3 36.04 11 F11:20468 NaNaKA16_F7.raw 4.1728E63.0509E71.9498E76.7525E61.6307E6 7 0000000012211 47 59 Carbamidomethylation C11:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.ISLADGNDVR.I N 62.61 1058.5356 10 -0.5 530.2748 2 22.28 11 F11:9363 NaNaKA16_F7.raw 3.5268E65.5622E7 4 0000000002200 27 36 PEAKS DB
TIC(+57.02)YNHLTR.T Y 59.52 1176.5709 9 -0.3 589.2925 2 12.11 11 F11:1854 NaNaKA16_F7.raw 5.0884E51.9464E7 3 0000000001200 1 9 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
L.RPTGIYVYC(+57.02)C(+57.02)R.R Y 51.69 1443.6750 11 0.8 482.2327 3 19.57 11 F11:7076 NaNaKA16_F7.raw 1.1449E6 1 0000000000100 49 59 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
P.TGIYVYC(+57.02)C(+57.02)R.R Y 46.97 1190.5212 9 0.2 596.2680 2 28.61 11 F11:14302 NaNaKA16_F7.raw 7.0149E5 1 0000000000100 51 59 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELR.P N 45.94 1239.5376 10 0.0 620.7761 2 30.33 10 F10:15872 NaNaKA16_F6.raw 1.838E7 1 0000000001000 40 49 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
T.GIYVYC(+57.02)C(+57.02)R.R Y 43.24 1089.4735 8 0.6 545.7444 2 25.37 11 F11:11525 NaNaKA16_F7.raw 2.1848E6 1 0000000000100 52 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
T.C(+57.02)PELRPTGIYVYC(+57.02)C(+57.02)R.R Y 42.68 1942.8851 15 1.6 648.6367 3 39.71 11 F11:23366 NaNaKA16_F7.raw 0 0 0000000000000 45 59 Carbamidomethylation C1:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
E.TTEIC(+57.02)PDSWYFC(+57.02)YK.I N 42.51 1868.7749 14 1.2 935.3958 2 68.81 10 F10:48624 NaNaKA16_F6.raw 1.3848E6 1 0000000001000 13 26 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 17 peptides
1T37
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LAAIC(+57.02)FAGAPYNDDNYNIDLK.A Y 92.87 2357.0999 21 -0.9 1179.5562 2 77.04 13 F13:51637 NaNaKA16_F9.raw 3.6037E73.3667E71.9932E92.5595E108.2815E91.462E10 68 07050000011161217 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDDNYNIDLK.A Y 80.92 1553.6997 13 1.1 777.8580 2 40.11 11 F11:24310 NaNaKA16_F7.raw 1.285E91.4557E95.7971E77.0516E7 19 0000000005554 103 115 PEAKS DB
F.AGAPYNDDNYNIDLK.A Y 77.81 1681.7583 15 0.1 841.8865 2 42.69 13 F13:22802 NaNaKA16_F9.raw 1.3878E87.6515E71.16E73.0896E8 16 0000000004336 101 115 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDDNYNIDLK.A Y 69.06 1828.8268 16 0.1 915.4208 2 54.79 13 F13:31983 NaNaKA16_F9.raw 4.2561E65.8811E55.6426E7 5 0000000001103 100 115 PEAKS DB
K.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDDNYNIDLK.A Y 63.91 2513.2009 22 0.9 838.7416 3 64.79 12 F12:43839 NaNaKA16_F8.raw 1.7196E73.8048E6 3 0000000000021 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
P.YNDDNYNIDLK.A Y 49.28 1385.6099 11 0.1 693.8123 2 36.17 10 F10:20793 NaNaKA16_F6.raw 2.4481E6 1 0000000001000 105 115 PEAKS DB
N.DDNYNIDLK.A Y 48.54 1108.5037 9 -0.4 555.2589 2 37.39 10 F10:21951 NaNaKA16_F6.raw 9.0684E5 1 0000000001000 107 115 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDDNYNIDLKAR.C Y 43.98 2584.2380 23 0.0 862.4199 3 66.94 12 F12:45096 NaNaKA16_F8.raw 4.0557E56.9771E5 2 0000000000110 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 13 peptides
1ZM6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LAAIC(+57.02)FAGAPYNDDNYNIDLK.A Y 92.87 2357.0999 21 -0.9 1179.5562 2 77.04 13 F13:51637 NaNaKA16_F9.raw 3.6037E73.3667E71.9932E92.5595E108.2815E91.462E10 68 07050000011161217 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.APYNDDNYNIDLK.A Y 80.92 1553.6997 13 1.1 777.8580 2 40.11 11 F11:24310 NaNaKA16_F7.raw 1.285E91.4557E95.7971E77.0516E7 19 0000000005554 103 115 PEAKS DB
F.AGAPYNDDNYNIDLK.A Y 77.81 1681.7583 15 0.1 841.8865 2 42.69 13 F13:22802 NaNaKA16_F9.raw 1.3878E87.6515E71.16E73.0896E8 16 0000000004336 101 115 PEAKS DB
K.GDNNAC(+57.02)AASVC(+57.02)DC(+57.02)DR.L N 70.22 1683.6035 15 0.2 842.8092 2 12.08 11 F11:1839 NaNaKA16_F7.raw 6.3052E61.0666E60 2 0000000001100 80 94 Carbamidomethylation C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.FAGAPYNDDNYNIDLK.A Y 69.06 1828.8268 16 0.1 915.4208 2 54.79 13 F13:31983 NaNaKA16_F9.raw 4.2561E65.8811E55.6426E7 5 0000000001103 100 115 PEAKS DB
K.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
D.RLAAIC(+57.02)FAGAPYNDDNYNIDLK.A Y 63.91 2513.2009 22 0.9 838.7416 3 64.79 12 F12:43839 NaNaKA16_F8.raw 1.7196E73.8048E6 3 0000000000021 94 115 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
P.YNDDNYNIDLK.A Y 49.28 1385.6099 11 0.1 693.8123 2 36.17 10 F10:20793 NaNaKA16_F6.raw 2.4481E6 1 0000000001000 105 115 PEAKS DB
N.DDNYNIDLK.A Y 48.54 1108.5037 9 -0.4 555.2589 2 37.39 10 F10:21951 NaNaKA16_F6.raw 9.0684E5 1 0000000001000 107 115 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDDNYNIDLKAR.C Y 43.98 2584.2380 23 0.0 862.4199 3 66.94 12 F12:45096 NaNaKA16_F8.raw 4.0557E56.9771E5 2 0000000000110 95 117 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 13 peptides
XP_029140080.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.LPDWTEC(+57.02)EVSGYGK.H N 89.52 1639.7188 14 0.4 820.8669 2 53.18 4 F4:33245 NaNaKA16_F12.raw 2.4114E61.7456E75.2898E85.0846E5 6 0113100000000 436 449 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 99 117 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.H N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 483 495 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.AVC(+57.02)YQDIGDTYR.G Y 79.54 1459.6401 12 0.7 730.8278 2 35.07 11 F11:19729 NaNaKA16_F7.raw 1.2319E61.3702E69.6234E62.3912E77.3676E61.527E6 6 0111000001101 125 136 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GTWSTTESGAEC(+57.02)VNWK.T N 79.36 1811.7784 16 0.6 906.8970 2 40.11 11 F11:23748 NaNaKA16_F7.raw 3.6435E62.669E79.2931E6 3 0001000001100 137 152 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
L.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 171 180 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.H N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 483 495 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.SSKPWC(+57.02)HVLK.K N 63.39 1240.6387 10 0.1 414.5535 3 12.10 11 F11:1845 NaNaKA16_F7.raw 2.6656E6 1 0000000000100 185 194 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 105 117 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 107 117 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 400 409 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 102 117 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.E N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 400 411 PEAKS DB
total 13 peptides
JAI11009.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.LPDWTEC(+57.02)EVSGYGK.H N 89.52 1639.7188 14 0.4 820.8669 2 53.18 4 F4:33245 NaNaKA16_F12.raw 2.4114E61.7456E75.2898E85.0846E5 6 0113100000000 437 450 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
Q.ALYSPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 84.91 2174.0330 19 0.6 1088.0244 2 95.42 12 F12:68966 NaNaKA16_F8.raw 3.6583E51.5307E75.8251E71.0308E74.354E6 9 0100000002222 99 117 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENMLC(+57.02)AGDTR.H N 84.34 1466.6494 13 -0.1 734.3319 2 30.20 4 F4:13667 NaNaKA16_F12.raw 9.0057E7 2 0002000000000 484 496 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.AVC(+57.02)YQDIGDTYR.G Y 79.54 1459.6401 12 0.7 730.8278 2 35.07 11 F11:19729 NaNaKA16_F7.raw 1.2319E61.3702E69.6234E62.3912E77.3676E61.527E6 6 0111000001101 125 136 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.GTWSTTESGAEC(+57.02)VNWK.T N 79.36 1811.7784 16 0.6 906.8970 2 40.11 11 F11:23748 NaNaKA16_F7.raw 3.6435E62.669E79.2931E6 3 0001000001100 137 152 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
L.LGLGDHNYC(+57.02)R.N N 69.80 1203.5455 10 0.7 602.7805 2 12.35 11 F11:2053 NaNaKA16_F7.raw 2.6837E51.9952E6 3 0000000001200 171 180 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TVTENM(+15.99)LC(+57.02)AGDTR.H N 67.27 1482.6443 13 0.9 742.3301 2 28.18 4 F4:11849 NaNaKA16_F12.raw 6.8651E6 5 0005000000000 484 496 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.SSKPWC(+57.02)HVLK.K N 63.39 1240.6387 10 0.1 414.5535 3 12.10 11 F11:1845 NaNaKA16_F7.raw 2.6656E6 1 0000000000100 185 194 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
N.LFIC(+57.02)FC(+57.02)PPGFSGK.F N 61.36 1528.7206 13 -0.1 765.3675 2 80.11 10 F10:58024 NaNaKA16_F6.raw 1.3335E77.5039E6 3 0000000001200 105 117 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
F.IC(+57.02)FC(+57.02)PPGFSGK.F N 58.86 1268.5681 11 0.1 635.2914 2 51.30 10 F10:33995 NaNaKA16_F6.raw 1.0459E75.3422E62.3238E6 3 0000000001110 107 117 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLK.L N 56.75 1114.6234 10 0.2 558.3191 2 53.18 4 F4:32689 NaNaKA16_F12.raw 4.6197E64.3448E8 3 0012000000000 401 410 PEAKS DB
Y.SPNLFIC(+57.02)FC(+57.02)PPGFSGK.F N 49.42 1826.8484 16 1.4 914.4327 2 84.61 12 F12:60077 NaNaKA16_F8.raw 5.8546E57.1533E5 2 0000000000110 102 117 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
R.TLDNDIALLKLK.E N 47.35 1355.8024 12 0.6 452.9417 3 55.08 4 F4:34569 NaNaKA16_F12.raw 8.5072E5 1 0001000000000 401 412 PEAKS DB
total 13 peptides
ADG02948.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 95.50 2964.2898 26 0.7 989.1046 3 43.19 9 F9:25736 NaNaKA16_F5.raw 5.0308E71.4807E8 2 0000000011000 451 476 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.TAPAFQFSSC(+57.02)SIR.E N 80.42 1470.6925 13 0.6 736.3539 2 46.94 4 F4:27572 NaNaKA16_F12.raw 7.7695E67.0106E66.7741E67.3303E52.6381E6 5 0111100000001 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
D.LPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N N 78.21 2160.9780 19 0.3 1081.4966 2 44.94 10 F10:28461 NaNaKA16_F6.raw 2.2687E6 1 0000000001000 458 476 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 68.03 2666.0894 23 -1.2 1334.0503 2 58.77 10 F10:39904 NaNaKA16_F6.raw 6.6603E63.9675E65.5621E56.4952E62.3844E7 9 0002021022000 454 476 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.VYEMINAVNTK.F N 67.13 1280.6434 11 -0.4 641.3287 2 34.28 4 F4:17180 NaNaKA16_F12.raw 2.766E62.8909E6 2 0001100000000 232 242 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.GQC(+57.02)VDVQTAY N 56.58 1139.4917 10 0.2 570.7532 2 32.85 10 F10:17935 NaNaKA16_F6.raw 2.4491E8 1 0000000001000 584 593 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
H.IALIGLEIWSNK.D N 54.66 1355.7812 12 0.3 678.8981 2 85.43 4 F4:59423 NaNaKA16_F12.raw 7.965E52.2382E6 2 0011000000000 250 261 PEAKS DB
K.GC(+57.02)FDLNMR.G N 52.79 1011.4266 8 -0.1 506.7205 2 36.97 10 F10:21218 NaNaKA16_F6.raw 9.5883E8 1 0000000001000 514 521 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.LIGLEIWSNK.D N 47.34 1171.6600 10 0.4 586.8375 2 69.88 4 F4:46518 NaNaKA16_F12.raw 3.0353E5 1 0001000000000 252 261 PEAKS DB
L.IGLEIWSNK.D N 46.89 1058.5760 9 -0.3 530.2952 2 56.37 4 F4:35622 NaNaKA16_F12.raw 6.5535E50 1 0001000000000 253 261 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.HIALIGLEIWSNK.D Y 45.00 1492.8402 13 0.2 498.6208 3 70.93 3 F3:45643 NaNaKA16_F11.raw 1.7705E61.4324E6 2 0110000000000 249 261 PEAKS DB
total 13 peptides
D6PXE8.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 95.50 2964.2898 26 0.7 989.1046 3 43.19 9 F9:25736 NaNaKA16_F5.raw 5.0308E71.4807E8 2 0000000011000 451 476 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.TAPAFQFSSC(+57.02)SIR.E N 80.42 1470.6925 13 0.6 736.3539 2 46.94 4 F4:27572 NaNaKA16_F12.raw 7.7695E67.0106E66.7741E67.3303E52.6381E6 5 0111100000001 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
D.LPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N N 78.21 2160.9780 19 0.3 1081.4966 2 44.94 10 F10:28461 NaNaKA16_F6.raw 2.2687E6 1 0000000001000 458 476 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 68.03 2666.0894 23 -1.2 1334.0503 2 58.77 10 F10:39904 NaNaKA16_F6.raw 6.6603E63.9675E65.5621E56.4952E62.3844E7 9 0002021022000 454 476 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.VYEMINAVNTK.F N 67.13 1280.6434 11 -0.4 641.3287 2 34.28 4 F4:17180 NaNaKA16_F12.raw 2.766E62.8909E6 2 0001100000000 232 242 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.GQC(+57.02)VDVQTAY N 56.58 1139.4917 10 0.2 570.7532 2 32.85 10 F10:17935 NaNaKA16_F6.raw 2.4491E8 1 0000000001000 584 593 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
H.IALIGLEIWSNK.D N 54.66 1355.7812 12 0.3 678.8981 2 85.43 4 F4:59423 NaNaKA16_F12.raw 7.965E52.2382E6 2 0011000000000 250 261 PEAKS DB
K.GC(+57.02)FDLNMR.G N 52.79 1011.4266 8 -0.1 506.7205 2 36.97 10 F10:21218 NaNaKA16_F6.raw 9.5883E8 1 0000000001000 514 521 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.LIGLEIWSNK.D N 47.34 1171.6600 10 0.4 586.8375 2 69.88 4 F4:46518 NaNaKA16_F12.raw 3.0353E5 1 0001000000000 252 261 PEAKS DB
L.IGLEIWSNK.D N 46.89 1058.5760 9 -0.3 530.2952 2 56.37 4 F4:35622 NaNaKA16_F12.raw 6.5535E50 1 0001000000000 253 261 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.HIALIGLEIWSNK.D Y 45.00 1492.8402 13 0.2 498.6208 3 70.93 3 F3:45643 NaNaKA16_F11.raw 1.7705E61.4324E6 2 0110000000000 249 261 PEAKS DB
total 13 peptides
ACN50005.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 95.50 2964.2898 26 0.7 989.1046 3 43.19 9 F9:25736 NaNaKA16_F5.raw 5.0308E71.4807E8 2 0000000011000 451 476 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.TAPAFQFSSC(+57.02)SIR.E N 80.42 1470.6925 13 0.6 736.3539 2 46.94 4 F4:27572 NaNaKA16_F12.raw 7.7695E67.0106E66.7741E67.3303E52.6381E6 5 0111100000001 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
D.LPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N N 78.21 2160.9780 19 0.3 1081.4966 2 44.94 10 F10:28461 NaNaKA16_F6.raw 2.2687E6 1 0000000001000 458 476 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 68.03 2666.0894 23 -1.2 1334.0503 2 58.77 10 F10:39904 NaNaKA16_F6.raw 6.6603E63.9675E65.5621E56.4952E62.3844E7 9 0002021022000 454 476 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.VYEMINAVNTK.F N 67.13 1280.6434 11 -0.4 641.3287 2 34.28 4 F4:17180 NaNaKA16_F12.raw 2.766E62.8909E6 2 0001100000000 232 242 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.GQC(+57.02)VDVQTAY N 56.58 1139.4917 10 0.2 570.7532 2 32.85 10 F10:17935 NaNaKA16_F6.raw 2.4491E8 1 0000000001000 584 593 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
H.IALIGLEIWSNK.D N 54.66 1355.7812 12 0.3 678.8981 2 85.43 4 F4:59423 NaNaKA16_F12.raw 7.965E52.2382E6 2 0011000000000 250 261 PEAKS DB
K.GC(+57.02)FDLNMR.G N 52.79 1011.4266 8 -0.1 506.7205 2 36.97 10 F10:21218 NaNaKA16_F6.raw 9.5883E8 1 0000000001000 514 521 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.LIGLEIWSNK.D N 47.34 1171.6600 10 0.4 586.8375 2 69.88 4 F4:46518 NaNaKA16_F12.raw 3.0353E5 1 0001000000000 252 261 PEAKS DB
L.IGLEIWSNK.D N 46.89 1058.5760 9 -0.3 530.2952 2 56.37 4 F4:35622 NaNaKA16_F12.raw 6.5535E50 1 0001000000000 253 261 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.HIALIGLEIWSNK.D Y 45.00 1492.8402 13 0.2 498.6208 3 70.93 3 F3:45643 NaNaKA16_F11.raw 1.7705E61.4324E6 2 0110000000000 249 261 PEAKS DB
total 13 peptides
D3TTC1.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VAKDDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 95.50 2964.2898 26 0.7 989.1046 3 43.19 9 F9:25736 NaNaKA16_F5.raw 5.0308E71.4807E8 2 0000000011000 451 476 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
R.TAPAFQFSSC(+57.02)SIR.E N 80.42 1470.6925 13 0.6 736.3539 2 46.94 4 F4:27572 NaNaKA16_F12.raw 7.7695E67.0106E66.7741E67.3303E52.6381E6 5 0111100000001 370 382 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
D.LPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N N 78.21 2160.9780 19 0.3 1081.4966 2 44.94 10 F10:28461 NaNaKA16_F6.raw 2.2687E6 1 0000000001000 458 476 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.DDC(+57.02)DLPELC(+57.02)TGQSAEC(+57.02)PTDSLQR.N Y 68.03 2666.0894 23 -1.2 1334.0503 2 58.77 10 F10:39904 NaNaKA16_F6.raw 6.6603E63.9675E65.5621E56.4952E62.3844E7 9 0002021022000 454 476 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
R.VYEMINAVNTK.F N 67.13 1280.6434 11 -0.4 641.3287 2 34.28 4 F4:17180 NaNaKA16_F12.raw 2.766E62.8909E6 2 0001100000000 232 242 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.GQC(+57.02)VDVQTAY N 56.58 1139.4917 10 0.2 570.7532 2 32.85 10 F10:17935 NaNaKA16_F6.raw 2.4491E8 1 0000000001000 584 593 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
H.IALIGLEIWSNK.D N 54.66 1355.7812 12 0.3 678.8981 2 85.43 4 F4:59423 NaNaKA16_F12.raw 7.965E52.2382E6 2 0011000000000 250 261 PEAKS DB
K.GC(+57.02)FDLNMR.G N 52.79 1011.4266 8 -0.1 506.7205 2 36.97 10 F10:21218 NaNaKA16_F6.raw 9.5883E8 1 0000000001000 514 521 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
A.LIGLEIWSNK.D N 47.34 1171.6600 10 0.4 586.8375 2 69.88 4 F4:46518 NaNaKA16_F12.raw 3.0353E5 1 0001000000000 252 261 PEAKS DB
L.IGLEIWSNK.D N 46.89 1058.5760 9 -0.3 530.2952 2 56.37 4 F4:35622 NaNaKA16_F12.raw 6.5535E50 1 0001000000000 253 261 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 391 403 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
I.HIALIGLEIWSNK.D Y 45.00 1492.8402 13 0.2 498.6208 3 70.93 3 F3:45643 NaNaKA16_F11.raw 1.7705E61.4324E6 2 0110000000000 249 261 PEAKS DB
total 13 peptides
P60044.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 23 37 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 24 37 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 38 49 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 24 38 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 39 49 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLQ.A Y 58.95 2356.0793 21 4.1 1179.0518 2 118.61 11 F11:86921 NaNaKA16_F7.raw 01.489E6 1 0000000000001 102 122 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 28 37 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 24 49 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 25 37 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 102 113 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 26 37 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 27 37 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 18 37 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 24 33 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 40 49 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 24 34 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
AAR00254.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 23 37 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 24 37 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 38 49 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 24 38 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 39 49 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLQ.A Y 58.95 2356.0793 21 4.1 1179.0518 2 118.61 11 F11:86921 NaNaKA16_F7.raw 01.489E6 1 0000000000001 102 122 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 28 37 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 24 49 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 25 37 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 102 113 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 26 37 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 27 37 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 18 37 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 24 33 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 40 49 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 24 34 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
1XXW
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLQ.A Y 58.95 2356.0793 21 4.1 1179.0518 2 118.61 11 F11:86921 NaNaKA16_F7.raw 01.489E6 1 0000000000001 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
1S6B
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLQ.A Y 58.95 2356.0793 21 4.1 1179.0518 2 118.61 11 F11:86921 NaNaKA16_F7.raw 01.489E6 1 0000000000001 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
2RD4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.RSWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.58 1997.7937 15 1.2 666.9393 3 70.64 11 F11:48142 NaNaKA16_F7.raw 3.4823E79.6445E6 4 0000000000220 16 30 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GR.G N 77.10 1841.6926 14 2.4 921.8558 2 86.60 11 F11:61115 NaNaKA16_F7.raw 2.3849E73.1182E61.2353E79.152E56.0399E61.4952E95.4032E101.5192E102.1735E9 46 021210001317613 17 30 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRG.G N 61.68 1898.7141 15 1.5 950.3657 2 84.85 11 F11:59757 NaNaKA16_F7.raw 1.1046E7 1 0000000000100 17 31 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
R.LAAIC(+57.02)FAGAPYNDNNYNIDLQ.A Y 58.95 2356.0793 21 4.1 1179.0518 2 118.61 11 F11:86921 NaNaKA16_F7.raw 01.489E6 1 0000000000001 95 115 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
D.FADYGC(+57.02)YC(+57.02)GR.G N 57.15 1267.4750 10 0.8 634.7452 2 25.42 11 F11:11882 NaNaKA16_F7.raw 2.1506E61.834E7 2 0000000001100 21 30 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GRGGSGTPVDDLDR.C N 56.86 3011.2239 26 0.6 1004.7491 3 81.63 11 F11:57027 NaNaKA16_F7.raw 4.9169E6 1 0000000000100 17 42 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
S.WWDFADYGC(+57.02)YC(+57.02)GR.G N 56.83 1754.6605 13 0.8 878.3382 2 78.92 12 F12:55446 NaNaKA16_F8.raw 1.3475E73.6699E6 2 0000000000110 18 30 Carbamidomethylation C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.LAAIC(+57.02)FAGAPYN.D N 53.90 1266.6067 12 0.8 634.3111 2 70.83 11 F11:49747 NaNaKA16_F7.raw 2.6932E86.3964E73.6922E87.2309E93.8533E92.4096E91.5572E9 11 0110000012321 95 106 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
W.WDFADYGC(+57.02)YC(+57.02)GR.G N 50.34 1568.5813 12 0.5 785.2983 2 61.41 11 F11:40293 NaNaKA16_F7.raw 5.6691E6 1 0000000000100 19 30 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
W.DFADYGC(+57.02)YC(+57.02)GR.G N 49.85 1382.5020 11 0.3 692.2585 2 40.50 10 F10:24767 NaNaKA16_F6.raw 5.0674E61.1493E71.4257E6 3 0000000011100 20 30 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
S.C(+57.02)TVPSRSWWDFADYGC(+57.02)YC(+57.02)GR.G N 48.21 2542.0251 20 -0.3 848.3488 3 69.09 11 F11:46749 NaNaKA16_F7.raw 6.2414E6 1 0000000000100 11 30 Carbamidomethylation C1:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 17 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 17 27 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 16 peptides
JAA75025.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
D.YGC(+57.02)YC(+57.02)GPGGSGTPVDDLDR.C Y 89.23 2044.8254 19 -0.4 1023.4196 2 42.89 13 F13:22904 NaNaKA16_F9.raw 3.6643E71.535E7 3 0000000002001 52 70 Carbamidomethylation C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
M.DYGC(+57.02)YC(+57.02)GPGGSGTPVDDLDR.C Y 85.76 2159.8523 20 -2.3 1080.9309 2 50.66 10 F10:34442 NaNaKA16_F6.raw 5.8775E62.4285E62.4039E61.2439E77.7573E91.9455E76.9427E61.1867E7 19 01110000111121 51 70 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
C.YC(+57.02)GPGGSGTPVDDLDR.C Y 84.89 1664.7100 16 0.9 833.3630 2 34.13 13 F13:15430 NaNaKA16_F9.raw 1.7463E81.9571E68.391E55.506E6 6 0000000003111 55 70 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
Y.C(+57.02)GPGGSGTPVDDLDR.C Y 83.55 1501.6467 15 -0.3 751.8304 2 25.73 10 F10:12021 NaNaKA16_F6.raw 1.6307E84.9153E53.7447E6 4 0000000002101 56 70 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
Y.GC(+57.02)YC(+57.02)GPGGSGTPVDDLDR.C Y 82.65 1881.7621 18 0.2 941.8885 2 35.82 13 F13:16810 NaNaKA16_F9.raw 1.02E81.5202E7 3 0000000002001 53 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
G.C(+57.02)YC(+57.02)GPGGSGTPVDDLDR.C Y 75.89 1824.7407 17 -0.1 913.3776 2 35.67 13 F13:16718 NaNaKA16_F9.raw 6.2401E68.775E6 4 0000000003001 54 70 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00 PEAKS DB
P.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 59 70 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 60 70 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 61 70 PEAKS DB
total 9 peptides
ABN72541.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 107 122 PEAKS DB
K.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 107 125 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Q.LKLGVHNVHVHYEDEQIR.V Y 71.23 2185.1392 18 0.9 547.2925 4 22.98 4 F4:7749 NaNaKA16_F12.raw 4.1304E6 1 0001000000000 105 122 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 244 253 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 256 267 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
D.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 243 253 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 257 267 PEAKS DB
total 8 peptides
ABN72545.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 107 122 PEAKS DB
K.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 107 125 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Q.LKLGVHNVHVHYEDEQIR.V Y 71.23 2185.1392 18 0.9 547.2925 4 22.98 4 F4:7749 NaNaKA16_F12.raw 4.1304E6 1 0001000000000 105 122 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 244 253 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 256 267 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
D.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 243 253 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 257 267 PEAKS DB
total 8 peptides
A8QL57.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 107 122 PEAKS DB
K.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 107 125 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Q.LKLGVHNVHVHYEDEQIR.V Y 71.23 2185.1392 18 0.9 547.2925 4 22.98 4 F4:7749 NaNaKA16_F12.raw 4.1304E6 1 0001000000000 105 122 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 244 253 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 256 267 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
D.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 243 253 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 257 267 PEAKS DB
total 8 peptides
A8QL53.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 107 122 PEAKS DB
K.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 107 125 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
Q.LKLGVHNVHVHYEDEQIR.V Y 71.23 2185.1392 18 0.9 547.2925 4 22.98 4 F4:7749 NaNaKA16_F12.raw 4.1304E6 1 0001000000000 105 122 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 244 253 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 256 267 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
D.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 243 253 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 257 267 PEAKS DB
total 8 peptides
XP_026522175.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 107 122 PEAKS DB
R.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 107 125 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 254 267 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 244 253 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 256 267 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.YSEHIAPLSLPSNPPR.M Y 51.85 1776.9158 16 -0.2 593.3124 3 41.69 4 F4:23304 NaNaKA16_F12.raw 1.7578E6 1 0001000000000 154 169 PEAKS DB
N.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 243 253 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 257 267 PEAKS DB
total 8 peptides
XP_026522176.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 84 99 PEAKS DB
R.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 84 102 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 231 244 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 221 230 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 233 244 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.YSEHIAPLSLPSNPPR.M Y 51.85 1776.9158 16 -0.2 593.3124 3 41.69 4 F4:23304 NaNaKA16_F12.raw 1.7578E6 1 0001000000000 131 146 PEAKS DB
N.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 220 230 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 234 244 PEAKS DB
total 8 peptides
XP_026522177.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGVHNVHVHYEDEQIR.V N 101.62 1943.9602 16 0.2 486.9974 4 17.09 4 F4:3865 NaNaKA16_F12.raw 6.3497E8 7 0007000000000 75 90 PEAKS DB
R.LGVHNVHVHYEDEQIRVPK.E N 95.24 2268.1763 19 0.0 568.0513 4 23.37 4 F4:8250 NaNaKA16_F12.raw 1.3694E8 3 0003000000000 75 93 PEAKS DB
R.FPC(+57.02)AQLLEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 222 235 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.QIQGIVSWGR.F N 61.28 1142.6196 10 -0.6 572.3168 2 83.53 4 F4:57766 NaNaKA16_F12.raw 3.0835E63.6982E8 3 0012000000000 212 221 PEAKS DB
P.C(+57.02)AQLLEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 224 235 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
N.YSEHIAPLSLPSNPPR.M Y 51.85 1776.9158 16 -0.2 593.3124 3 41.69 4 F4:23304 NaNaKA16_F12.raw 1.7578E6 1 0001000000000 122 137 PEAKS DB
N.GQIQGIVSWGR.F N 51.14 1199.6411 11 0.9 600.8284 2 49.57 4 F4:29910 NaNaKA16_F12.raw 3.2311E6 1 0001000000000 211 221 PEAKS DB
C.AQLLEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 225 235 PEAKS DB
total 8 peptides
P82463.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SIFGVTTEDC(+57.02)PDGQNLC(+57.02)FK.R Y 97.83 2186.9612 19 -0.6 1094.4872 2 66.71 9 F9:45775 NaNaKA16_F5.raw 6.3064E62.4346E62.938E61.407E101.3055E83.8362E62.3887E61.6324E7 21 01100001113112 8 26 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
K.SIFGVTTEDC(+57.02)PDGQNLC(+57.02)FKR.W Y 91.00 2343.0623 20 0.8 782.0287 3 52.75 9 F9:33810 NaNaKA16_F5.raw 1.8626E7 1 0000000010000 8 27 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)AATC(+57.02)PIAENRDVIEC(+57.02)C(+57.02)STDK.C Y 82.94 2526.0608 22 0.1 843.0276 3 26.01 9 F9:12076 NaNaKA16_F5.raw 1.1949E8 3 0000000030000 41 62 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)AATC(+57.02)PIAENR.D Y 69.11 1318.5758 12 0.5 660.2955 2 11.86 9 F9:1876 NaNaKA16_F5.raw 2.4558E6 1 0000000010000 41 52 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
R.WHMIVPGR.Y Y 69.06 994.5171 8 -1.8 498.2649 2 31.00 9 F9:16710 NaNaKA16_F5.raw 3.3475E54.6031E94.7328E72.2059E6 25 00010000212100 28 35 PEAKS DB
F.GVTTEDC(+57.02)PDGQNLC(+57.02)FK.R Y 67.79 1839.7767 16 0.1 920.8958 2 34.49 9 F9:18426 NaNaKA16_F5.raw 8.7884E6 1 0000000010000 11 26 Carbamidomethylation C7:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.WHM(+15.99)IVPGR.Y Y 63.81 1010.5120 8 0.2 506.2634 2 18.00 9 F9:4372 NaNaKA16_F5.raw 4.2675E84.9641E5 12 00000000111000 28 35 Oxidation (M) M3:Oxidation (M):1000.00 PEAKS DB
K.RWHMIVPGR.Y Y 54.49 1150.6182 9 0.4 384.5468 3 18.86 9 F9:6666 NaNaKA16_F5.raw 1.434E6 2 0000000020000 27 35 PEAKS DB
I.FGVTTEDC(+57.02)PDGQNLC(+57.02)FK.R Y 42.20 1986.8451 17 1.0 994.4308 2 50.65 9 F9:32237 NaNaKA16_F5.raw 1.0969E6 1 0000000010000 10 26 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
P25674.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PTVK.P N 93.61 1390.6584 13 6.1 696.3372 2 26.78 7 F7:8603 NaNaKA16_F3.raw 1.5246E71.5932E65.0659E71.9121E82.2473E106.1192E101.9939E95.3549E60 56 000111213325100 37 49 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K N 81.03 1627.6178 13 6.1 814.8168 2 20.86 8 F8:6556 NaNaKA16_F4.raw 4.0032E52.1346E61.8581E72.2172E61.8648E77.3726E5 12 1000014231000 56 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
C.STDNC(+57.02)NPFPTR.K N 69.23 1307.5564 11 4.8 654.7853 2 11.47 7 F7:1955 NaNaKA16_F3.raw 3.2217E61.3046E72.4922E61.0115E7 5 0000011120000 58 68 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
C.C(+57.02)STDNC(+57.02)NPFPTR.K N 66.15 1467.5872 12 0.1 734.8009 2 20.98 6 F6:8194 NaNaKA16_F2.raw 3.5509E61.6348E61.0498E71.4874E7 5 1000012010000 57 68 Carbamidomethylation C1:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
R.VDLGC(+57.02)AATC(+57.02)PTV.K N 45.13 1262.5635 12 -0.9 632.2885 2 50.91 10 F10:33445 NaNaKA16_F6.raw 1.1303E75.2132E7 2 0000001001000 37 48 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
T.DNC(+57.02)NPFPTR.K N 44.94 1119.4767 9 0.7 560.7460 2 23.18 6 F6:10002 NaNaKA16_F2.raw 3.0548E5 1 0000010000000 60 68 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.RVDLGC(+57.02)AATC(+57.02)PTVK.P N 44.70 1546.7595 14 -0.8 516.5934 3 18.27 9 F9:5871 NaNaKA16_F5.raw 1.5478E52.2798E6 2 0000000110000 36 49 Carbamidomethylation C6:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
G.VDIKC(+57.02)C(+57.02)STDNC(+57.02)NPFPTR.K Y 42.24 2082.8921 17 -4.8 695.2978 3 40.50 7 F7:19795 NaNaKA16_F3.raw 4.6388E6 1 0000001000000 52 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
D.NC(+57.02)NPFPTR.K N 41.96 1004.4498 8 -0.2 503.2321 2 43.27 9 F9:25860 NaNaKA16_F5.raw 0 0 0000000000000 61 68 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
P0DI91.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.RSPLEEC(+57.02)FQQNDYEEFLEIAR.N Y 83.05 2672.2175 21 1.4 891.7477 3 78.80 4 F4:53897 NaNaKA16_F12.raw 2.2899E71.3716E6 2 0001000001000 4 24 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.REIQALC(+57.02)YPSIK.K N 74.57 1476.7759 12 -0.3 493.2658 3 32.85 4 F4:15922 NaNaKA16_F12.raw 1.3566E72.8894E62.7998E5 4 0002100000001 83 94 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.EIQALC(+57.02)YPSIK.K N 73.42 1320.6747 11 -0.2 661.3445 2 47.89 3 F3:27602 NaNaKA16_F11.raw 01.5106E73.3878E72.1775E73.2256E6 4 0011100000001 84 94 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.SPLEEC(+57.02)FQQNDYEEFLEIAR.N Y 69.73 2516.1165 20 0.9 839.7135 3 88.96 4 F4:62291 NaNaKA16_F12.raw 1.3696E64.3724E57.453E5 3 0001000001001 5 24 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.KFWEADGIHGGK.V N 66.46 1343.6622 12 -0.8 448.8943 3 17.58 5 F5:3842 NaNaKA16_F13.raw 2.6107E6 2 0000200000000 58 69 PEAKS DB
N.DLSLIHDLPK.R N 62.72 1149.6393 10 1.4 575.8277 2 52.52 3 F3:29824 NaNaKA16_F11.raw 1.6899E67.7612E64.7179E6 4 0112000000000 73 82 PEAKS DB
K.FWEADGIHGGK.V N 57.27 1215.5673 11 -0.2 608.7908 2 22.40 5 F5:5921 NaNaKA16_F13.raw 1.8542E7 2 0000200000000 59 69 PEAKS DB
E.DSSYHLSFIESLK.S Y 54.67 1524.7460 13 -0.4 509.2557 3 60.89 2 F2:38089 NaNaKA16_F10.raw 1.0135E6 1 0100000000000 36 48 PEAKS DB
K.SDALFSYEK.K N 53.51 1058.4919 9 1.2 530.2539 2 36.12 5 F5:13813 NaNaKA16_F13.raw 1.7934E62.9321E7 2 0001100000000 49 57 PEAKS DB
R.RSPLEEC(+57.02)FQQN.D N 46.24 1406.6249 11 0.2 704.3199 2 30.98 6 F6:16775 NaNaKA16_F2.raw 5.3696E6 1 0000010000000 4 14 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.RSPLEEC(+57.02)FQQNDYEEF.L Y 43.99 2089.8687 16 0.5 1045.9421 2 63.35 9 F9:43147 NaNaKA16_F5.raw 2.7322E6 1 0000000010000 4 19 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 11 peptides
P86540.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LIPLAYKTC(+57.02)PAGK.D N 79.70 1430.7955 13 0.0 716.4050 2 25.87 11 F11:12139 NaNaKA16_F7.raw 9.7323E404.3516E74.1837E72.4864E6 7 0100000002220 6 18 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.NSLLVKYEC(+57.02)C(+57.02)NTDRC(+57.02)N N 75.75 2044.8765 16 0.3 682.6329 3 23.00 11 F11:9699 NaNaKA16_F7.raw 9.8402E52.1018E71.6302E6 4 0000000010210 45 60 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.NSLLVKYEC(+57.02)C(+57.02)NTDR.C N 74.45 1770.8029 14 0.3 591.2751 3 21.35 9 F9:8563 NaNaKA16_F5.raw 6.2524E69.9017E64.0334E71.719E6 7 0000000022210 45 58 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKNSLLVK.Y N 68.20 1601.8269 14 1.2 801.9217 2 32.93 11 F11:17854 NaNaKA16_F7.raw 3.4688E62.4226E74.8159E73.5284E71.3913E83.2893E6 11 0001000022321 37 50 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.MYMVSDKTVPVK.R Y 66.57 1396.7095 12 0.4 699.3623 2 24.45 10 F10:10888 NaNaKA16_F6.raw 5.2696E68.0968E5 9 0000000006300 24 35 PEAKS DB
K.C(+57.02)NKLIPLAYK.T N 64.76 1218.6794 10 0.0 610.3470 2 27.82 11 F11:13604 NaNaKA16_F7.raw 4.8462E62.3967E71.338E6 6 0000000002220 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YEC(+57.02)C(+57.02)NTDR.C N 48.64 1116.3965 8 0.5 559.2058 2 11.28 2 F2:1740 NaNaKA16_F10.raw 8.8663E57.7742E5 2 0100000000010 51 58 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.MYMVSDKTVPVKR.G Y 46.93 1552.8105 13 -0.3 389.2098 4 17.80 11 F11:5501 NaNaKA16_F7.raw 3.3127E5 1 0000000000100 24 36 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.N N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 37 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.LIPLAYK.T N 44.45 816.5109 7 0.5 409.2629 2 54.15 9 F9:34957 NaNaKA16_F5.raw 3.0941E72.6175E72.3481E709.2494E600 12 0000010270200 6 12 PEAKS DB
total 10 peptides
P01440.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NLC(+57.02)YKMYMVATPK.V N 76.09 1617.7717 13 1.0 540.2651 3 40.76 3 F3:21520 NaNaKA16_F11.raw 1.1161E88.8933E72.7026E66.0171E61.0433E7 13 0432000000022 19 31 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.LVPLFYKTC(+57.02)PAGK.N N 73.66 1492.8112 13 -0.3 498.6109 3 36.55 10 F10:21078 NaNaKA16_F6.raw 1.9305E66.2426E61.2125E71.1688E75.7221E51.8629E7 10 0122000002120 6 18 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.MYMVATPKVPVK.R N 69.79 1362.7404 12 0.3 682.3777 2 33.08 3 F3:15035 NaNaKA16_F11.raw 1.4824E61.7787E75.0904E603.8618E65.7667E61.0364E7 10 0122000001022 24 35 PEAKS DB
K.LVPLFYKTC(+57.02)PAGKNLC(+57.02)YK.M N 68.71 2171.1272 18 0.0 543.7891 4 39.14 2 F2:20436 NaNaKA16_F10.raw 1.2494E75.7358E6 4 0220000000000 6 23 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NKLVPLFYK.T N 68.01 1280.6951 10 -0.1 641.3547 2 39.35 4 F4:21415 NaNaKA16_F12.raw 3.2793E55.2282E67.4866E67.2675E6 7 0102000000022 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.MYMVATPK.V N 57.98 939.4558 8 0.2 470.7353 2 80.14 2 F2:54827 NaNaKA16_F10.raw 6.1524E54.1543E87.6807E89.3976E68.1538E63.4343E55.559E73.0059E71.5397E7 31 110122110001102 24 31 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLVLK.Y Y 57.12 1574.8160 14 -0.3 525.9458 3 33.98 4 F4:16775 NaNaKA16_F12.raw 3.3882E61.4076E6 2 0001000000010 37 50 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.MYMVATPKVPVKR.G N 55.52 1518.8414 13 0.7 507.2881 3 22.16 3 F3:6654 NaNaKA16_F11.raw 4.2443E56.4334E57.6552E5 3 0110000000010 24 36 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 51 58 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.MYM(+15.99)VATPK.V N 50.67 955.4507 8 0.9 478.7330 2 12.45 9 F9:2420 NaNaKA16_F5.raw 01.5678E82.9325E51.4671E74.6131E63.2608E54.1111E6 10 0030000012211 24 31 Oxidation (M) M3:Oxidation (M):39.76 PEAKS DB
K.M(+15.99)YMVATPK.V N 50.53 955.4507 8 -1.4 478.7319 2 23.80 3 F3:7731 NaNaKA16_F11.raw 4.99E71.1486E81.4502E7 5 0120000002000 24 31 Oxidation (M) M1:Oxidation (M):40.21 PEAKS DB
K.M(+15.99)YM(+15.99)VATPK.V N 49.54 971.4456 8 -0.9 486.7296 2 18.43 3 F3:3370 NaNaKA16_F11.raw 2.4924E67.1227E66.7927E6 5 0120000002000 24 31 Oxidation (M) M1:Oxidation (M):1000.00;M3:Oxidation (M):1000.00 PEAKS DB
K.SSLVLKYVC(+57.02)C(+57.02)NTDRC(+57.02)N Y 48.34 1987.8914 16 0.9 994.9539 2 34.13 2 F2:16403 NaNaKA16_F10.raw 9.2923E5 1 0100000000000 45 60 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.NLC(+57.02)YKM(+15.99)YMVATPK.V N 48.00 1633.7666 13 0.4 817.8909 2 40.76 3 F3:21375 NaNaKA16_F11.raw 1.9576E6 1 0010000000000 19 31 Carbamidomethylation; Oxidation (M) C3:Carbamidomethylation:1000.00;M6:Oxidation (M):40.21 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 37 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PAGKNLC(+57.02)YK.M N 44.80 1310.6111 11 0.6 437.8779 3 11.38 12 F12:1793 NaNaKA16_F8.raw 2.5665E5 1 0000000000010 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.MYM(+15.99)VATPKVPVK.R N 43.62 1378.7352 12 -0.7 690.3744 2 26.28 12 F12:11654 NaNaKA16_F8.raw 5.4527E5 1 0000000000010 24 35 Oxidation (M) M3:Oxidation (M):25.86 PEAKS DB
total 17 peptides
5H7W
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.HGQGTGELLQVSGIK.V N 77.57 1522.8103 15 0.5 762.4128 2 32.78 5 F5:12050 NaNaKA16_F13.raw 4.2458E55.0296E6 3 0001200000000 418 432 PEAKS DB
R.VVSLNVLC(+57.02)TEC(+57.02)R.V Y 73.80 1448.7115 12 0.0 725.3630 2 49.09 10 F10:32110 NaNaKA16_F6.raw 2.3522E67.2729E6 2 0000100001000 445 456 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 72.86 2420.1365 20 0.2 807.7196 3 76.91 13 F13:50987 NaNaKA16_F9.raw 5.2029E62.2685E7 3 0000000000012 330 349 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.VPTYVPLEMEK.T N 72.07 1304.6686 11 1.1 653.3423 2 50.51 5 F5:20383 NaNaKA16_F13.raw 01.0366E66.7478E6 2 0001100000000 457 467 PEAKS DB
R.QVPVVQAYAFGK.Y N 68.51 1305.7081 12 -0.2 653.8612 2 81.22 5 F5:33335 NaNaKA16_F13.raw 4.7302E54.1666E6 3 0001200000000 249 260 PEAKS DB
E.LTILHTNDVHAR.L N 61.22 1388.7524 12 -0.8 463.9244 3 12.08 5 F5:1993 NaNaKA16_F13.raw 9.2667E5 1 0000100000000 5 16 PEAKS DB
K.ETPVLSNPGPYLEFR.D N 55.50 1717.8674 15 -0.2 859.9409 2 68.90 5 F5:28106 NaNaKA16_F13.raw 1.3217E6 1 0000100000000 155 169 PEAKS DB
K.VVYDLSQKPGK.R Y 51.28 1232.6764 11 0.5 411.8996 3 12.16 5 F5:2047 NaNaKA16_F13.raw 4.4733E4 1 0000100000000 433 443 PEAKS DB
K.VQLQNYSSQEIGR.T Y 49.47 1520.7583 13 0.1 761.3865 2 29.54 5 F5:9993 NaNaKA16_F13.raw 3.2134E5 1 0000100000000 304 316 PEAKS DB
R.VPTYVPLEM(+15.99)EK.T N 47.95 1320.6635 11 0.2 661.3391 2 38.01 5 F5:14849 NaNaKA16_F13.raw 6.2061E5 1 0000100000000 457 467 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.VGIIGYTTK.E N 46.40 950.5436 9 0.7 476.2794 2 30.07 5 F5:10298 NaNaKA16_F13.raw 6.7595E6 1 0000100000000 146 154 PEAKS DB
N.ISGYILPYK.I N 45.32 1052.5906 9 0.8 527.3030 2 46.37 5 F5:18970 NaNaKA16_F13.raw 5.2097E6 1 0000100000000 129 137 PEAKS DB
total 12 peptides
A0A2I4HXH5.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.HGQGTGELLQVSGIK.V N 77.57 1522.8103 15 0.5 762.4128 2 32.78 5 F5:12050 NaNaKA16_F13.raw 4.2458E55.0296E6 3 0001200000000 418 432 PEAKS DB
R.VVSLNVLC(+57.02)TEC(+57.02)R.V Y 73.80 1448.7115 12 0.0 725.3630 2 49.09 10 F10:32110 NaNaKA16_F6.raw 2.3522E67.2729E6 2 0000100001000 445 456 Carbamidomethylation C8:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 72.86 2420.1365 20 0.2 807.7196 3 76.91 13 F13:50987 NaNaKA16_F9.raw 5.2029E62.2685E7 3 0000000000012 330 349 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.VPTYVPLEMEK.T N 72.07 1304.6686 11 1.1 653.3423 2 50.51 5 F5:20383 NaNaKA16_F13.raw 01.0366E66.7478E6 2 0001100000000 457 467 PEAKS DB
R.QVPVVQAYAFGK.Y N 68.51 1305.7081 12 -0.2 653.8612 2 81.22 5 F5:33335 NaNaKA16_F13.raw 4.7302E54.1666E6 3 0001200000000 249 260 PEAKS DB
E.LTILHTNDVHAR.L N 61.22 1388.7524 12 -0.8 463.9244 3 12.08 5 F5:1993 NaNaKA16_F13.raw 9.2667E5 1 0000100000000 5 16 PEAKS DB
K.ETPVLSNPGPYLEFR.D N 55.50 1717.8674 15 -0.2 859.9409 2 68.90 5 F5:28106 NaNaKA16_F13.raw 1.3217E6 1 0000100000000 155 169 PEAKS DB
K.VVYDLSQKPGK.R Y 51.28 1232.6764 11 0.5 411.8996 3 12.16 5 F5:2047 NaNaKA16_F13.raw 4.4733E4 1 0000100000000 433 443 PEAKS DB
K.VQLQNYSSQEIGR.T Y 49.47 1520.7583 13 0.1 761.3865 2 29.54 5 F5:9993 NaNaKA16_F13.raw 3.2134E5 1 0000100000000 304 316 PEAKS DB
R.VPTYVPLEM(+15.99)EK.T N 47.95 1320.6635 11 0.2 661.3391 2 38.01 5 F5:14849 NaNaKA16_F13.raw 6.2061E5 1 0000100000000 457 467 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.VGIIGYTTK.E N 46.40 950.5436 9 0.7 476.2794 2 30.07 5 F5:10298 NaNaKA16_F13.raw 6.7595E6 1 0000100000000 146 154 PEAKS DB
N.ISGYILPYK.I N 45.32 1052.5906 9 0.8 527.3030 2 46.37 5 F5:18970 NaNaKA16_F13.raw 5.2097E6 1 0000100000000 129 137 PEAKS DB
total 12 peptides
P19859.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FC(+57.02)ELAPSAGSC(+57.02)FGFVSSYYYNR.Y Y 88.81 2581.1042 22 1.4 861.3766 3 80.30 9 F9:58071 NaNaKA16_F5.raw 9.1242E63.1298E87.8424E62.7271E71.4564E78.7373E6 15 0000000261222 4 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.FGFVSSYYYNR.Y Y 66.32 1401.6353 11 0.4 701.8252 2 55.40 9 F9:35924 NaNaKA16_F5.raw 7.7088E7 1 0000000010000 15 25 PEAKS DB
F.GFVSSYYYNR.Y Y 57.18 1254.5669 10 -1.2 628.2866 2 35.39 8 F8:17699 NaNaKA16_F4.raw 3.3057E72.894E7 2 0000001100000 16 25 PEAKS DB
R.YSNTC(+57.02)HSFTY.S Y 55.37 1278.4976 10 0.0 640.2560 2 21.02 9 F9:8253 NaNaKA16_F5.raw 1.0479E7 1 0000000010000 26 35 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)FGF.V Y 54.88 1548.6377 14 0.9 775.3268 2 86.97 9 F9:63427 NaNaKA16_F5.raw 3.4844E8 1 0000000010000 4 17 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
S.AGSC(+57.02)FGFVSSYYYNR.Y Y 54.26 1776.7566 15 0.3 889.3858 2 61.53 9 F9:41371 NaNaKA16_F5.raw 9.3714E6 1 0000000010000 11 25 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
L.APSAGSC(+57.02)FGFVSSYYYNR.Y Y 53.17 2031.8784 18 0.6 1016.9471 2 64.10 9 F9:43764 NaNaKA16_F5.raw 2.531E6 1 0000000010000 8 25 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.G N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 4 15 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
G.FVSSYYYNR.Y Y 49.56 1197.5454 9 5.5 599.7801 2 26.39 8 F8:10833 NaNaKA16_F4.raw 2.4207E66.1561E6 2 0000000110000 17 25 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)FGFVSSY.Y Y 45.14 1984.8335 18 0.8 993.4248 2 91.33 9 F9:67008 NaNaKA16_F5.raw 4.9023E7 1 0000000010000 4 21 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.YSNTC(+57.02)HSFTYSGC(+57.02).G Y 44.20 1582.5817 13 0.6 792.2986 2 21.90 9 F9:8790 NaNaKA16_F5.raw 1.9651E7 1 0000000010000 26 38 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
P.RFC(+57.02)ELAPSAGSC(+57.02)FGFVSSYYYNR.Y Y 42.03 2737.2053 23 -0.9 913.4082 3 67.15 11 F11:45247 NaNaKA16_F7.raw 2.4763E6 1 0000000000100 3 25 Carbamidomethylation C3:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 12 peptides
1702215A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FC(+57.02)ELAPSAGSC(+57.02)FGFVSSYYYNR.Y Y 88.81 2581.1042 22 1.4 861.3766 3 80.30 9 F9:58071 NaNaKA16_F5.raw 9.1242E63.1298E87.8424E62.7271E71.4564E78.7373E6 15 0000000261222 4 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
C.FGFVSSYYYNR.Y Y 66.32 1401.6353 11 0.4 701.8252 2 55.40 9 F9:35924 NaNaKA16_F5.raw 7.7088E7 1 0000000010000 15 25 PEAKS DB
F.GFVSSYYYNR.Y Y 57.18 1254.5669 10 -1.2 628.2866 2 35.39 8 F8:17699 NaNaKA16_F4.raw 3.3057E72.894E7 2 0000001100000 16 25 PEAKS DB
R.YSNTC(+57.02)HSFTY.S Y 55.37 1278.4976 10 0.0 640.2560 2 21.02 9 F9:8253 NaNaKA16_F5.raw 1.0479E7 1 0000000010000 26 35 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)FGF.V Y 54.88 1548.6377 14 0.9 775.3268 2 86.97 9 F9:63427 NaNaKA16_F5.raw 3.4844E8 1 0000000010000 4 17 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
S.AGSC(+57.02)FGFVSSYYYNR.Y Y 54.26 1776.7566 15 0.3 889.3858 2 61.53 9 F9:41371 NaNaKA16_F5.raw 9.3714E6 1 0000000010000 11 25 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
L.APSAGSC(+57.02)FGFVSSYYYNR.Y Y 53.17 2031.8784 18 0.6 1016.9471 2 64.10 9 F9:43764 NaNaKA16_F5.raw 2.531E6 1 0000000010000 8 25 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.G N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 4 15 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
G.FVSSYYYNR.Y Y 49.56 1197.5454 9 5.5 599.7801 2 26.39 8 F8:10833 NaNaKA16_F4.raw 2.4207E66.1561E6 2 0000000110000 17 25 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)FGFVSSY.Y Y 45.14 1984.8335 18 0.8 993.4248 2 91.33 9 F9:67008 NaNaKA16_F5.raw 4.9023E7 1 0000000010000 4 21 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.YSNTC(+57.02)HSFTYSGC(+57.02).G Y 44.20 1582.5817 13 0.6 792.2986 2 21.90 9 F9:8790 NaNaKA16_F5.raw 1.9651E7 1 0000000010000 26 38 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
P.RFC(+57.02)ELAPSAGSC(+57.02)FGFVSSYYYNR.Y Y 42.03 2737.2053 23 -0.9 913.4082 3 67.15 11 F11:45247 NaNaKA16_F7.raw 2.4763E6 1 0000000000100 3 25 Carbamidomethylation C3:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 12 peptides
ETE68810.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NSC(+57.02)PPVVETFGDTAK.L Y 83.83 1620.7454 15 0.4 811.3803 2 37.81 6 F6:22302 NaNaKA16_F2.raw 3.7961E62.8507E72.9105E72.4421E63.064E64.1372E6 8 0001220111000 197 211 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.LVILGFPC(+57.02)NQFGK.Q N 75.66 1491.7908 13 0.9 746.9033 2 75.14 4 F4:50923 NaNaKA16_F12.raw 1.9324E78.891E61.0383E71.972E72.0275E61.0176E74.4683E6 7 0111100000111 137 149 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.QEPGQNSEILQGIK.H N 72.65 1539.7893 14 1.0 770.9027 2 36.16 5 F5:14005 NaNaKA16_F13.raw 3.6181E62.8478E7 3 0001200000000 150 163 PEAKS DB
L.VILGFPC(+57.02)NQFGK.Q N 63.26 1378.7067 12 0.9 690.3612 2 60.52 12 F12:39695 NaNaKA16_F8.raw 3.3914E62.4189E62.1917E63.4327E64.8393E6 5 0100000001111 138 149 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
L.KNSC(+57.02)PPVVETFGDTAK.L Y 58.26 1748.8403 16 0.7 583.9545 3 24.33 6 F6:10585 NaNaKA16_F2.raw 2.3512E6 1 0000010000000 196 211 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
T.ELNALQNSLK.T Y 58.17 1128.6139 10 -0.1 565.3141 2 31.56 6 F6:17301 NaNaKA16_F2.raw 1.2474E7 1 0000010000000 124 133 PEAKS DB
K.FLVNPQGKPVMR.W N 57.92 1384.7649 12 1.1 462.5961 3 26.92 5 F5:8608 NaNaKA16_F13.raw 1.9299E6 1 0000100000000 229 240 PEAKS DB
C.SYAPNSQPIPDR.A N 52.88 1343.6470 12 0.3 672.8310 2 19.74 5 F5:4861 NaNaKA16_F13.raw 1.9768E68.8175E5 2 0000110000000 90 101 PEAKS DB
K.NSC(+57.02)PPVVETFG.D N 51.85 1205.5387 11 0.2 603.7767 2 53.03 6 F6:34639 NaNaKA16_F2.raw 5.7957E71.0144E73.2539E6 3 0000011001000 197 207 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.LFWSPLK.I N 50.13 889.5062 7 -0.4 445.7602 2 61.25 2 F2:38338 NaNaKA16_F10.raw 1.0564E72.3049E74.474E69.3271E68.0536E64.602E6 6 0111100001100 212 218 PEAKS DB
total 10 peptides
XP_026570202.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.ALNEAC(+57.02)ESVIQTAC(+57.02)K.H Y 79.78 1692.7811 15 0.1 847.3979 2 33.28 4 F4:16250 NaNaKA16_F12.raw 7.8004E52.1456E6 2 0011000000000 488 502 Carbamidomethylation C6:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
R.LSYLLMC(+57.02)LESAVHR.G Y 66.53 1690.8535 14 0.4 564.6254 3 75.96 4 F4:51604 NaNaKA16_F12.raw 1.2498E65.0919E55.032E5 4 0211000000000 384 397 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
T.EMMDPELDYTLMR.V Y 65.34 1642.7041 13 0.2 822.3595 2 71.71 10 F10:50951 NaNaKA16_F6.raw 5.7591E6 1 0000000001000 856 868 PEAKS DB
R.QVSSEC(+57.02)QGEMLDYR.R Y 65.27 1700.7134 14 0.5 851.3644 2 30.29 4 F4:13595 NaNaKA16_F12.raw 9.4592E5 1 0001000000000 400 413 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.MTAIIFSDYR.L Y 62.66 1215.5958 10 0.0 608.8052 2 58.13 4 F4:36942 NaNaKA16_F12.raw 9.3455E51.2514E68.0173E5 3 0111000000000 209 218 PEAKS DB
M.DPELDYTLMR.V Y 58.88 1251.5806 10 0.0 626.7975 2 58.42 9 F9:38833 NaNaKA16_F5.raw 2.3119E6 1 0000000010000 859 868 PEAKS DB
R.SGDPMILSC(+57.02)LMEHLYTEK.M Y 54.83 2122.9736 18 0.2 708.6653 3 87.32 4 F4:60933 NaNaKA16_F12.raw 1.0515E6 1 0001000000000 506 523 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.LLELQYFISR.D Y 53.33 1280.7129 10 0.6 641.3641 2 79.15 4 F4:54084 NaNaKA16_F12.raw 1.3142E6 1 0001000000000 532 541 PEAKS DB
P.ELDYTLMR.V Y 50.52 1039.5009 8 -0.5 520.7574 2 44.47 9 F9:26860 NaNaKA16_F5.raw 5.1797E6 2 0000000020000 861 868 PEAKS DB
R.IEMWSFAAK.V Y 48.70 1081.5266 9 0.2 541.7707 2 59.06 2 F2:36380 NaNaKA16_F10.raw 4.9011E5 1 0100000000000 1102 1110 PEAKS DB
R.VAELSSDDFHLDR.H Y 48.48 1502.7001 13 -0.1 501.9072 3 38.95 4 F4:20893 NaNaKA16_F12.raw 3.427E5 1 0001000000000 284 296 PEAKS DB
R.LSYLLM(+15.99)C(+57.02)LESAVHR.G Y 42.33 1706.8484 14 0.2 569.9568 3 71.41 3 F3:45998 NaNaKA16_F11.raw 3.4744E5 1 0010000000000 384 397 Oxidation (M); Carbamidomethylation M6:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 12 peptides
Q9W6W9.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.LVPLFYKTC(+57.02)PAGK.N N 73.66 1492.8112 13 -0.3 498.6109 3 36.55 10 F10:21078 NaNaKA16_F6.raw 1.9305E66.2426E61.2125E71.1688E75.7221E51.8629E7 10 0122000002120 27 39 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.LVPLFYKTC(+57.02)PAGKNLC(+57.02)YK.M N 68.71 2171.1272 18 0.0 543.7891 4 39.14 2 F2:20436 NaNaKA16_F10.raw 1.2494E75.7358E6 4 0220000000000 27 44 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NKLVPLFYK.T N 68.01 1280.6951 10 -0.1 641.3547 2 39.35 4 F4:21415 NaNaKA16_F12.raw 3.2793E55.2282E67.4866E67.2675E6 7 0102000000022 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PAGKNLC(+57.02)YK.M N 44.80 1310.6111 11 0.6 437.8779 3 11.38 12 F12:1793 NaNaKA16_F8.raw 2.5665E5 1 0000000000010 34 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.MFM(+15.99)VSNLTVPVKR.G Y 42.32 1536.8157 13 -0.3 385.2111 4 24.96 10 F10:11084 NaNaKA16_F6.raw 3.5601E5 1 0000000001000 45 57 Oxidation (M) M3:Oxidation (M):0.00 PEAKS DB
total 10 peptides
CAB42057.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.LVPLFYKTC(+57.02)PAGK.N N 73.66 1492.8112 13 -0.3 498.6109 3 36.55 10 F10:21078 NaNaKA16_F6.raw 1.9305E66.2426E61.2125E71.1688E75.7221E51.8629E7 10 0122000002120 27 39 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.LVPLFYKTC(+57.02)PAGKNLC(+57.02)YK.M N 68.71 2171.1272 18 0.0 543.7891 4 39.14 2 F2:20436 NaNaKA16_F10.raw 1.2494E75.7358E6 4 0220000000000 27 44 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NKLVPLFYK.T N 68.01 1280.6951 10 -0.1 641.3547 2 39.35 4 F4:21415 NaNaKA16_F12.raw 3.2793E55.2282E67.4866E67.2675E6 7 0102000000022 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PAGKNLC(+57.02)YK.M N 44.80 1310.6111 11 0.6 437.8779 3 11.38 12 F12:1793 NaNaKA16_F8.raw 2.5665E5 1 0000000000010 34 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.MFM(+15.99)VSNLTVPVKR.G Y 42.32 1536.8157 13 -0.3 385.2111 4 24.96 10 F10:11084 NaNaKA16_F6.raw 3.5601E5 1 0000000001000 45 57 Oxidation (M) M3:Oxidation (M):0.00 PEAKS DB
total 10 peptides
P82885.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ADVTFDSNTAFESLVVSPDKK.T Y 94.59 2269.1113 21 -0.4 1135.5625 2 66.19 2 F2:42503 NaNaKA16_F10.raw 2.8885E83.556E62.6478E62.1479E6 6 0311000001000 9 29 PEAKS DB
R.FDGSPC(+57.02)VLGSPGFR.S Y 81.12 1494.6925 14 1.3 748.3545 2 52.39 2 F2:30743 NaNaKA16_F10.raw 1.3035E88.1299E61.7629E65.5091E61.2638E65.3893E5 8 0311000011001 47 60 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.TVENVGVSQVAPDNPER.F Y 72.54 1809.8856 17 0.3 905.9504 2 28.99 4 F4:12723 NaNaKA16_F12.raw 4.4967E52.8451E61.0607E6 3 1001000010000 30 46 PEAKS DB
K.TVENVGVSQVAPDNPERFDGSPC(+57.02)VLGSPGFR.S Y 68.97 3286.5676 31 0.6 1096.5305 3 61.34 2 F2:38663 NaNaKA16_F10.raw 4.7404E7 1 0100000000000 30 60 Carbamidomethylation C23:Carbamidomethylation:1000.00 PEAKS DB
K.ADVTFDSNTAFESLVVSPDK.K Y 67.96 2141.0164 20 0.4 1071.5159 2 79.78 2 F2:54526 NaNaKA16_F10.raw 1.937E6 1 0100000000000 9 28 PEAKS DB
R.EWAVGLAGK.S Y 43.22 929.4970 9 -0.6 465.7555 2 37.09 4 F4:19505 NaNaKA16_F12.raw 4.4943E56.5516E5 2 0001000010000 75 83 PEAKS DB
total 6 peptides
P01427.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQPPTTK.T Y 90.54 1753.8053 15 -2.8 877.9075 2 11.84 6 F6:1921 NaNaKA16_F2.raw 3.9815E73.3625E82.7134E6 7 2000032000000 1 15 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02)R.T Y 73.50 1315.6489 11 4.7 658.8315 2 11.28 7 F7:1787 NaNaKA16_F3.raw 8.7631E62.55E86.5001E68.5404E4 10 2000052100000 45 55 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.PGVNLNC(+57.02)C(+57.02)R.T Y 61.71 1088.4856 9 -3.5 545.2482 2 11.84 6 F6:2180 NaNaKA16_F2.raw 6.794E44.9207E6 3 1000020000000 47 55 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02).C Y 60.37 999.5172 9 0.2 500.7659 2 12.45 6 F6:2465 NaNaKA16_F2.raw 1.6082E6 1 0000010000000 45 53 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)SGETNC(+57.02)YK.K Y 54.62 1218.4645 10 -2.4 610.2380 2 11.84 6 F6:1942 NaNaKA16_F2.raw 2.3803E65.9614E6 2 1000010000000 16 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02).R Y 51.22 1159.5479 10 0.8 580.7817 2 12.51 6 F6:2512 NaNaKA16_F2.raw 9.6916E5 1 0000010000000 45 54 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.WWSDHRGTIIER.G Y 50.82 1554.7692 12 0.6 389.6998 4 33.34 6 F6:18624 NaNaKA16_F2.raw 3.5624E6 1 0000010000000 27 38 PEAKS DB
K.KWWSDHR.G Y 48.51 1013.4832 7 -0.3 507.7487 2 14.91 6 F6:3847 NaNaKA16_F2.raw 1.42E6 1 0000010000000 26 32 PEAKS DB
total 8 peptides
1NOR
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQPPTTK.T Y 90.54 1753.8053 15 -2.8 877.9075 2 11.84 6 F6:1921 NaNaKA16_F2.raw 3.9815E73.3625E82.7134E6 7 2000032000000 1 15 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02)R.T Y 73.50 1315.6489 11 4.7 658.8315 2 11.28 7 F7:1787 NaNaKA16_F3.raw 8.7631E62.55E86.5001E68.5404E4 10 2000052100000 45 55 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.PGVNLNC(+57.02)C(+57.02)R.T Y 61.71 1088.4856 9 -3.5 545.2482 2 11.84 6 F6:2180 NaNaKA16_F2.raw 6.794E44.9207E6 3 1000020000000 47 55 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02).C Y 60.37 999.5172 9 0.2 500.7659 2 12.45 6 F6:2465 NaNaKA16_F2.raw 1.6082E6 1 0000010000000 45 53 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)SGETNC(+57.02)YK.K Y 54.62 1218.4645 10 -2.4 610.2380 2 11.84 6 F6:1942 NaNaKA16_F2.raw 2.3803E65.9614E6 2 1000010000000 16 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02).R Y 51.22 1159.5479 10 0.8 580.7817 2 12.51 6 F6:2512 NaNaKA16_F2.raw 9.6916E5 1 0000010000000 45 54 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.WWSDHRGTIIER.G Y 50.82 1554.7692 12 0.6 389.6998 4 33.34 6 F6:18624 NaNaKA16_F2.raw 3.5624E6 1 0000010000000 27 38 PEAKS DB
K.KWWSDHR.G Y 48.51 1013.4832 7 -0.3 507.7487 2 14.91 6 F6:3847 NaNaKA16_F2.raw 1.42E6 1 0000010000000 26 32 PEAKS DB
total 8 peptides
2MJ4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQPPTTK.T Y 90.54 1753.8053 15 -2.8 877.9075 2 11.84 6 F6:1921 NaNaKA16_F2.raw 3.9815E73.3625E82.7134E6 7 2000032000000 1 15 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02)R.T Y 73.50 1315.6489 11 4.7 658.8315 2 11.28 7 F7:1787 NaNaKA16_F3.raw 8.7631E62.55E86.5001E68.5404E4 10 2000052100000 45 55 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.PGVNLNC(+57.02)C(+57.02)R.T Y 61.71 1088.4856 9 -3.5 545.2482 2 11.84 6 F6:2180 NaNaKA16_F2.raw 6.794E44.9207E6 3 1000020000000 47 55 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02).C Y 60.37 999.5172 9 0.2 500.7659 2 12.45 6 F6:2465 NaNaKA16_F2.raw 1.6082E6 1 0000010000000 45 53 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)SGETNC(+57.02)YK.K Y 54.62 1218.4645 10 -2.4 610.2380 2 11.84 6 F6:1942 NaNaKA16_F2.raw 2.3803E65.9614E6 2 1000010000000 16 25 Carbamidomethylation C2:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
K.VKPGVNLNC(+57.02)C(+57.02).R Y 51.22 1159.5479 10 0.8 580.7817 2 12.51 6 F6:2512 NaNaKA16_F2.raw 9.6916E5 1 0000010000000 45 54 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
K.WWSDHRGTIIER.G Y 50.82 1554.7692 12 0.6 389.6998 4 33.34 6 F6:18624 NaNaKA16_F2.raw 3.5624E6 1 0000010000000 27 38 PEAKS DB
K.KWWSDHR.G Y 48.51 1013.4832 7 -0.3 507.7487 2 14.91 6 F6:3847 NaNaKA16_F2.raw 1.42E6 1 0000010000000 26 32 PEAKS DB
total 8 peptides
JAG67188.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.HGQGTGELLQVSGIK.V N 77.57 1522.8103 15 0.5 762.4128 2 32.78 5 F5:12050 NaNaKA16_F13.raw 4.2458E55.0296E6 3 0001200000000 457 471 PEAKS DB
R.FHEC(+57.02)NLGNLIC(+57.02)DAVVYNNLR.H N 72.86 2420.1365 20 0.2 807.7196 3 76.91 13 F13:50987 NaNaKA16_F9.raw 5.2029E62.2685E7 3 0000000000012 369 388 Carbamidomethylation C4:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
R.VPTYVPLEMEK.S N 72.07 1304.6686 11 1.1 653.3423 2 50.51 5 F5:20383 NaNaKA16_F13.raw 01.0366E66.7478E6 2 0001100000000 496 506 PEAKS DB
R.QVPVVQAYAFGK.Y N 68.51 1305.7081 12 -0.2 653.8612 2 81.22 5 F5:33335 NaNaKA16_F13.raw 4.7302E54.1666E6 3 0001200000000 288 299 PEAKS DB
E.LTILHTNDVHAR.V N 61.22 1388.7524 12 -0.8 463.9244 3 12.08 5 F5:1993 NaNaKA16_F13.raw 9.2667E5 1 0000100000000 44 55 PEAKS DB
K.ETPVLSNPGPYLEFR.D N 55.50 1717.8674 15 -0.2 859.9409 2 68.90 5 F5:28106 NaNaKA16_F13.raw 1.3217E6 1 0000100000000 194 208 PEAKS DB
R.EVVQFMNSLR.Y Y 51.27 1221.6176 10 -0.2 611.8159 2 54.42 5 F5:22037 NaNaKA16_F13.raw 1.1341E6 1 0000100000000 114 123 PEAKS DB
R.VPTYVPLEM(+15.99)EK.S N 47.95 1320.6635 11 0.2 661.3391 2 38.01 5 F5:14849 NaNaKA16_F13.raw 6.2061E5 1 0000100000000 496 506 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
K.VGIIGYTTK.E N 46.40 950.5436 9 0.7 476.2794 2 30.07 5 F5:10298 NaNaKA16_F13.raw 6.7595E6 1 0000100000000 185 193 PEAKS DB
N.ISGYILPYK.I N 45.32 1052.5906 9 0.8 527.3030 2 46.37 5 F5:18970 NaNaKA16_F13.raw 5.2097E6 1 0000100000000 168 176 PEAKS DB
total 10 peptides
APB88857.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.RLC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 79.97 3207.4463 26 -1.6 802.8676 4 81.23 13 F13:56229 NaNaKA16_F9.raw 6.2243E7 2 0000000000002 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
F.SETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 77.77 1952.8396 16 -1.2 977.4259 2 49.68 10 F10:32514 NaNaKA16_F6.raw 5.3752E73.3568E7 4 0000000002002 32 47 Carbamidomethylation C7:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
S.ETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 62.63 1865.8076 15 0.0 622.9432 3 50.23 10 F10:33009 NaNaKA16_F6.raw 1.5094E7 2 0000000002000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 61.37 2778.2305 23 0.8 927.0848 3 83.94 13 F13:56808 NaNaKA16_F9.raw 1.0126E7 1 0000000000001 25 47 Carbamidomethylation C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.LC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 54.85 3051.3452 25 0.3 1018.1226 3 92.48 13 F13:64193 NaNaKA16_F9.raw 1.7346E7 1 0000000000001 23 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
K.GITRLPWVIR.G N 53.94 1209.7346 10 0.7 404.2524 3 50.16 12 F12:31448 NaNaKA16_F8.raw 4.8367E64.8796E6 2 0000000000011 52 61 PEAKS DB
Y.SIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 53.11 2300.0242 19 1.0 767.6827 3 72.97 13 F13:47475 NaNaKA16_F9.raw 7.4795E69.9901E6 2 0000000000011 29 47 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
S.IFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 48.14 2212.9922 18 0.6 738.6718 3 65.16 12 F12:43580 NaNaKA16_F8.raw 6.4302E6 1 0000000000010 30 47 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
S.DYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 47.17 2578.1145 21 0.6 860.3793 3 86.30 12 F12:61577 NaNaKA16_F8.raw 2.9844E6 1 0000000000010 27 47 Carbamidomethylation C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
I.TRLPWVIR.G N 42.46 1039.6290 8 -0.3 520.8217 2 38.07 12 F12:21421 NaNaKA16_F8.raw 1.3591E7 1 0000000000010 54 61 PEAKS DB
total 10 peptides
CAB45156.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.RLC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 79.97 3207.4463 26 -1.6 802.8676 4 81.23 13 F13:56229 NaNaKA16_F9.raw 6.2243E7 2 0000000000002 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
F.SETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 77.77 1952.8396 16 -1.2 977.4259 2 49.68 10 F10:32514 NaNaKA16_F6.raw 5.3752E73.3568E7 4 0000000002002 32 47 Carbamidomethylation C7:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
S.ETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 62.63 1865.8076 15 0.0 622.9432 3 50.23 10 F10:33009 NaNaKA16_F6.raw 1.5094E7 2 0000000002000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 61.37 2778.2305 23 0.8 927.0848 3 83.94 13 F13:56808 NaNaKA16_F9.raw 1.0126E7 1 0000000000001 25 47 Carbamidomethylation C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.LC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 54.85 3051.3452 25 0.3 1018.1226 3 92.48 13 F13:64193 NaNaKA16_F9.raw 1.7346E7 1 0000000000001 23 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
K.GITRLPWVIR.G N 53.94 1209.7346 10 0.7 404.2524 3 50.16 12 F12:31448 NaNaKA16_F8.raw 4.8367E64.8796E6 2 0000000000011 52 61 PEAKS DB
Y.SIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 53.11 2300.0242 19 1.0 767.6827 3 72.97 13 F13:47475 NaNaKA16_F9.raw 7.4795E69.9901E6 2 0000000000011 29 47 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
S.IFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 48.14 2212.9922 18 0.6 738.6718 3 65.16 12 F12:43580 NaNaKA16_F8.raw 6.4302E6 1 0000000000010 30 47 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
S.DYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 47.17 2578.1145 21 0.6 860.3793 3 86.30 12 F12:61577 NaNaKA16_F8.raw 2.9844E6 1 0000000000010 27 47 Carbamidomethylation C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
I.TRLPWVIR.G N 42.46 1039.6290 8 -0.3 520.8217 2 38.07 12 F12:21421 NaNaKA16_F8.raw 1.3591E7 1 0000000000010 54 61 PEAKS DB
total 10 peptides
Q9W717.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.RLC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 79.97 3207.4463 26 -1.6 802.8676 4 81.23 13 F13:56229 NaNaKA16_F9.raw 6.2243E7 2 0000000000002 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
F.SETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 77.77 1952.8396 16 -1.2 977.4259 2 49.68 10 F10:32514 NaNaKA16_F6.raw 5.3752E73.3568E7 4 0000000002002 32 47 Carbamidomethylation C7:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
S.ETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 62.63 1865.8076 15 0.0 622.9432 3 50.23 10 F10:33009 NaNaKA16_F6.raw 1.5094E7 2 0000000002000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
C.LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 61.37 2778.2305 23 0.8 927.0848 3 83.94 13 F13:56808 NaNaKA16_F9.raw 1.0126E7 1 0000000000001 25 47 Carbamidomethylation C14:Carbamidomethylation:1000.00;C21:Carbamidomethylation:1000.00 PEAKS DB
R.LC(+57.02)LSDYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 54.85 3051.3452 25 0.3 1018.1226 3 92.48 13 F13:64193 NaNaKA16_F9.raw 1.7346E7 1 0000000000001 23 47 Carbamidomethylation C2:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00;C23:Carbamidomethylation:1000.00 PEAKS DB
K.GITRLPWVIR.G N 53.94 1209.7346 10 0.7 404.2524 3 50.16 12 F12:31448 NaNaKA16_F8.raw 4.8367E64.8796E6 2 0000000000011 52 61 PEAKS DB
Y.SIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 53.11 2300.0242 19 1.0 767.6827 3 72.97 13 F13:47475 NaNaKA16_F9.raw 7.4795E69.9901E6 2 0000000000011 29 47 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
S.IFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 48.14 2212.9922 18 0.6 738.6718 3 65.16 12 F12:43580 NaNaKA16_F8.raw 6.4302E6 1 0000000000010 30 47 Carbamidomethylation C9:Carbamidomethylation:1000.00;C16:Carbamidomethylation:1000.00 PEAKS DB
S.DYSIFSETIEIC(+57.02)PDGHNFC(+57.02)FK.K Y 47.17 2578.1145 21 0.6 860.3793 3 86.30 12 F12:61577 NaNaKA16_F8.raw 2.9844E6 1 0000000000010 27 47 Carbamidomethylation C12:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
I.TRLPWVIR.G N 42.46 1039.6290 8 -0.3 520.8217 2 38.07 12 F12:21421 NaNaKA16_F8.raw 1.3591E7 1 0000000000010 54 61 PEAKS DB
total 10 peptides
AAB25732.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MFMMSDLTIPVKR.G N 78.37 1567.7925 13 0.7 784.9041 2 64.37 13 F13:40261 NaNaKA16_F9.raw 4.2403E91.3439E71.7372E63.8642E65.9217E51.0397E73.2403E73.9215E7 33 0942300001464 24 36 PEAKS DB
K.MFM(+15.99)MSDLTIPVKR.G N 73.58 1583.7874 13 -3.6 528.9345 3 64.32 2 F2:41277 NaNaKA16_F10.raw 6.4476E81.4987E63.4668E51.3565E51.7098E64.1492E77.8309E6 19 0411100000165 24 36 Oxidation (M) M3:Oxidation (M):54.01 PEAKS DB
K.MFMM(+15.99)SDLTIPVKR.G N 73.15 1583.7874 13 -0.7 528.9360 3 50.11 2 F2:28972 NaNaKA16_F10.raw 2.9709E84.1034E66.2939E60 11 0600000000230 24 36 Oxidation (M) M4:Oxidation (M):33.98 PEAKS DB
K.M(+15.99)FMMSDLTIPVKR.G N 72.36 1583.7874 13 0.2 528.9365 3 56.84 2 F2:34425 NaNaKA16_F10.raw 2.8654E81.319E62.7338E64.1047E6 7 0210000000022 24 36 Oxidation (M) M1:Oxidation (M):39.76 PEAKS DB
K.MFMMSDLTIPVK.R N 71.68 1411.6914 12 0.8 706.8535 2 79.29 3 F3:53820 NaNaKA16_F11.raw 1.5688E91.881E72.977E61.2231E69.2248E51.3238E73.1707E71.643E7 16 0222100001431 24 35 PEAKS DB
K.MFMM(+15.99)SDLTIPVK.R N 68.52 1427.6863 12 0.4 714.8507 2 65.23 2 F2:42286 NaNaKA16_F10.raw 6.9158E75.2718E6 3 0200000000010 24 35 Oxidation (M) M4:Oxidation (M):40.00 PEAKS DB
K.M(+15.99)FMMSDLTIPVK.R N 67.62 1427.6863 12 1.3 714.8513 2 72.40 2 F2:48081 NaNaKA16_F10.raw 2.2728E82.5292E61.6964E6 4 0200000000011 24 35 Oxidation (M) M1:Oxidation (M):45.01 PEAKS DB
K.M(+15.99)FM(+15.99)MSDLTIPVKR.G N 67.36 1599.7822 13 -0.1 534.2679 3 52.56 2 F2:30572 NaNaKA16_F10.raw 1.3826E7 4 0400000000000 24 36 Oxidation (M) M1:Oxidation (M):77.24;M3:Oxidation (M):33.98 PEAKS DB
K.MFM(+15.99)MSDLTIPVK.R N 66.69 1427.6863 12 -1.0 714.8497 2 80.39 2 F2:54977 NaNaKA16_F10.raw 2.2728E82.7181E61.0282E61.1732E61.7882E72.4723E6 10 0210100000222 24 35 Oxidation (M) M3:Oxidation (M):40.00 PEAKS DB
F.MMSDLTIPVK.R N 61.69 1133.5824 10 -0.7 567.7981 2 48.83 2 F2:28577 NaNaKA16_F10.raw 1.0581E7 1 0100000000000 26 35 PEAKS DB
K.SNLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N Y 59.74 2014.9023 16 -0.1 1008.4584 2 33.22 2 F2:15712 NaNaKA16_F10.raw 6.926E6 1 0100000000000 45 60 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.MFM(+15.99)M(+15.99)SDLTIPVKR.G N 53.05 1599.7822 13 0.1 534.2681 3 41.44 2 F2:22207 NaNaKA16_F10.raw 2.4835E7 6 0600000000000 24 36 Oxidation (M) M3:Oxidation (M):32.28;M4:Oxidation (M):47.09 PEAKS DB
K.M(+15.99)FMM(+15.99)SDLTIPVK.R N 52.06 1443.6812 12 -0.4 722.8475 2 79.59 2 F2:55048 NaNaKA16_F10.raw 3.8316E6 1 0100000000000 24 35 Oxidation (M) M1:Oxidation (M):38.40;M4:Oxidation (M):33.98 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 51 58 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
K.M(+15.99)FM(+15.99)M(+15.99)SDLTIPVKR.G N 49.67 1615.7772 13 -0.6 539.5994 3 64.71 2 F2:41281 NaNaKA16_F10.raw 3.6921E5 1 0100000000000 24 36 Oxidation (M) M1:Oxidation (M):1000.00;M3:Oxidation (M):1000.00;M4:Oxidation (M):1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSNLLVK.Y Y 48.08 1601.8269 14 0.9 534.9501 3 32.72 12 F12:16982 NaNaKA16_F8.raw 1.1895E71.0889E8 2 0000000001010 37 50 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.M(+15.99)FM(+15.99)MSDLTIPVK.R N 46.34 1443.6812 12 -0.7 722.8474 2 80.40 2 F2:55048 NaNaKA16_F10.raw 9.9748E6 3 0300000000000 24 35 Oxidation (M) M1:Oxidation (M):56.34;M3:Oxidation (M):40.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 37 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.TC(+57.02)PAGKNLC(+57.02)YK.M N 44.80 1310.6111 11 0.6 437.8779 3 11.38 12 F12:1793 NaNaKA16_F8.raw 2.5665E5 1 0000000000010 13 23 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.SNLLVKYVC(+57.02)C(+57.02)NTDR.C Y 44.53 1740.8287 14 0.3 871.4219 2 32.22 13 F13:14152 NaNaKA16_F9.raw 6.0589E6 1 0000000000001 45 58 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 20 peptides
XP_026575983.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SNVGIGIPESIDWR.D Y 78.34 1541.7838 14 0.1 771.8993 2 70.19 4 F4:46856 NaNaKA16_F12.raw 1.2185E52.1799E7 2 0011000000000 115 128 PEAKS DB
K.ENGMDYWLVK.N N 68.67 1253.5751 10 0.4 627.7950 2 61.07 4 F4:39425 NaNaKA16_F12.raw 4.1193E6 1 0001000000000 294 303 PEAKS DB
N.VGIGIPESIDWR.D Y 60.83 1340.7089 12 -0.3 671.3615 2 71.29 4 F4:47876 NaNaKA16_F12.raw 1.4762E7 1 0001000000000 117 128 PEAKS DB
K.NVQFIALHNLE.Y Y 57.39 1296.6826 11 0.5 649.3489 2 60.01 12 F12:39273 NaNaKA16_F8.raw 1.7428E63.131E6 2 0000000000110 60 70 PEAKS DB
V.GIGIPESIDWR.D Y 55.43 1241.6404 11 0.5 621.8278 2 65.64 4 F4:43184 NaNaKA16_F12.raw 2.0063E6 1 0001000000000 118 128 PEAKS DB
F.SAVGALEAQLK.L Y 53.15 1085.6080 11 0.8 543.8117 2 40.64 4 F4:22485 NaNaKA16_F12.raw 5.635E6 1 0001000000000 149 159 PEAKS DB
K.GINSEASYPYK.A Y 44.03 1227.5771 11 0.3 614.7960 2 19.35 5 F5:4472 NaNaKA16_F13.raw 1.333E5 1 0000100000000 202 212 PEAKS DB
K.NVQFIALHNLEYSLGLH.S Y 43.16 1967.0265 17 1.1 656.6835 3 83.79 2 F2:57904 NaNaKA16_F10.raw 6.3277E5 1 0100000000000 60 76 PEAKS DB
total 8 peptides
XP_026575982.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SNVGIGIPESIDWR.D Y 78.34 1541.7838 14 0.1 771.8993 2 70.19 4 F4:46856 NaNaKA16_F12.raw 1.2185E52.1799E7 2 0011000000000 115 128 PEAKS DB
K.ENGMDYWLVK.N N 68.67 1253.5751 10 0.4 627.7950 2 61.07 4 F4:39425 NaNaKA16_F12.raw 4.1193E6 1 0001000000000 294 303 PEAKS DB
N.VGIGIPESIDWR.D Y 60.83 1340.7089 12 -0.3 671.3615 2 71.29 4 F4:47876 NaNaKA16_F12.raw 1.4762E7 1 0001000000000 117 128 PEAKS DB
K.NVQFIALHNLE.Y Y 57.39 1296.6826 11 0.5 649.3489 2 60.01 12 F12:39273 NaNaKA16_F8.raw 1.7428E63.131E6 2 0000000000110 60 70 PEAKS DB
V.GIGIPESIDWR.D Y 55.43 1241.6404 11 0.5 621.8278 2 65.64 4 F4:43184 NaNaKA16_F12.raw 2.0063E6 1 0001000000000 118 128 PEAKS DB
F.SAVGALEAQLK.L Y 53.15 1085.6080 11 0.8 543.8117 2 40.64 4 F4:22485 NaNaKA16_F12.raw 5.635E6 1 0001000000000 149 159 PEAKS DB
K.GINSEASYPYK.A Y 44.03 1227.5771 11 0.3 614.7960 2 19.35 5 F5:4472 NaNaKA16_F13.raw 1.333E5 1 0000100000000 202 212 PEAKS DB
K.NVQFIALHNLEYSLGLH.S Y 43.16 1967.0265 17 1.1 656.6835 3 83.79 2 F2:57904 NaNaKA16_F10.raw 6.3277E5 1 0100000000000 60 76 PEAKS DB
total 8 peptides
4GFY
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1SV9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
3G8F
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1TK4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2QVD
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
4EIX
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
3H1X
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2B17
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2ARM
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1TG4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1SQZ
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
3FG5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1ZWP
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2QU9
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1Y38
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
4GLD
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
4FGA
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1ZR8
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1TP2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1Q7A
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
1TH6
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
4HMB
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
3CBI
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
P59071.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2QUE
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
3FO7
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 106 116 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
AAZ53186.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 32 49 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 122 132 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 59 76 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 123 132 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 123 132 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 122 132 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
AAZ53179.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAIPSYSSYGC(+57.02)YC(+57.02)GWGGK.G Y 88.95 2024.8760 18 1.0 1013.4462 2 65.94 4 F4:43325 NaNaKA16_F12.raw 5.4816E7 2 0002000000000 32 49 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.KYMLYPDFLC(+57.02)K.G Y 78.94 1476.7145 11 0.6 739.3649 2 58.50 4 F4:37246 NaNaKA16_F12.raw 3.9698E7 2 0002000000000 122 132 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 59 76 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 123 132 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
K.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 123 132 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.KYM(+15.99)LYPDFLC(+57.02)K.G Y 62.57 1492.7095 11 0.2 498.5772 3 52.20 4 F4:32001 NaNaKA16_F12.raw 4.3437E6 1 0001000000000 122 132 Oxidation (M); Carbamidomethylation M3:Oxidation (M):1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
5GZ4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 65 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 65 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NPFYNPSPAK.E Y 62.89 1133.5505 10 0.5 567.7828 2 24.80 5 F5:7428 NaNaKA16_F13.raw 1.5571E6 1 0000100000000 501 510 PEAKS DB
K.FGPVSGQVIK.S Y 62.30 1030.5811 10 -0.3 516.2977 2 31.02 5 F5:10994 NaNaKA16_F13.raw 1.4827E6 1 0000100000000 288 297 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 433 446 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.K N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 370 381 PEAKS DB
total 6 peptides
A0A2D0TC04.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 65 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 65 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NPFYNPSPAK.E Y 62.89 1133.5505 10 0.5 567.7828 2 24.80 5 F5:7428 NaNaKA16_F13.raw 1.5571E6 1 0000100000000 501 510 PEAKS DB
K.FGPVSGQVIK.S Y 62.30 1030.5811 10 -0.3 516.2977 2 31.02 5 F5:10994 NaNaKA16_F13.raw 1.4827E6 1 0000100000000 288 297 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 433 446 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.K N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 370 381 PEAKS DB
total 6 peptides
5GZ5
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 65 79 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 65 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.NPFYNPSPAK.E Y 62.89 1133.5505 10 0.5 567.7828 2 24.80 5 F5:7428 NaNaKA16_F13.raw 1.5571E6 1 0000100000000 501 510 PEAKS DB
K.FGPVSGQVIK.S Y 62.30 1030.5811 10 -0.3 516.2977 2 31.02 5 F5:10994 NaNaKA16_F13.raw 1.4827E6 1 0000100000000 288 297 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 433 446 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.K N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 370 381 PEAKS DB
total 6 peptides
XP_026541908.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LVILGFPC(+57.02)NQFGK.Q N 75.66 1491.7908 13 0.9 746.9033 2 75.14 4 F4:50923 NaNaKA16_F12.raw 1.9324E78.891E61.0383E71.972E72.0275E61.0176E74.4683E6 7 0111100000111 124 136 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.QEPGQNSEILQGIK.Y N 72.65 1539.7893 14 1.0 770.9027 2 36.16 5 F5:14005 NaNaKA16_F13.raw 3.6181E62.8478E7 3 0001200000000 137 150 PEAKS DB
R.PGGGYVPNFQLFQK.G Y 67.77 1550.7881 14 0.4 776.4016 2 67.84 10 F10:47726 NaNaKA16_F6.raw 1.2069E63.3174E61.1691E73.9836E6 4 0001100011000 154 167 PEAKS DB
L.VILGFPC(+57.02)NQFGK.Q N 63.26 1378.7067 12 0.9 690.3612 2 60.52 12 F12:39695 NaNaKA16_F8.raw 3.3914E62.4189E62.1917E63.4327E64.8393E6 5 0100000001111 125 136 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.FLVNPQGKPVMR.W N 57.92 1384.7649 12 1.1 462.5961 3 26.92 5 F5:8608 NaNaKA16_F13.raw 1.9299E6 1 0000100000000 216 227 PEAKS DB
C.SYAPNSQPIPDR.G N 52.88 1343.6470 12 0.3 672.8310 2 19.74 5 F5:4861 NaNaKA16_F13.raw 1.9768E68.8175E5 2 0000110000000 47 58 PEAKS DB
K.NSC(+57.02)PPVVETFG.D N 51.85 1205.5387 11 0.2 603.7767 2 53.03 6 F6:34639 NaNaKA16_F2.raw 5.7957E71.0144E73.2539E6 3 0000011001000 184 194 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
R.LFWSPLK.I N 50.13 889.5062 7 -0.4 445.7602 2 61.25 2 F2:38338 NaNaKA16_F10.raw 1.0564E72.3049E74.474E69.3271E68.0536E64.602E6 6 0111100001100 199 205 PEAKS DB
total 8 peptides
P20229.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
RPGFC(+57.02)ELPAAK.G Y 72.25 1244.6335 11 0.2 415.8852 3 25.83 6 F6:12043 NaNaKA16_F2.raw 1.8481E106.6671E61.2942E57.7812E4 18 00000133110000 1 11 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.PGFC(+57.02)ELPAAK.G Y 69.38 1088.5325 10 -0.4 545.2733 2 30.14 6 F6:15808 NaNaKA16_F2.raw 5.4631E7 1 0000010000000 2 11 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.AHKPAFYYNK.D Y 67.89 1237.6244 10 -3.0 413.5475 3 11.83 6 F6:1936 NaNaKA16_F2.raw 7.8577E6 1 0000010000000 16 25 PEAKS DB
P.GFC(+57.02)ELPAAK.G Y 63.36 991.4797 9 0.5 496.7473 2 17.61 6 F6:5902 NaNaKA16_F2.raw 4.9737E51.1731E9 3 1000020000000 3 11 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.FC(+57.02)ELPAAK.G Y 56.52 934.4582 8 0.0 468.2364 2 18.99 6 F6:7115 NaNaKA16_F2.raw 7.1119E7 4 0000040000000 4 11 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
RPGFC(+57.02)ELPAAKGLC(+57.02)K.A Y 51.83 1702.8646 15 0.1 426.7235 4 25.88 6 F6:12144 NaNaKA16_F2.raw 2.0513E6 2 0000020000000 1 15 Carbamidomethylation C5:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
RPGFC(+57.02)ELPAAKG.L Y 49.32 1301.6550 12 -0.7 651.8344 2 18.25 6 F6:5806 NaNaKA16_F2.raw 1.9208E8 2 0000020000000 1 12 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.AHKPAFYY.N Y 47.54 995.4865 8 0.8 498.7509 2 12.31 6 F6:2289 NaNaKA16_F2.raw 1.4654E7 1 0000010000000 16 23 PEAKS DB
F.C(+57.02)ELPAAK.G Y 42.14 787.3898 7 -0.3 394.7021 2 17.61 6 F6:5910 NaNaKA16_F2.raw 4.1672E7 1 0000010000000 5 11 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 9 peptides
XP_034258146.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LVILGFPC(+57.02)NQFGK.Q N 75.66 1491.7908 13 0.9 746.9033 2 75.14 4 F4:50923 NaNaKA16_F12.raw 1.9324E78.891E61.0383E71.972E72.0275E61.0176E74.4683E6 7 0111100000111 124 136 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.QEPGQNSEILQGIK.Y N 72.65 1539.7893 14 1.0 770.9027 2 36.16 5 F5:14005 NaNaKA16_F13.raw 3.6181E62.8478E7 3 0001200000000 137 150 PEAKS DB
L.VILGFPC(+57.02)NQFGK.Q N 63.26 1378.7067 12 0.9 690.3612 2 60.52 12 F12:39695 NaNaKA16_F8.raw 3.3914E62.4189E62.1917E63.4327E64.8393E6 5 0100000001111 125 136 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.NSC(+57.02)PPVVETFG.D N 51.85 1205.5387 11 0.2 603.7767 2 53.03 6 F6:34639 NaNaKA16_F2.raw 5.7957E71.0144E73.2539E6 3 0000011001000 184 194 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
S.ITGDYIAFR.N Y 43.42 1054.5447 9 4.7 528.2793 2 43.17 8 F8:23978 NaNaKA16_F4.raw 1.2476E5 1 0000000100000 79 87 PEAKS DB
H.DYGALSITGDYIAFR.N Y 43.37 1660.8096 15 1.4 831.4132 2 87.62 5 F5:35334 NaNaKA16_F13.raw 6.8309E5 1 0000100000000 73 87 PEAKS DB
total 6 peptides
1UG4
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 45 60 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 45 58 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 37 50 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 51 58 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 37 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
ADN67586.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 47 62 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 47 60 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 39 52 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 5 14 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 53 60 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 39 46 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
2207174C
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
CAB42058.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
AAB86638.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
CAA07687.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
P80245.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
CAA90966.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
CAA69977.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N.N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
Q98965.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SSLLVKYVC(+57.02)C(+57.02)NTDRC(+57.02)N.N N 73.90 1987.8914 16 0.9 663.6383 3 34.50 3 F3:16042 NaNaKA16_F11.raw 4.3691E64.3984E7 3 0120000000000 66 81 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
K.SSLLVKYVC(+57.02)C(+57.02)NTDR.C N 70.96 1713.8179 14 0.6 857.9167 2 34.00 3 F3:15457 NaNaKA16_F11.raw 5.0554E61.1527E81.6508E603.3481E6 7 0221000000002 66 79 Carbamidomethylation C9:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PKSSLLVK.Y N 65.71 1574.8160 14 0.6 788.4158 2 32.88 3 F3:14936 NaNaKA16_F11.raw 2.0322E7 2 0020000000000 58 71 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)NQLIPPFYK.T Y 52.30 1278.6431 10 1.2 640.3296 2 54.59 3 F3:31482 NaNaKA16_F11.raw 2.358E6 1 0010000000000 24 33 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.YVC(+57.02)C(+57.02)NTDR.C N 50.92 1086.4222 8 -0.2 544.2183 2 11.37 12 F12:1787 NaNaKA16_F8.raw 2.1124E62.9778E61.3296E61.5915E61.7945E6 5 0111000001010 72 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C4:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)IDVC(+57.02)PK.S N 46.03 947.4205 8 -0.5 474.7173 2 11.54 12 F12:1895 NaNaKA16_F8.raw 1.5891E76.084E52.0697E66.3919E71.8242E66.8843E6 6 0010001011110 58 65 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 6 peptides
CAA55333.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DSVLAQYIFELSR.R Y 69.25 1539.7932 13 0.9 770.9045 2 100.63 4 F4:70292 NaNaKA16_F12.raw 1.0257E6 1 0001000000000 160 172 PEAKS DB
K.ESFLFTLTR.N N 61.74 1112.5865 9 0.9 557.3010 2 70.76 4 F4:47352 NaNaKA16_F12.raw 9.6337E51.0016E7 2 0101000000000 356 364 PEAKS DB
R.AALSQYVC(+57.02)EHK.D N 61.07 1304.6183 11 0.1 653.3165 2 12.43 5 F5:2258 NaNaKA16_F13.raw 1.4233E6 2 0000200000000 286 296 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.ILETC(+57.02)C(+57.02)AEADKDAC(+57.02)IHEK.A Y 55.71 2161.9441 18 0.9 721.6559 3 16.34 5 F5:3387 NaNaKA16_F13.raw 8.0793E5 1 0000100000000 192 209 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
K.LSAEIIELHK.K Y 51.62 1151.6550 10 0.1 576.8348 2 34.25 5 F5:12846 NaNaKA16_F13.raw 1.2882E6 2 0000200000000 69 78 PEAKS DB
R.RYPTALSVVILESTK.T Y 50.77 1675.9508 15 0.7 559.6580 3 59.32 4 F4:37972 NaNaKA16_F12.raw 1.8323E6 1 0001000000000 173 187 PEAKS DB
R.YPTALSVVILESTK.T Y 46.54 1519.8497 14 1.3 760.9331 2 75.67 4 F4:51451 NaNaKA16_F12.raw 5.6387E5 1 0001000000000 174 187 PEAKS DB
R.SPDLPPPSEEILK.E Y 43.64 1420.7449 13 1.0 711.3804 2 49.60 5 F5:19999 NaNaKA16_F13.raw 2.2776E6 1 0000100000000 327 339 PEAKS DB
total 8 peptides
S59517
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DSVLAQYIFELSR.R Y 69.25 1539.7932 13 0.9 770.9045 2 100.63 4 F4:70292 NaNaKA16_F12.raw 1.0257E6 1 0001000000000 160 172 PEAKS DB
K.ESFLFTLTR.N N 61.74 1112.5865 9 0.9 557.3010 2 70.76 4 F4:47352 NaNaKA16_F12.raw 9.6337E51.0016E7 2 0101000000000 356 364 PEAKS DB
R.AALSQYVC(+57.02)EHK.D N 61.07 1304.6183 11 0.1 653.3165 2 12.43 5 F5:2258 NaNaKA16_F13.raw 1.4233E6 2 0000200000000 286 296 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.ILETC(+57.02)C(+57.02)AEADKDAC(+57.02)IHEK.A Y 55.71 2161.9441 18 0.9 721.6559 3 16.34 5 F5:3387 NaNaKA16_F13.raw 8.0793E5 1 0000100000000 192 209 Carbamidomethylation C5:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C14:Carbamidomethylation:1000.00 PEAKS DB
K.LSAEIIELHK.K Y 51.62 1151.6550 10 0.1 576.8348 2 34.25 5 F5:12846 NaNaKA16_F13.raw 1.2882E6 2 0000200000000 69 78 PEAKS DB
R.RYPTALSVVILESTK.T Y 50.77 1675.9508 15 0.7 559.6580 3 59.32 4 F4:37972 NaNaKA16_F12.raw 1.8323E6 1 0001000000000 173 187 PEAKS DB
R.YPTALSVVILESTK.T Y 46.54 1519.8497 14 1.3 760.9331 2 75.67 4 F4:51451 NaNaKA16_F12.raw 5.6387E5 1 0001000000000 174 187 PEAKS DB
R.SPDLPPPSEEILK.E Y 43.64 1420.7449 13 1.0 711.3804 2 49.60 5 F5:19999 NaNaKA16_F13.raw 2.2776E6 1 0000100000000 327 339 PEAKS DB
total 8 peptides
JAS05092.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DPDYGMVEPGTK.C N 79.87 1307.5703 12 0.4 654.7927 2 33.63 5 F5:12378 NaNaKA16_F13.raw 3.4025E6 2 0000200000000 583 594 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.AAKDDC(+57.02)DLPEFC(+57.02)TGR.S Y 58.01 1753.7400 15 -0.2 877.8771 2 29.51 10 F10:15073 NaNaKA16_F6.raw 2.1613E7 1 0000000001000 468 482 Carbamidomethylation C6:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGMVC(+57.02)SNR.Q N 51.31 1154.4268 10 1.1 578.2213 2 11.85 5 F5:1806 NaNaKA16_F13.raw 4.5755E5 1 0000100000000 595 604 Carbamidomethylation C1:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
K.LQHEAQC(+57.02)DSEEC(+57.02)C(+57.02)EK.C N 46.38 1921.7240 15 0.0 641.5820 3 11.83 5 F5:1808 NaNaKA16_F13.raw 2.9375E5 1 0000100000000 443 457 Carbamidomethylation C7:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
R.DRPQC(+57.02)ILNKPLST.D N 46.29 1540.8031 13 -0.4 514.6081 3 27.16 4 F4:11109 NaNaKA16_F12.raw 7.0589E58.268E5 2 0001000100000 392 404 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)GDGM(+15.99)VC(+57.02)SNR.Q N 45.27 1170.4216 10 0.3 586.2183 2 11.84 5 F5:1815 NaNaKA16_F13.raw 9.9702E4 1 0000100000000 595 604 Carbamidomethylation; Oxidation (M) C1:Carbamidomethylation:1000.00;M5:Oxidation (M):1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 7 peptides
P49122.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)HNTQLPFIYNTC(+57.02)PEGK.N Y 86.07 2077.9351 17 1.0 693.6530 3 41.97 3 F3:22380 NaNaKA16_F11.raw 3.8675E64.1549E7 4 0130000000000 24 40 Carbamidomethylation C1:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.FPLKFPVK.R N 54.70 974.5953 8 0.0 488.3049 2 39.56 13 F13:19983 NaNaKA16_F9.raw 1.6603E74.0114E61.1085E75.1109E65.3917E62.3367E89.727E8 7 0111000001111 50 57 PEAKS DB
K.NLC(+57.02)FKATLK.F N 53.76 1093.5953 9 0.6 547.8053 2 11.47 13 F13:1926 NaNaKA16_F9.raw 1.6934E5 1 0000000000001 41 49 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
L.KFPLKFPVK.R N 53.60 1102.6902 9 0.2 552.3525 2 23.75 13 F13:7063 NaNaKA16_F9.raw 6.4443E6 1 0000000000001 49 57 PEAKS DB
total 4 peptides
CAA77017.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)HNTQLPFIYNTC(+57.02)PEGK.N Y 86.07 2077.9351 17 1.0 693.6530 3 41.97 3 F3:22380 NaNaKA16_F11.raw 3.8675E64.1549E7 4 0130000000000 24 40 Carbamidomethylation C1:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.FPLKFPVK.R N 54.70 974.5953 8 0.0 488.3049 2 39.56 13 F13:19983 NaNaKA16_F9.raw 1.6603E74.0114E61.1085E75.1109E65.3917E62.3367E89.727E8 7 0111000001111 50 57 PEAKS DB
K.NLC(+57.02)FKATLK.F N 53.76 1093.5953 9 0.6 547.8053 2 11.47 13 F13:1926 NaNaKA16_F9.raw 1.6934E5 1 0000000000001 41 49 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
L.KFPLKFPVK.R N 53.60 1102.6902 9 0.2 552.3525 2 23.75 13 F13:7063 NaNaKA16_F9.raw 6.4443E6 1 0000000000001 49 57 PEAKS DB
total 4 peptides
CAA90967.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)HNTQLPFIYNTC(+57.02)PEGK.N Y 86.07 2077.9351 17 1.0 693.6530 3 41.97 3 F3:22380 NaNaKA16_F11.raw 3.8675E64.1549E7 4 0130000000000 24 40 Carbamidomethylation C1:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
K.FPLKFPVK.R N 54.70 974.5953 8 0.0 488.3049 2 39.56 13 F13:19983 NaNaKA16_F9.raw 1.6603E74.0114E61.1085E75.1109E65.3917E62.3367E89.727E8 7 0111000001111 50 57 PEAKS DB
K.NLC(+57.02)FKATLK.F N 53.76 1093.5953 9 0.6 547.8053 2 11.47 13 F13:1926 NaNaKA16_F9.raw 1.6934E5 1 0000000000001 41 49 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
L.KFPLKFPVK.R N 53.60 1102.6902 9 0.2 552.3525 2 23.75 13 F13:7063 NaNaKA16_F9.raw 6.4443E6 1 0000000000001 49 57 PEAKS DB
total 4 peptides
XP_026581281.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.AVTIFGESAGAASVGMHLLSTQSR.G Y 64.96 2389.2061 24 0.8 797.4099 3 74.57 3 F3:48871 NaNaKA16_F11.raw 1.5157E62.4175E62.4449E6 3 0111000000000 224 247 PEAKS DB
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
Y.SGAASLDVYDGR.F N 59.74 1209.5625 12 0.9 605.7891 2 28.23 5 F5:9342 NaNaKA16_F13.raw 7.7144E5 1 0000100000000 153 164 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 449 457 PEAKS DB
G.ESAGAASVGMHLLSTQSR.G N 53.24 1800.8788 18 0.5 601.3005 3 37.20 2 F2:18899 NaNaKA16_F10.raw 5.5667E61.2248E6 2 0100000000001 230 247 PEAKS DB
F.LGVPFAEPPVGR.M Y 45.46 1237.6819 12 0.1 619.8483 2 56.17 5 F5:22990 NaNaKA16_F13.raw 2.3712E6 1 0000100000000 62 73 PEAKS DB
total 6 peptides
XP_026561288.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 88 102 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 88 103 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 456 469 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.N N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 393 404 PEAKS DB
E.AC(+57.02)C(+57.02)WDYQDTC(+57.02)VLPTQSWSC(+57.02)NK.L Y 45.73 2678.0659 21 6.3 893.6968 3 66.86 8 F8:43778 NaNaKA16_F4.raw 6.225E6 1 0000000100000 60 80 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026561287.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 88 102 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 88 103 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 456 469 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.N N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 393 404 PEAKS DB
E.AC(+57.02)C(+57.02)WDYQDTC(+57.02)VLPTQSWSC(+57.02)NK.L Y 45.73 2678.0659 21 6.3 893.6968 3 66.86 8 F8:43778 NaNaKA16_F4.raw 6.225E6 1 0000000100000 60 80 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026561289.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 88 102 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 88 103 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 456 469 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.N N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 393 404 PEAKS DB
E.AC(+57.02)C(+57.02)WDYQDTC(+57.02)VLPTQSWSC(+57.02)NK.L Y 45.73 2678.0659 21 6.3 893.6968 3 66.86 8 F8:43778 NaNaKA16_F4.raw 6.225E6 1 0000000100000 60 80 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026561284.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 124 138 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 124 139 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 492 505 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.N N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 429 440 PEAKS DB
E.AC(+57.02)C(+57.02)WDYQDTC(+57.02)VLPTQSWSC(+57.02)NK.L Y 45.73 2678.0659 21 6.3 893.6968 3 66.86 8 F8:43778 NaNaKA16_F4.raw 6.225E6 1 0000000100000 96 116 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026561286.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTK.K N 76.27 1786.7358 15 5.5 894.3754 2 37.96 8 F8:19800 NaNaKA16_F4.raw 2.2299E61.4838E74.3252E6 3 0000001110000 124 138 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.MANVLC(+57.02)SC(+57.02)SEDC(+57.02)LTKK.D N 64.42 1914.8308 16 5.8 639.2845 3 25.10 8 F8:9795 NaNaKA16_F4.raw 4.6506E6 1 0000000100000 124 139 Carbamidomethylation C6:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
K.YC(+57.02)SGGTHGYDNEFK.S N 55.74 1633.6467 14 0.9 545.5567 3 11.99 5 F5:1916 NaNaKA16_F13.raw 4.2751E5 1 0000100000000 492 505 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.DFYTFDSEAIVK.N N 52.96 1433.6714 12 0.4 717.8433 2 71.19 5 F5:28900 NaNaKA16_F13.raw 5.5404E5 1 0000100000000 429 440 PEAKS DB
E.AC(+57.02)C(+57.02)WDYQDTC(+57.02)VLPTQSWSC(+57.02)NK.L Y 45.73 2678.0659 21 6.3 893.6968 3 66.86 8 F8:43778 NaNaKA16_F4.raw 6.225E6 1 0000000100000 96 116 Carbamidomethylation C2:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C19:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
AJB84504.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.FPC(+57.02)AQILEPGVYTK.V N 90.02 1621.8174 14 0.7 811.9165 2 63.25 4 F4:41641 NaNaKA16_F12.raw 4.8534E66.8218E81.5279E6 10 0018100000000 223 236 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
G.GFPC(+57.02)AQILEPGVYTK.V Y 73.73 1678.8389 15 -0.2 840.4265 2 67.68 4 F4:44810 NaNaKA16_F12.raw 8.0725E6 1 0001000000000 222 236 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
P.C(+57.02)AQILEPGVYTK.V N 56.21 1377.6962 12 0.9 689.8560 2 38.93 4 F4:20939 NaNaKA16_F12.raw 2.6297E6 1 0001000000000 225 236 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
C.AQILEPGVYTK.V N 44.01 1217.6655 11 0.3 609.8402 2 35.96 4 F4:18428 NaNaKA16_F12.raw 4.2348E6 1 0001000000000 226 236 PEAKS DB
total 4 peptides
4QWW
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 518 530 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.LLNATVDPPR.A Y 60.70 1094.6084 10 0.6 548.3118 2 27.22 5 F5:8897 NaNaKA16_F13.raw 4.4219E6 1 0000100000000 531 540 PEAKS DB
Y.SGAASLDVYDGR.F N 59.74 1209.5625 12 0.9 605.7891 2 28.23 5 F5:9342 NaNaKA16_F13.raw 7.7144E5 1 0000100000000 122 133 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 418 426 PEAKS DB
G.ESAGAASVGMHLLSTQSR.T N 53.24 1800.8788 18 0.5 601.3005 3 37.20 2 F2:18899 NaNaKA16_F10.raw 5.5667E61.2248E6 2 0100000000001 199 216 PEAKS DB
K.LLNATVDPPRA.D Y 51.91 1165.6455 11 -0.1 583.8300 2 32.03 5 F5:11512 NaNaKA16_F13.raw 7.4587E6 1 0000100000000 531 541 PEAKS DB
total 6 peptides
AAC59905.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 549 561 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.LLNATVDPPR.A Y 60.70 1094.6084 10 0.6 548.3118 2 27.22 5 F5:8897 NaNaKA16_F13.raw 4.4219E6 1 0000100000000 562 571 PEAKS DB
Y.SGAASLDVYDGR.F N 59.74 1209.5625 12 0.9 605.7891 2 28.23 5 F5:9342 NaNaKA16_F13.raw 7.7144E5 1 0000100000000 153 164 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 449 457 PEAKS DB
G.ESAGAASVGMHLLSTQSR.T N 53.24 1800.8788 18 0.5 601.3005 3 37.20 2 F2:18899 NaNaKA16_F10.raw 5.5667E61.2248E6 2 0100000000001 230 247 PEAKS DB
K.LLNATVDPPRA.D Y 51.91 1165.6455 11 -0.1 583.8300 2 32.03 5 F5:11512 NaNaKA16_F13.raw 7.4587E6 1 0000100000000 562 572 PEAKS DB
total 6 peptides
P00600.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
K.ISGC(+57.02)WPYIK.T Y 67.75 1122.5532 9 2.8 562.2855 2 51.79 13 F13:29736 NaNaKA16_F9.raw 3.7449E87.0956E75.0959E72.0327E63.4961E51.7447E81.5647E103.8482E93.7982E91.0131E11 42 02211001255518 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
E.AEKISGC(+57.02)WPYIK.T Y 59.04 1450.7278 12 0.5 726.3715 2 40.43 13 F13:20797 NaNaKA16_F9.raw 7.6834E6 2 0000000000002 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
total 5 peptides
P00601.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 31 42 PEAKS DB
K.ISGC(+57.02)WPYIK.T Y 67.75 1122.5532 9 2.8 562.2855 2 51.79 13 F13:29736 NaNaKA16_F9.raw 3.7449E87.0956E75.0959E72.0327E63.4961E51.7447E81.5647E103.8482E93.7982E91.0131E11 42 02211001255518 57 65 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 32 42 PEAKS DB
E.AEKISGC(+57.02)WPYIK.T Y 59.04 1450.7278 12 0.5 726.3715 2 40.43 13 F13:20797 NaNaKA16_F9.raw 7.6834E6 2 0000000000002 54 65 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 33 42 PEAKS DB
total 5 peptides
XP_013911763.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
R.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RMEWYPEAASNAER.W Y 55.40 1708.7627 14 0.1 570.5949 3 30.68 4 F4:14194 NaNaKA16_F12.raw 1.1323E7 1 0001000000000 56 69 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
total 4 peptides
XP_032069584.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MEWYPEAASNAER.W N 77.76 1552.6616 13 0.7 518.5615 3 44.66 4 F4:25052 NaNaKA16_F12.raw 1.7754E73.6E101.0543E7 15 00112200000000 57 69 PEAKS DB
R.M(+15.99)EWYPEAASNAER.W N 75.60 1568.6565 13 1.2 785.3364 2 31.92 4 F4:18885 NaNaKA16_F12.raw 4.1615E9 21 00021000000000 57 69 Oxidation (M) M1:Oxidation (M):1000.00 PEAKS DB
L.RMEWYPEAASNAER.W Y 55.40 1708.7627 14 0.1 570.5949 3 30.68 4 F4:14194 NaNaKA16_F12.raw 1.1323E7 1 0001000000000 56 69 PEAKS DB
M.EWYPEAASNAER.W N 53.15 1421.6211 12 0.6 711.8182 2 30.28 4 F4:13787 NaNaKA16_F12.raw 1.7579E7 1 0001000000000 58 69 PEAKS DB
total 4 peptides
XP_026579406.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FTYGGC(+57.02)AGNANNFK.K Y 83.49 1519.6514 14 0.1 760.8330 2 24.59 9 F9:11113 NaNaKA16_F5.raw 5.8819E76.0965E7 2 0000000011000 170 183 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.FEGSC(+57.02)SIFPNDSQR.C Y 75.18 1642.7046 14 0.2 822.3597 2 40.72 10 F10:24722 NaNaKA16_F6.raw 5.6415E51.0068E7 2 0000000011000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.LFEGSC(+57.02)SIFPNDSQR.C Y 64.56 1755.7886 15 0.3 878.9018 2 55.75 10 F10:37299 NaNaKA16_F6.raw 4.6458E7 1 0000000001000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026579408.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FTYGGC(+57.02)AGNANNFK.K Y 83.49 1519.6514 14 0.1 760.8330 2 24.59 9 F9:11113 NaNaKA16_F5.raw 5.8819E76.0965E7 2 0000000011000 170 183 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.FEGSC(+57.02)SIFPNDSQR.C Y 75.18 1642.7046 14 0.2 822.3597 2 40.72 10 F10:24722 NaNaKA16_F6.raw 5.6415E51.0068E7 2 0000000011000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.LFEGSC(+57.02)SIFPNDSQR.C Y 64.56 1755.7886 15 0.3 878.9018 2 55.75 10 F10:37299 NaNaKA16_F6.raw 4.6458E7 1 0000000001000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026579405.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FTYGGC(+57.02)AGNANNFK.K Y 83.49 1519.6514 14 0.1 760.8330 2 24.59 9 F9:11113 NaNaKA16_F5.raw 5.8819E76.0965E7 2 0000000011000 170 183 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.FEGSC(+57.02)SIFPNDSQR.C Y 75.18 1642.7046 14 0.2 822.3597 2 40.72 10 F10:24722 NaNaKA16_F6.raw 5.6415E51.0068E7 2 0000000011000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.LFEGSC(+57.02)SIFPNDSQR.C Y 64.56 1755.7886 15 0.3 878.9018 2 55.75 10 F10:37299 NaNaKA16_F6.raw 4.6458E7 1 0000000001000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026579404.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FTYGGC(+57.02)AGNANNFK.K Y 83.49 1519.6514 14 0.1 760.8330 2 24.59 9 F9:11113 NaNaKA16_F5.raw 5.8819E76.0965E7 2 0000000011000 170 183 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.FEGSC(+57.02)SIFPNDSQR.C Y 75.18 1642.7046 14 0.2 822.3597 2 40.72 10 F10:24722 NaNaKA16_F6.raw 5.6415E51.0068E7 2 0000000011000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.LFEGSC(+57.02)SIFPNDSQR.C Y 64.56 1755.7886 15 0.3 878.9018 2 55.75 10 F10:37299 NaNaKA16_F6.raw 4.6458E7 1 0000000001000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026579409.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FTYGGC(+57.02)AGNANNFK.K Y 83.49 1519.6514 14 0.1 760.8330 2 24.59 9 F9:11113 NaNaKA16_F5.raw 5.8819E76.0965E7 2 0000000011000 170 183 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
L.FEGSC(+57.02)SIFPNDSQR.C Y 75.18 1642.7046 14 0.2 822.3597 2 40.72 10 F10:24722 NaNaKA16_F6.raw 5.6415E51.0068E7 2 0000000011000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
G.LFEGSC(+57.02)SIFPNDSQR.C Y 64.56 1755.7886 15 0.3 878.9018 2 55.75 10 F10:37299 NaNaKA16_F6.raw 4.6458E7 1 0000000001000 33 47 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
2M99
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.YSNTC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 88.06 2151.8486 19 -0.4 1076.9312 2 11.90 9 F9:1956 NaNaKA16_F5.raw 7.3152E51.3863E84.2021E5 3 0000000110100 26 44 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 56.15 1787.7104 16 0.4 596.9110 3 11.84 9 F9:1871 NaNaKA16_F5.raw 5.9811E5 1 0000000010000 29 44 Carbamidomethylation C2:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.A N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 4 15 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
H.SFTYSGC(+57.02)GGNANR.F Y 45.38 1389.5731 13 0.0 695.7938 2 11.92 9 F9:1980 NaNaKA16_F5.raw 2.6632E5 1 0000000010000 32 44 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
CAE51866.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.YSNTC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 88.06 2151.8486 19 -0.4 1076.9312 2 11.90 9 F9:1956 NaNaKA16_F5.raw 7.3152E51.3863E84.2021E5 3 0000000110100 50 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 56.15 1787.7104 16 0.4 596.9110 3 11.84 9 F9:1871 NaNaKA16_F5.raw 5.9811E5 1 0000000010000 53 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.A N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 28 39 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
H.SFTYSGC(+57.02)GGNANR.F Y 45.38 1389.5731 13 0.0 695.7938 2 11.92 9 F9:1980 NaNaKA16_F5.raw 2.6632E5 1 0000000010000 56 68 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
Q5ZPJ7.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.YSNTC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 88.06 2151.8486 19 -0.4 1076.9312 2 11.90 9 F9:1956 NaNaKA16_F5.raw 7.3152E51.3863E84.2021E5 3 0000000110100 50 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 56.15 1787.7104 16 0.4 596.9110 3 11.84 9 F9:1871 NaNaKA16_F5.raw 5.9811E5 1 0000000010000 53 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.A N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 28 39 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
H.SFTYSGC(+57.02)GGNANR.F Y 45.38 1389.5731 13 0.0 695.7938 2 11.92 9 F9:1980 NaNaKA16_F5.raw 2.6632E5 1 0000000010000 56 68 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
CAE51867.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.YSNTC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 88.06 2151.8486 19 -0.4 1076.9312 2 11.90 9 F9:1956 NaNaKA16_F5.raw 7.3152E51.3863E84.2021E5 3 0000000110100 50 68 Carbamidomethylation C5:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
N.TC(+57.02)HSFTYSGC(+57.02)GGNANR.F Y 56.15 1787.7104 16 0.4 596.9110 3 11.84 9 F9:1871 NaNaKA16_F5.raw 5.9811E5 1 0000000010000 53 68 Carbamidomethylation C2:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
R.FC(+57.02)ELAPSAGSC(+57.02)F.A N 51.69 1344.5479 12 0.6 673.2816 2 63.59 9 F9:43111 NaNaKA16_F5.raw 1.5951E8 1 0000000010000 28 39 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
H.SFTYSGC(+57.02)GGNANR.F Y 45.38 1389.5731 13 0.0 695.7938 2 11.92 9 F9:1980 NaNaKA16_F5.raw 2.6632E5 1 0000000010000 56 68 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
JAB52939.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAI08988.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAI09156.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAS04977.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAC95037.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_034298588.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026522979.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
ETE60014.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026555459.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
LAA17506.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 238 251 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 413 423 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 378 393 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 378 387 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 340 351 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
LAB17921.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 242 255 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 417 427 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 382 397 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 382 391 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 344 355 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_034298590.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 116 129 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 291 301 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 256 271 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 256 265 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 218 229 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_034298589.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 141 154 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 316 326 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 281 296 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 281 290 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 243 254 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAC96561.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_029139565.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 186 199 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 361 371 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 326 341 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 326 335 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 288 299 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAI10614.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAV48556.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_013912093.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAC94973.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 116 129 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 291 301 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 256 271 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 256 265 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 218 229 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
SMD28268.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
JAA95033.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 185 198 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 360 370 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 325 340 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 325 334 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 287 298 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
LAB17920.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TLFEITVPLSHGPK.P Y 67.52 1537.8503 14 -0.1 513.6240 3 58.66 2 F2:36076 NaNaKA16_F10.raw 9.1753E61.5718E62.8923E6 4 0200000000011 53 66 PEAKS DB
K.C(+57.02)IC(+57.02)EC(+57.02)VESPNK.C Y 61.53 1394.5629 11 0.3 698.2889 2 47.51 6 F6:30331 NaNaKA16_F2.raw 4.592E5 1 0000010000000 228 238 Carbamidomethylation C1:Carbamidomethylation:1000.00;C3:Carbamidomethylation:1000.00;C5:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNKEFDEEK.C Y 60.34 1864.8876 16 4.8 622.6364 3 33.83 7 F7:14388 NaNaKA16_F3.raw 1.4164E5 1 0000001000000 193 208 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.LLPSSC(+57.02)GLNK.E Y 54.98 1087.5696 10 -0.1 544.7920 2 19.39 6 F6:6810 NaNaKA16_F2.raw 2.1852E6 1 0000010000000 193 202 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.ELDEETC(+57.02)QC(+57.02)VC(+57.02)K.G Y 48.15 1569.6110 12 0.1 785.8129 2 12.37 6 F6:2413 NaNaKA16_F2.raw 8.8422E4 1 0000010000000 155 166 Carbamidomethylation C7:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026575343.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QLVPIGLSEFALDIR.M Y 75.78 1669.9402 15 0.1 557.6541 3 95.82 4 F4:67305 NaNaKA16_F12.raw 2.3291E6 2 0002000000000 55 69 PEAKS DB
K.YFVLQVHYGDVGVFK.D Y 72.55 1769.9141 15 -0.4 590.9784 3 68.48 4 F4:45599 NaNaKA16_F12.raw 1.0363E6 1 0001000000000 168 182 PEAKS DB
R.LPVEEEAYVVDFKPH.A Y 50.34 1770.8828 15 0.8 591.3020 3 55.69 4 F4:35066 NaNaKA16_F12.raw 2.2836E6 1 0001000000000 88 102 PEAKS DB
total 3 peptides
XP_026575334.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QLVPIGLSEFALDIR.M Y 75.78 1669.9402 15 0.1 557.6541 3 95.82 4 F4:67305 NaNaKA16_F12.raw 2.3291E6 2 0002000000000 55 69 PEAKS DB
K.YFVLQVHYGDVGVFK.D Y 72.55 1769.9141 15 -0.4 590.9784 3 68.48 4 F4:45599 NaNaKA16_F12.raw 1.0363E6 1 0001000000000 168 182 PEAKS DB
R.LPVEEEAYVVDFKPH.A Y 50.34 1770.8828 15 0.8 591.3020 3 55.69 4 F4:35066 NaNaKA16_F12.raw 2.2836E6 1 0001000000000 88 102 PEAKS DB
total 3 peptides
XP_026575314.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QLVPIGLSEFALDIR.M Y 75.78 1669.9402 15 0.1 557.6541 3 95.82 4 F4:67305 NaNaKA16_F12.raw 2.3291E6 2 0002000000000 55 69 PEAKS DB
K.YFVLQVHYGDVGVFK.D Y 72.55 1769.9141 15 -0.4 590.9784 3 68.48 4 F4:45599 NaNaKA16_F12.raw 1.0363E6 1 0001000000000 168 182 PEAKS DB
R.LPVEEEAYVVDFKPH.A Y 50.34 1770.8828 15 0.8 591.3020 3 55.69 4 F4:35066 NaNaKA16_F12.raw 2.2836E6 1 0001000000000 88 102 PEAKS DB
total 3 peptides
XP_026575325.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QLVPIGLSEFALDIR.M Y 75.78 1669.9402 15 0.1 557.6541 3 95.82 4 F4:67305 NaNaKA16_F12.raw 2.3291E6 2 0002000000000 55 69 PEAKS DB
K.YFVLQVHYGDVGVFK.D Y 72.55 1769.9141 15 -0.4 590.9784 3 68.48 4 F4:45599 NaNaKA16_F12.raw 1.0363E6 1 0001000000000 168 182 PEAKS DB
R.LPVEEEAYVVDFKPH.A Y 50.34 1770.8828 15 0.8 591.3020 3 55.69 4 F4:35066 NaNaKA16_F12.raw 2.2836E6 1 0001000000000 88 102 PEAKS DB
total 3 peptides
XP_026575319.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QLVPIGLSEFALDIR.M Y 75.78 1669.9402 15 0.1 557.6541 3 95.82 4 F4:67305 NaNaKA16_F12.raw 2.3291E6 2 0002000000000 55 69 PEAKS DB
K.YFVLQVHYGDVGVFK.D Y 72.55 1769.9141 15 -0.4 590.9784 3 68.48 4 F4:45599 NaNaKA16_F12.raw 1.0363E6 1 0001000000000 168 182 PEAKS DB
R.LPVEEEAYVVDFKPH.A Y 50.34 1770.8828 15 0.8 591.3020 3 55.69 4 F4:35066 NaNaKA16_F12.raw 2.2836E6 1 0001000000000 88 102 PEAKS DB
total 3 peptides
XP_026570451.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FASFIDKVR.F N 65.27 1081.5920 9 3.5 541.8023 2 29.71 8 F8:13159 NaNaKA16_F4.raw 5.894E57.4963E501.9656E62.1554E62.1372E6 5 0001100111000 182 190 PEAKS DB
K.LALDIEIATYR.K N 64.60 1276.7026 11 0.8 639.3591 2 69.21 11 F11:46918 NaNaKA16_F7.raw 1.118E61.7861E61.6805E66.0957E58.3228E52.295E6 6 0000010011111 464 474 PEAKS DB
R.TEAESWYQTK.Y Y 53.60 1241.5564 10 -0.5 621.7852 2 22.28 5 F5:6009 NaNaKA16_F13.raw 1.1357E6 1 0000100000000 358 367 PEAKS DB
K.YEELQVTAGR.H Y 44.80 1164.5775 10 0.0 583.2960 2 24.04 5 F5:6769 NaNaKA16_F13.raw 3.6427E5 1 0000100000000 368 377 PEAKS DB
total 4 peptides
AAM51550.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VYEMVNALNTMYR.R Y 67.38 1602.7534 13 0.8 802.3846 2 65.11 5 F5:26842 NaNaKA16_F13.raw 1.0623E6 1 0000100000000 232 244 PEAKS DB
Q.ATLDLFGEWR.E N 65.68 1206.6033 10 0.9 604.3094 2 78.42 2 F2:53296 NaNaKA16_F10.raw 2.2448E63.9536E51.1467E75.6872E66.3509E51.6325E61.5953E6 8 0101200001111 272 281 PEAKS DB
R.DRPQC(+57.02)ILNKPSR.K Y 65.30 1482.7725 12 0.3 495.2649 3 11.84 5 F5:1801 NaNaKA16_F13.raw 2.8122E6 1 0000100000000 391 402 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
Q10749.3
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VYEMVNALNTMYR.R Y 67.38 1602.7534 13 0.8 802.3846 2 65.11 5 F5:26842 NaNaKA16_F13.raw 1.0623E6 1 0000100000000 232 244 PEAKS DB
Q.ATLDLFGEWR.E N 65.68 1206.6033 10 0.9 604.3094 2 78.42 2 F2:53296 NaNaKA16_F10.raw 2.2448E63.9536E51.1467E75.6872E66.3509E51.6325E61.5953E6 8 0101200001111 272 281 PEAKS DB
R.DRPQC(+57.02)ILNKPSR.K Y 65.30 1482.7725 12 0.3 495.2649 3 11.84 5 F5:1801 NaNaKA16_F13.raw 2.8122E6 1 0000100000000 391 402 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
A.DSSAVISAC(+57.02)DGLK.G N 60.11 1321.6184 13 0.4 661.8168 2 33.21 10 F10:19042 NaNaKA16_F6.raw 6.9505E6 1 0000000001000 119 131 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
P18964.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WC(+57.02)EPLYPWVPADSR.T Y 78.81 1774.8137 14 0.9 888.4149 2 77.31 4 F4:52756 NaNaKA16_F12.raw 3.2408E53.1766E6 2 0011000000000 151 164 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.ISTTEDTYPDVPHC(+57.02)TNIFIVK.H Y 69.19 2449.1836 21 -0.4 817.4015 3 59.42 4 F4:38046 NaNaKA16_F12.raw 3.898E6 1 0001000000000 128 148 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.RPVTYSTHIAPVSLPSR.S Y 54.67 1880.0267 17 0.5 627.6832 3 28.52 4 F4:12074 NaNaKA16_F12.raw 7.8153E6 2 0002000000000 96 112 PEAKS DB
K.FPNGLDKDIMLIR.L Y 47.58 1530.8228 13 0.2 511.2816 3 62.71 4 F4:40623 NaNaKA16_F12.raw 5.0748E5 1 0001000000000 81 93 PEAKS DB
total 4 peptides
P18965.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WC(+57.02)EPLYPWVPADSR.T Y 78.81 1774.8137 14 0.9 888.4149 2 77.31 4 F4:52756 NaNaKA16_F12.raw 3.2408E53.1766E6 2 0011000000000 175 188 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.ISTTEDTYPDVPHC(+57.02)TNIFIVK.H Y 69.19 2449.1836 21 -0.4 817.4015 3 59.42 4 F4:38046 NaNaKA16_F12.raw 3.898E6 1 0001000000000 152 172 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.RPVTYSTHIAPVSLPSR.S Y 54.67 1880.0267 17 0.5 627.6832 3 28.52 4 F4:12074 NaNaKA16_F12.raw 7.8153E6 2 0002000000000 120 136 PEAKS DB
K.FPNGLDKDIMLIR.L Y 47.58 1530.8228 13 0.2 511.2816 3 62.71 4 F4:40623 NaNaKA16_F12.raw 5.0748E5 1 0001000000000 105 117 PEAKS DB
total 4 peptides
ADP88558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WC(+57.02)EPLYPWVPADSR.T Y 78.81 1774.8137 14 0.9 888.4149 2 77.31 4 F4:52756 NaNaKA16_F12.raw 3.2408E53.1766E6 2 0011000000000 175 188 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
K.ISTTEDTYPDVPHC(+57.02)TNIFIVK.H Y 69.19 2449.1836 21 -0.4 817.4015 3 59.42 4 F4:38046 NaNaKA16_F12.raw 3.898E6 1 0001000000000 152 172 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
R.RPVTYSTHIAPVSLPSR.S Y 54.67 1880.0267 17 0.5 627.6832 3 28.52 4 F4:12074 NaNaKA16_F12.raw 7.8153E6 2 0002000000000 120 136 PEAKS DB
K.FPNGLDKDIMLIR.L Y 47.58 1530.8228 13 0.2 511.2816 3 62.71 4 F4:40623 NaNaKA16_F12.raw 5.0748E5 1 0001000000000 105 117 PEAKS DB
total 4 peptides
LAA86163.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)LETFGEQPLSK.K Y 71.04 1407.6704 12 -0.1 704.8424 2 37.43 9 F9:21037 NaNaKA16_F5.raw 9.5826E6 2 0000000020000 193 204 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.TTAIVGNLPSSR.D Y 59.87 1214.6619 12 -0.7 608.3378 2 27.46 10 F10:13494 NaNaKA16_F6.raw 5.8183E6 1 0000000001000 453 464 PEAKS DB
K.DGQSISLVLK.I Y 58.68 1058.5972 10 -0.3 530.3057 2 56.75 6 F6:37699 NaNaKA16_F2.raw 1.6308E71.6776E62.4729E51.2797E6 7 0000023101000 354 363 PEAKS DB
R.VC(+57.02)IENEDSTSAVIVR.A Y 52.64 1690.8196 15 0.5 846.4175 2 37.00 10 F10:21436 NaNaKA16_F6.raw 6.7885E6 1 0000000001000 123 137 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
JAA75028.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
E.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 59 70 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 60 70 PEAKS DB
M.DYGC(+57.02)YC(+57.02)GEGGSGTPVDDLDR.C Y 53.94 2191.8423 20 -8.0 1096.9197 2 53.56 10 F10:35748 NaNaKA16_F6.raw 7.4633E6 2 0000000002000 51 70 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 61 70 PEAKS DB
total 4 peptides
AAZ39880.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FLTEHNPEC(+57.02)IINPPLR.T Y 78.43 1948.9829 16 -0.1 650.6682 3 50.62 4 F4:30756 NaNaKA16_F12.raw 4.0513E6 1 0001000000000 386 401 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TDIVSPPAC(+57.02)GNELLER.G Y 65.09 1769.8618 16 1.0 885.9391 2 51.94 4 F4:32003 NaNaKA16_F12.raw 2.786E6 1 0001000000000 402 417 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.VTLDLFGEWR.K N 61.73 1234.6346 10 0.5 618.3249 2 82.47 11 F11:57626 NaNaKA16_F7.raw 1.9987E54.7038E5 2 0000000000110 270 279 PEAKS DB
total 3 peptides
B8K1W0.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FLTEHNPEC(+57.02)IINPPLR.T Y 78.43 1948.9829 16 -0.1 650.6682 3 50.62 4 F4:30756 NaNaKA16_F12.raw 4.0513E6 1 0001000000000 386 401 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
R.TDIVSPPAC(+57.02)GNELLER.G Y 65.09 1769.8618 16 1.0 885.9391 2 51.94 4 F4:32003 NaNaKA16_F12.raw 2.786E6 1 0001000000000 402 417 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
N.VTLDLFGEWR.K N 61.73 1234.6346 10 0.5 618.3249 2 82.47 11 F11:57626 NaNaKA16_F7.raw 1.9987E54.7038E5 2 0000000000110 270 279 PEAKS DB
total 3 peptides
Q9W727.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISLADGNDVR.I N 62.61 1058.5356 10 -0.5 530.2748 2 22.28 11 F11:9363 NaNaKA16_F7.raw 3.5268E65.5622E7 4 0000000002200 48 57 PEAKS DB
R.TPETTEIC(+57.02)PDSWYFC(+57.02)YK.I Y 57.52 2195.9180 17 -0.8 1098.9653 2 71.57 10 F10:50882 NaNaKA16_F6.raw 1.6607E6 1 0000000001000 31 47 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELR.P N 45.94 1239.5376 10 0.0 620.7761 2 30.33 10 F10:15872 NaNaKA16_F6.raw 1.838E7 1 0000000001000 61 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.TTEIC(+57.02)PDSWYFC(+57.02)YK.I N 42.51 1868.7749 14 1.2 935.3958 2 68.81 10 F10:48624 NaNaKA16_F6.raw 1.3848E6 1 0000000001000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
Q9DEQ3.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISLADGNDVR.I N 62.61 1058.5356 10 -0.5 530.2748 2 22.28 11 F11:9363 NaNaKA16_F7.raw 3.5268E65.5622E7 4 0000000002200 48 57 PEAKS DB
R.TPETTEIC(+57.02)PDSWYFC(+57.02)YK.I Y 57.52 2195.9180 17 -0.8 1098.9653 2 71.57 10 F10:50882 NaNaKA16_F6.raw 1.6607E6 1 0000000001000 31 47 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELR.P N 45.94 1239.5376 10 0.0 620.7761 2 30.33 10 F10:15872 NaNaKA16_F6.raw 1.838E7 1 0000000001000 61 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.TTEIC(+57.02)PDSWYFC(+57.02)YK.I N 42.51 1868.7749 14 1.2 935.3958 2 68.81 10 F10:48624 NaNaKA16_F6.raw 1.3848E6 1 0000000001000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
CAB50691.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISLADGNDVR.I N 62.61 1058.5356 10 -0.5 530.2748 2 22.28 11 F11:9363 NaNaKA16_F7.raw 3.5268E65.5622E7 4 0000000002200 48 57 PEAKS DB
R.TPETTEIC(+57.02)PDSWYFC(+57.02)YK.I Y 57.52 2195.9180 17 -0.8 1098.9653 2 71.57 10 F10:50882 NaNaKA16_F6.raw 1.6607E6 1 0000000001000 31 47 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELR.P N 45.94 1239.5376 10 0.0 620.7761 2 30.33 10 F10:15872 NaNaKA16_F6.raw 1.838E7 1 0000000001000 61 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.TTEIC(+57.02)PDSWYFC(+57.02)YK.I N 42.51 1868.7749 14 1.2 935.3958 2 68.81 10 F10:48624 NaNaKA16_F6.raw 1.3848E6 1 0000000001000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
CAC08183.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ISLADGNDVR.I N 62.61 1058.5356 10 -0.5 530.2748 2 22.28 11 F11:9363 NaNaKA16_F7.raw 3.5268E65.5622E7 4 0000000002200 48 57 PEAKS DB
R.TPETTEIC(+57.02)PDSWYFC(+57.02)YK.I Y 57.52 2195.9180 17 -0.8 1098.9653 2 71.57 10 F10:50882 NaNaKA16_F6.raw 1.6607E6 1 0000000001000 31 47 Carbamidomethylation C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
R.GC(+57.02)TFTC(+57.02)PELR.P N 45.94 1239.5376 10 0.0 620.7761 2 30.33 10 F10:15872 NaNaKA16_F6.raw 1.838E7 1 0000000001000 61 70 Carbamidomethylation C2:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
E.TTEIC(+57.02)PDSWYFC(+57.02)YK.I N 42.51 1868.7749 14 1.2 935.3958 2 68.81 10 F10:48624 NaNaKA16_F6.raw 1.3848E6 1 0000000001000 34 47 Carbamidomethylation C5:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_032075406.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_013912685.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
LAB26479.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026519907.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026556422.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_015676850.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAV51273.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AFJ49397.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG47493.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG45861.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAI14367.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAA97793.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_034283168.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026519906.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026556420.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_013912686.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_034283217.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_015676849.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
K.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAI10297.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG68744.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 163 179 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 142 156 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ETE71713.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GMNLHDYGMLLPC(+57.02)GIDK.F Y 84.67 1932.8896 17 1.6 967.4536 2 65.84 9 F9:45212 NaNaKA16_F5.raw 3.28E7 2 0000000020000 155 171 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
R.MDIC(+57.02)ETHLHWHTVAK.E Y 79.85 1876.8712 15 -0.1 626.6310 3 22.06 9 F9:9168 NaNaKA16_F5.raw 1.6968E7 2 0000000020000 134 148 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026556851.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NPDGAEVPWC(+57.02)FTTNPNIR.I Y 71.09 2086.9531 18 -0.7 1044.4832 2 67.95 10 F10:47791 NaNaKA16_F6.raw 5.5425E6 2 0000000002000 343 360 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.GTVNTIWSGIEC(+57.02)QR.W Y 54.12 1619.7726 14 -0.8 810.8929 2 54.83 10 F10:36806 NaNaKA16_F6.raw 9.9884E6 1 0000000001000 302 315 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.IVVGVIIPGR.G Y 51.24 1021.6648 10 0.5 511.8399 2 54.45 13 F13:31672 NaNaKA16_F9.raw 1.8048E600 1 0100000000000 677 686 PEAKS DB
K.LSRPAVSNNAVAIIR.L Y 46.51 1579.9158 15 1.2 527.6465 3 29.81 4 F4:13118 NaNaKA16_F12.raw 1.5704E5 1 0001000000000 575 589 PEAKS DB
S.AVIETTEC(+57.02)IQGQGEGYR.G Y 43.56 1909.8839 17 0.5 955.9497 2 32.89 10 F10:18132 NaNaKA16_F6.raw 1.1889E6 1 0000000001000 285 301 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
XP_026556843.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NPDGAEVPWC(+57.02)FTTNPNIR.I Y 71.09 2086.9531 18 -0.7 1044.4832 2 67.95 10 F10:47791 NaNaKA16_F6.raw 5.5425E6 2 0000000002000 348 365 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.GTVNTIWSGIEC(+57.02)QR.W Y 54.12 1619.7726 14 -0.8 810.8929 2 54.83 10 F10:36806 NaNaKA16_F6.raw 9.9884E6 1 0000000001000 307 320 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
K.IVVGVIIPGR.G Y 51.24 1021.6648 10 0.5 511.8399 2 54.45 13 F13:31672 NaNaKA16_F9.raw 1.8048E600 1 0100000000000 682 691 PEAKS DB
K.LSRPAVSNNAVAIIR.L Y 46.51 1579.9158 15 1.2 527.6465 3 29.81 4 F4:13118 NaNaKA16_F12.raw 1.5704E5 1 0001000000000 580 594 PEAKS DB
S.AVIETTEC(+57.02)IQGQGEGYR.G Y 43.56 1909.8839 17 0.5 955.9497 2 32.89 10 F10:18132 NaNaKA16_F6.raw 1.1889E6 1 0000000001000 290 306 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 5 peptides
1COD
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 1 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 48 59 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 49 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
1V6P
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 1 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 48 59 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 49 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
1COE
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 1 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 48 59 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 49 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB25735.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 1 26 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 48 59 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 49 59 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
ADN67584.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 3 28 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 50 61 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 51 61 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB36932.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
Q9PTT0.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
P60770.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
P60771.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAY63884.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB36930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB03222.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
CAA73097.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB03221.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
ADN67574.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB03223.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB36931.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB01538.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAF21774.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAR33035.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSQTPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 81.34 2944.2021 26 -3.1 982.4050 3 11.84 6 F6:2150 NaNaKA16_F2.raw 1.1842E61.0244E8 2 1000010000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.NGIEINC(+57.02)C(+57.02)TTDR.C Y 73.30 1451.6133 12 0.2 726.8141 2 20.42 1 F1:6421 NaNaKA16_F1.raw 8.7813E61.338E7 2 1000010000000 69 80 Carbamidomethylation C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00 PEAKS DB
N.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
LAB46845.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 25 36 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 26 36 PEAKS DB
R.SAWDFTNYGC(+57.02)YC(+57.02)GAGGSGTPVDDLDR.C Y 46.35 2840.1443 26 4.4 947.7262 3 105.93 13 F13:74891 NaNaKA16_F9.raw 4.6144E7 1 0000000000001 11 36 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 27 36 PEAKS DB
total 4 peptides
LAA90412.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 44 55 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 45 55 PEAKS DB
R.SAWDFTNYGC(+57.02)YC(+57.02)GAGGSGTPVDDLDR.C Y 46.35 2840.1443 26 4.4 947.7262 3 105.93 13 F13:74891 NaNaKA16_F9.raw 4.6144E7 1 0000000000001 30 55 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 46 55 PEAKS DB
total 4 peptides
LAA90421.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 44 55 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 45 55 PEAKS DB
R.SAWDFTNYGC(+57.02)YC(+57.02)GAGGSGTPVDDLDR.C Y 46.35 2840.1443 26 4.4 947.7262 3 105.93 13 F13:74891 NaNaKA16_F9.raw 4.6144E7 1 0000000000001 30 55 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 46 55 PEAKS DB
total 4 peptides
LAB46837.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 25 36 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 26 36 PEAKS DB
R.SAWDFTNYGC(+57.02)YC(+57.02)GAGGSGTPVDDLDR.C Y 46.35 2840.1443 26 4.4 947.7262 3 105.93 13 F13:74891 NaNaKA16_F9.raw 4.6144E7 1 0000000000001 11 36 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 27 36 PEAKS DB
total 4 peptides
LAB46855.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.GGSGTPVDDLDR.C N 67.81 1187.5417 12 0.8 594.7786 2 19.63 10 F10:6988 NaNaKA16_F6.raw 5.7224E72.6509E93.9395E6 4 0000000002110 25 36 PEAKS DB
G.GSGTPVDDLDR.C N 60.74 1130.5204 11 -0.3 566.2673 2 21.08 11 F11:8172 NaNaKA16_F7.raw 1.4052E51.2671E7 2 0000000001100 26 36 PEAKS DB
R.SAWDFTNYGC(+57.02)YC(+57.02)GAGGSGTPVDDLDR.C Y 46.35 2840.1443 26 4.4 947.7262 3 105.93 13 F13:74891 NaNaKA16_F9.raw 4.6144E7 1 0000000000001 11 36 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
G.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 27 36 PEAKS DB
total 4 peptides
XP_032067281.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FASFIDKVR.F N 65.27 1081.5920 9 3.5 541.8023 2 29.71 8 F8:13159 NaNaKA16_F4.raw 5.894E57.4963E501.9656E62.1554E62.1372E6 5 0001100111000 161 169 PEAKS DB
K.LALDIEIATYR.K N 64.60 1276.7026 11 0.8 639.3591 2 69.21 11 F11:46918 NaNaKA16_F7.raw 1.118E61.7861E61.6805E66.0957E58.3228E52.295E6 6 0000010011111 444 454 PEAKS DB
K.YEELQVSVGR.H Y 51.57 1178.5931 10 5.3 590.3040 2 30.47 7 F7:11700 NaNaKA16_F3.raw 3.5293E6 1 0000001000000 348 357 PEAKS DB
total 3 peptides
XP_013915209.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FASFIDKVR.F N 65.27 1081.5920 9 3.5 541.8023 2 29.71 8 F8:13159 NaNaKA16_F4.raw 5.894E57.4963E501.9656E62.1554E62.1372E6 5 0001100111000 161 169 PEAKS DB
K.LALDIEIATYR.K N 64.60 1276.7026 11 0.8 639.3591 2 69.21 11 F11:46918 NaNaKA16_F7.raw 1.118E61.7861E61.6805E66.0957E58.3228E52.295E6 6 0000010011111 444 454 PEAKS DB
K.YEELQVSVGR.H Y 51.57 1178.5931 10 5.3 590.3040 2 30.47 7 F7:11700 NaNaKA16_F3.raw 3.5293E6 1 0000001000000 348 357 PEAKS DB
total 3 peptides
P86368.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.C(+57.02)C(+57.02)FVHDC(+57.02)C(+57.02)YGNLPDC(+57.02)NPK.S N 74.08 2314.8687 18 0.4 772.6305 3 32.68 4 F4:15898 NaNaKA16_F12.raw 5.4885E7 2 0002000000000 43 60 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C8:Carbamidomethylation:1000.00;C15:Carbamidomethylation:1000.00 PEAKS DB
I.YM(+15.99)LYPDFLC(+57.02)K.G N 68.84 1364.6145 10 0.1 683.3146 2 68.38 4 F4:45614 NaNaKA16_F12.raw 8.5839E6 4 0004000000000 107 116 Oxidation (M); Carbamidomethylation M2:Oxidation (M):1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
I.YMLYPDFLC(+57.02)K.G N 67.92 1348.6195 10 0.7 675.3175 2 75.32 4 F4:51022 NaNaKA16_F12.raw 6.0196E56.6727E55.9248E74.1845E5 4 0111000001000 107 116 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.IYMLYPDFLC(+57.02)K.G Y 45.34 1461.7036 11 0.7 731.8596 2 82.77 11 F11:57956 NaNaKA16_F7.raw 2.1087E5 1 0000000000100 106 116 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
JAG66642.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAB53407.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAI11580.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_015686894.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_007432078.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAV49286.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
LAA53283.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_015686900.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_007432077.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_026551822.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
AFJ51304.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_034283249.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_026551821.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAA95751.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_032072309.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_026532495.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_026532494.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAI09470.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_032072311.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_034283248.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
LAB39333.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
LAB39331.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 25 40 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 77 85 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 68 76 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 43 55 PEAKS DB
total 4 peptides
LAA53282.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 35 50 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 87 95 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 78 86 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 53 65 PEAKS DB
total 4 peptides
XP_013929631.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_013929630.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAI09497.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAB53439.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAI11613.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
AFJ51273.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAG66673.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAA95781.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAB53440.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
AAG17445.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAI10738.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
XP_013928637.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
AFJ51941.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
JAB53023.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TITLEVEPSDTIENVK.A Y 71.38 1786.9200 16 1.1 894.4683 2 56.97 1 F1:22100 NaNaKA16_F1.raw 1.7352E78.563E57.9338E5 3 1001000010000 12 27 PEAKS DB
K.ESTLHLVLR.L Y 62.86 1066.6135 9 0.3 534.3142 2 28.01 9 F9:13605 NaNaKA16_F5.raw 2.5029E5 1 0000000010000 64 72 PEAKS DB
R.TLSDYNIQK.E Y 56.48 1080.5452 9 1.0 541.2804 2 19.39 1 F1:5953 NaNaKA16_F1.raw 3.0489E6 2 2000000000000 55 63 PEAKS DB
K.IQDKEGIPPDQQR.L Y 42.00 1522.7739 13 -0.1 508.5985 3 11.71 1 F1:2169 NaNaKA16_F1.raw 1.117E6 1 1000000000000 30 42 PEAKS DB
total 4 peptides
LAA22167.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 107 121 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 324 334 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 152 167 PEAKS DB
total 3 peptides
XP_007444287.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
XP_026569669.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
JAB53920.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
XP_026544199.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
JAG47406.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
JAI14245.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
JAG45747.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
JAA97708.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
XP_013922009.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 77 91 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 294 304 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 122 137 PEAKS DB
total 3 peptides
XP_032069128.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVQAEEMVEFSSGLK.G Y 72.67 1666.7872 15 0.7 834.4015 2 57.47 1 F1:22310 NaNaKA16_F1.raw 6.2448E6 2 2000000000000 89 103 PEAKS DB
K.HALIIYDDLSK.Q Y 67.93 1286.6870 11 0.3 644.3510 2 34.90 1 F1:15224 NaNaKA16_F1.raw 1.6656E6 1 1000000000000 306 316 PEAKS DB
R.TGAIVDVPVGEELLGR.V Y 43.34 1623.8832 16 0.7 812.9495 2 71.89 1 F1:26457 NaNaKA16_F1.raw 8.0145E5 1 1000000000000 134 149 PEAKS DB
total 3 peptides
D5LMJ3.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VYEMVNYLNTK.Y Y 76.05 1372.6697 11 0.9 687.3427 2 49.71 3 F3:28127 NaNaKA16_F11.raw 5.6566E71.1334E87.86E72.6505E5 5 0112100000000 231 241 PEAKS DB
R.VYEM(+15.99)VNYLNTK.Y Y 60.35 1388.6646 11 0.6 695.3400 2 31.58 4 F4:14688 NaNaKA16_F12.raw 2.73E6 1 0001000000000 231 241 Oxidation (M) M4:Oxidation (M):1000.00 PEAKS DB
W.GSVAVVQDYSR.R Y 45.46 1179.5884 11 0.2 590.8016 2 21.25 5 F5:5450 NaNaKA16_F13.raw 1.2356E5 1 0000100000000 317 327 PEAKS DB
R.VYEMVNYLNTKYR.R Y 42.80 1691.8341 13 0.1 564.9520 3 45.94 4 F4:26761 NaNaKA16_F12.raw 2.3007E5 1 0001000000000 231 243 PEAKS DB
total 4 peptides
ADF43026.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VYEMVNYLNTK.Y Y 76.05 1372.6697 11 0.9 687.3427 2 49.71 3 F3:28127 NaNaKA16_F11.raw 5.6566E71.1334E87.86E72.6505E5 5 0112100000000 231 241 PEAKS DB
R.VYEM(+15.99)VNYLNTK.Y Y 60.35 1388.6646 11 0.6 695.3400 2 31.58 4 F4:14688 NaNaKA16_F12.raw 2.73E6 1 0001000000000 231 241 Oxidation (M) M4:Oxidation (M):1000.00 PEAKS DB
W.GSVAVVQDYSR.R Y 45.46 1179.5884 11 0.2 590.8016 2 21.25 5 F5:5450 NaNaKA16_F13.raw 1.2356E5 1 0000100000000 317 327 PEAKS DB
R.VYEMVNYLNTKYR.R Y 42.80 1691.8341 13 0.1 564.9520 3 45.94 4 F4:26761 NaNaKA16_F12.raw 2.3007E5 1 0001000000000 231 243 PEAKS DB
total 4 peptides
ACF21000.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Y.YFFGESPPVLVLTC(+57.02)K.S Y 64.06 1755.8905 15 0.3 878.9528 2 83.86 4 F4:58111 NaNaKA16_F12.raw 1.8725E6 1 0001000000000 107 121 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
C.TGYYFFGESPPVLVLTC(+57.02)K.S Y 62.06 2077.0229 18 0.3 1039.5190 2 91.83 4 F4:64506 NaNaKA16_F12.raw 1.724E6 1 0001000000000 104 121 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
F.FGESPPVLVLTC(+57.02)K.S Y 61.85 1445.7588 13 0.4 723.8870 2 61.00 10 F10:41816 NaNaKA16_F6.raw 3.4892E61.1315E6 2 0000000011000 109 121 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
Y.FFGESPPVLVLTC(+57.02)K.S Y 56.41 1592.8271 14 0.4 797.4211 2 75.32 4 F4:50993 NaNaKA16_F12.raw 2.1589E6 1 0001000000000 108 121 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
B6S2X0.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Y.YFFGESPPVLVLTC(+57.02)K.S Y 64.06 1755.8905 15 0.3 878.9528 2 83.86 4 F4:58111 NaNaKA16_F12.raw 1.8725E6 1 0001000000000 107 121 Carbamidomethylation C14:Carbamidomethylation:1000.00 PEAKS DB
C.TGYYFFGESPPVLVLTC(+57.02)K.S Y 62.06 2077.0229 18 0.3 1039.5190 2 91.83 4 F4:64506 NaNaKA16_F12.raw 1.724E6 1 0001000000000 104 121 Carbamidomethylation C17:Carbamidomethylation:1000.00 PEAKS DB
F.FGESPPVLVLTC(+57.02)K.S Y 61.85 1445.7588 13 0.4 723.8870 2 61.00 10 F10:41816 NaNaKA16_F6.raw 3.4892E61.1315E6 2 0000000011000 109 121 Carbamidomethylation C12:Carbamidomethylation:1000.00 PEAKS DB
Y.FFGESPPVLVLTC(+57.02)K.S Y 56.41 1592.8271 14 0.4 797.4211 2 75.32 4 F4:50993 NaNaKA16_F12.raw 2.1589E6 1 0001000000000 108 121 Carbamidomethylation C13:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
JAG47405.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
JAA97707.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
JAG45746.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
JAV51185.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
AFJ49478.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
JAI14244.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IMNVIGEPIDER.G Y 54.69 1384.7020 12 0.1 693.3583 2 47.41 1 F1:19045 NaNaKA16_F1.raw 1.9988E6 2 2000000000000 146 157 PEAKS DB
K.VVDLLAPYAK.G Y 54.59 1087.6277 10 0.3 544.8213 2 48.85 1 F1:20321 NaNaKA16_F1.raw 1.4349E6 2 2000000000000 191 200 PEAKS DB
R.FTQAGSEVSALLGR.I Y 48.99 1434.7467 14 0.8 718.3812 2 49.83 1 F1:21345 NaNaKA16_F1.raw 2.5822E5 1 1000000000000 313 326 PEAKS DB
total 3 peptides
XP_025032248.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.EPGC(+57.02)GC(+57.02)C(+57.02)LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 65.15 2801.1335 24 0.6 934.7190 3 54.05 9 F9:34846 NaNaKA16_F5.raw 5.9367E7 2 0000000020000 147 170 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.ALQEGQPC(+57.02)GVYTER.C N 51.25 1606.7410 14 0.7 804.3783 2 20.76 9 F9:8058 NaNaKA16_F5.raw 2.4162E6 1 0000000010000 157 170 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.PLQALLDGK.G N 49.53 953.5546 9 0.0 477.7845 2 36.75 9 F9:20556 NaNaKA16_F5.raw 1.0511E7 1 0000000010000 186 194 PEAKS DB
C.LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 46.53 1980.9033 17 0.4 991.4593 2 35.17 9 F9:19212 NaNaKA16_F5.raw 0 0 0000000000000 154 170 Carbamidomethylation C3:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.ILNVLSPR.G N 45.28 910.5600 8 0.0 456.2873 2 37.44 10 F10:22021 NaNaKA16_F6.raw 8.1117E5 1 0000000001000 318 325 PEAKS DB
total 5 peptides
XP_013925299.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.EPGC(+57.02)GC(+57.02)C(+57.02)LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 65.15 2801.1335 24 0.6 934.7190 3 54.05 9 F9:34846 NaNaKA16_F5.raw 5.9367E7 2 0000000020000 56 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.ALQEGQPC(+57.02)GVYTER.C N 51.25 1606.7410 14 0.7 804.3783 2 20.76 9 F9:8058 NaNaKA16_F5.raw 2.4162E6 1 0000000010000 66 79 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.PLQALLDGK.G N 49.53 953.5546 9 0.0 477.7845 2 36.75 9 F9:20556 NaNaKA16_F5.raw 1.0511E7 1 0000000010000 95 103 PEAKS DB
C.LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 46.53 1980.9033 17 0.4 991.4593 2 35.17 9 F9:19212 NaNaKA16_F5.raw 0 0 0000000000000 63 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.ILNVLSPR.G N 45.28 910.5600 8 0.0 456.2873 2 37.44 10 F10:22021 NaNaKA16_F6.raw 8.1117E5 1 0000000001000 229 236 PEAKS DB
total 5 peptides
XP_032093683.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.EPGC(+57.02)GC(+57.02)C(+57.02)LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 65.15 2801.1335 24 0.6 934.7190 3 54.05 9 F9:34846 NaNaKA16_F5.raw 5.9367E7 2 0000000020000 56 79 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.ALQEGQPC(+57.02)GVYTER.C N 51.25 1606.7410 14 0.7 804.3783 2 20.76 9 F9:8058 NaNaKA16_F5.raw 2.4162E6 1 0000000010000 66 79 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.PLQALLDGK.G N 49.53 953.5546 9 0.0 477.7845 2 36.75 9 F9:20556 NaNaKA16_F5.raw 1.0511E7 1 0000000010000 95 103 PEAKS DB
C.LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 46.53 1980.9033 17 0.4 991.4593 2 35.17 9 F9:19212 NaNaKA16_F5.raw 0 0 0000000000000 63 79 Carbamidomethylation C3:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.ILNVLSPR.G N 45.28 910.5600 8 0.0 456.2873 2 37.44 10 F10:22021 NaNaKA16_F6.raw 8.1117E5 1 0000000001000 226 233 PEAKS DB
total 5 peptides
XP_015680080.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.EPGC(+57.02)GC(+57.02)C(+57.02)LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 65.15 2801.1335 24 0.6 934.7190 3 54.05 9 F9:34846 NaNaKA16_F5.raw 5.9367E7 2 0000000020000 54 77 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C18:Carbamidomethylation:1000.00 PEAKS DB
C.ALQEGQPC(+57.02)GVYTER.C N 51.25 1606.7410 14 0.7 804.3783 2 20.76 9 F9:8058 NaNaKA16_F5.raw 2.4162E6 1 0000000010000 64 77 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.PLQALLDGK.G N 49.53 953.5546 9 0.0 477.7845 2 36.75 9 F9:20556 NaNaKA16_F5.raw 1.0511E7 1 0000000010000 93 101 PEAKS DB
C.LTC(+57.02)ALQEGQPC(+57.02)GVYTER.C Y 46.53 1980.9033 17 0.4 991.4593 2 35.17 9 F9:19212 NaNaKA16_F5.raw 0 0 0000000000000 61 77 Carbamidomethylation C3:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
K.ILNVLSPR.G N 45.28 910.5600 8 0.0 456.2873 2 37.44 10 F10:22021 NaNaKA16_F6.raw 8.1117E5 1 0000000001000 225 232 PEAKS DB
total 5 peptides
XP_026571876.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ITANLC(+57.02)MLGALK.C N 73.92 1303.6992 12 -0.5 652.8566 2 62.39 9 F9:42245 NaNaKA16_F5.raw 5.2097E6 1 0000000010000 930 941 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
K.VVLSGTEC(+57.02)LC(+57.02)VC(+57.02)R.A Y 61.14 1551.7207 13 8.1 776.8698 2 40.78 8 F8:22141 NaNaKA16_F4.raw 2.542E5 1 0000000100000 556 568 Carbamidomethylation C8:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.KITANLC(+57.02)MLGALK.C N 58.28 1431.7942 13 0.2 478.2721 3 47.11 9 F9:28940 NaNaKA16_F5.raw 9.6699E5 1 0000000010000 929 941 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026558105.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.ALEQC(+57.02)KPM(+15.99)VAEC(+57.02)PELVR.E Y 70.41 2044.9744 17 -0.5 1023.4940 2 33.02 9 F9:17611 NaNaKA16_F5.raw 2.241E8 2 0000000020000 39 55 Carbamidomethylation; Oxidation (M) C5:Carbamidomethylation:1000.00;M8:Oxidation (M):1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
C.ALQEGQPC(+57.02)GVYTER.C N 51.25 1606.7410 14 0.7 804.3783 2 20.76 9 F9:8058 NaNaKA16_F5.raw 2.4162E6 1 0000000010000 66 79 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.PLQALLDGK.G N 49.53 953.5546 9 0.0 477.7845 2 36.75 9 F9:20556 NaNaKA16_F5.raw 1.0511E7 1 0000000010000 95 103 PEAKS DB
K.ILNVLSPR.G N 45.28 910.5600 8 0.0 456.2873 2 37.44 10 F10:22021 NaNaKA16_F6.raw 8.1117E5 1 0000000001000 228 235 PEAKS DB
total 4 peptides
AXL96618.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 548 560 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 449 457 PEAKS DB
K.AVTIFGESAGAASVGMH.L Y 45.30 1603.7664 17 1.0 802.8912 2 59.66 5 F5:24642 NaNaKA16_F13.raw 1.3261E5 1 0000100000000 224 240 PEAKS DB
total 3 peptides
JAC96629.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 551 563 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 451 459 PEAKS DB
K.AVTIFGESAGAASVGMH.L Y 45.30 1603.7664 17 1.0 802.8912 2 59.66 5 F5:24642 NaNaKA16_F13.raw 1.3261E5 1 0000100000000 226 242 PEAKS DB
total 3 peptides
AHY20009.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 551 563 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 451 459 PEAKS DB
K.AVTIFGESAGAASVGMH.L Y 45.30 1603.7664 17 1.0 802.8912 2 59.66 5 F5:24642 NaNaKA16_F13.raw 1.3261E5 1 0000100000000 226 242 PEAKS DB
total 3 peptides
ASU45022.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.AQIC(+57.02)AFWNHFLPK.L N 62.23 1630.8079 13 0.8 544.6104 3 69.52 3 F3:44588 NaNaKA16_F11.raw 9.0724E52.7007E6 2 0011000000000 541 553 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
K.VYAYLFDHR.A N 53.79 1182.5822 9 0.8 592.2988 2 36.66 5 F5:14316 NaNaKA16_F13.raw 4.8237E6 2 0000200000000 441 449 PEAKS DB
K.AVTIFGESAGAASVGMH.L Y 45.30 1603.7664 17 1.0 802.8912 2 59.66 5 F5:24642 NaNaKA16_F13.raw 1.3261E5 1 0000100000000 216 232 PEAKS DB
total 3 peptides
XP_029140716.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ITANLC(+57.02)MLGALK.C N 73.92 1303.6992 12 -0.5 652.8566 2 62.39 9 F9:42245 NaNaKA16_F5.raw 5.2097E6 1 0000000010000 907 918 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.KITANLC(+57.02)MLGALK.C N 58.28 1431.7942 13 0.2 478.2721 3 47.11 9 F9:28940 NaNaKA16_F5.raw 9.6699E5 1 0000000010000 906 918 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TDIVILHEGSC(+57.02)PN Y 57.60 1453.6871 13 0.2 727.8510 2 39.23 9 F9:22795 NaNaKA16_F5.raw 2.402E6 1 0000000010000 922 934 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026522231.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ITANLC(+57.02)MLGALK.C N 73.92 1303.6992 12 -0.5 652.8566 2 62.39 9 F9:42245 NaNaKA16_F5.raw 5.2097E6 1 0000000010000 930 941 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.KITANLC(+57.02)MLGALK.C N 58.28 1431.7942 13 0.2 478.2721 3 47.11 9 F9:28940 NaNaKA16_F5.raw 9.6699E5 1 0000000010000 929 941 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
K.TDIVILHEGSC(+57.02)PN Y 57.60 1453.6871 13 0.2 727.8510 2 39.23 9 F9:22795 NaNaKA16_F5.raw 2.402E6 1 0000000010000 945 957 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_032070501.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ITANLC(+57.02)MLGALK.C N 73.92 1303.6992 12 -0.5 652.8566 2 62.39 9 F9:42245 NaNaKA16_F5.raw 5.2097E6 1 0000000010000 907 918 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
R.KITANLC(+57.02)MLGALK.C N 58.28 1431.7942 13 0.2 478.2721 3 47.11 9 F9:28940 NaNaKA16_F5.raw 9.6699E5 1 0000000010000 906 918 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
N.TDIVILHEGSC(+57.02)PN Y 57.60 1453.6871 13 0.2 727.8510 2 39.23 9 F9:22795 NaNaKA16_F5.raw 2.402E6 1 0000000010000 922 934 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AAB32582.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGSFDVNVGQNTYVR.G Y 85.27 1667.8267 15 1.5 834.9219 2 53.32 2 F2:31321 NaNaKA16_F10.raw 2.4785E79.3413E64.4857E60 3 0111000000000 56 70 PEAKS DB
K.EMYPGDIAYNIK.G Y 65.81 1412.6646 12 0.2 707.3397 2 52.62 4 F4:32516 NaNaKA16_F12.raw 5.6975E65.1901E63.4246E6 3 0111000000000 133 144 PEAKS DB
K.EM(+15.99)YPGDIAYNIK.G Y 45.15 1428.6594 12 0.4 715.3373 2 43.64 3 F3:23989 NaNaKA16_F11.raw 7.7933E5 1 0010000000000 133 144 Oxidation (M) M2:Oxidation (M):1000.00 PEAKS DB
total 3 peptides
Q7LZI1.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LGSFDVNVGQNTYVR.G Y 85.27 1667.8267 15 1.5 834.9219 2 53.32 2 F2:31321 NaNaKA16_F10.raw 2.4785E79.3413E64.4857E60 3 0111000000000 56 70 PEAKS DB
K.EMYPGDIAYNIK.G Y 65.81 1412.6646 12 0.2 707.3397 2 52.62 4 F4:32516 NaNaKA16_F12.raw 5.6975E65.1901E63.4246E6 3 0111000000000 133 144 PEAKS DB
K.EM(+15.99)YPGDIAYNIK.G Y 45.15 1428.6594 12 0.4 715.3373 2 43.64 3 F3:23989 NaNaKA16_F11.raw 7.7933E5 1 0010000000000 133 144 Oxidation (M) M2:Oxidation (M):1000.00 PEAKS DB
total 3 peptides
ETE59846.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.ESFLFTLTR.N N 61.74 1112.5865 9 0.9 557.3010 2 70.76 4 F4:47352 NaNaKA16_F12.raw 9.6337E51.0016E7 2 0101000000000 327 335 PEAKS DB
R.AALSQYVC(+57.02)EHK.D N 61.07 1304.6183 11 0.1 653.3165 2 12.43 5 F5:2258 NaNaKA16_F13.raw 1.4233E6 2 0000200000000 257 267 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
K.LIDLELLHK.Y Y 48.33 1092.6543 9 -0.4 547.3342 2 51.36 4 F4:31335 NaNaKA16_F12.raw 8.1726E6 1 0001000000000 343 351 PEAKS DB
total 3 peptides
XP_026555558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
N.VVQEALIPIIPDYK.C N 71.29 1596.9126 14 0.6 799.4641 2 76.22 4 F4:51790 NaNaKA16_F12.raw 7.806E53.194E68.6522E6 4 0112000000000 449 462 PEAKS DB
R.SPDEDEQPWC(+57.02)YFIK.D N 53.69 1812.7665 14 0.0 907.3905 2 80.04 2 F2:54723 NaNaKA16_F10.raw 2.0014E6 1 0100000000000 235 248 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
A.EISENMFC(+57.02)AGYLDGR.S Y 52.55 1760.7498 15 0.7 881.3828 2 64.89 4 F4:42607 NaNaKA16_F12.raw 1.2567E6 1 0001000000000 472 486 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_034282171.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
N.VVQEALIPIIPDYK.C N 71.29 1596.9126 14 0.6 799.4641 2 76.22 4 F4:51790 NaNaKA16_F12.raw 7.806E53.194E68.6522E6 4 0112000000000 315 328 PEAKS DB
R.SPDEDEQPWC(+57.02)YFIK.D N 53.69 1812.7665 14 0.0 907.3905 2 80.04 2 F2:54723 NaNaKA16_F10.raw 2.0014E6 1 0100000000000 101 114 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
A.EISENMFC(+57.02)AGYLDGR.S Y 52.55 1760.7498 15 0.7 881.3828 2 64.89 4 F4:42607 NaNaKA16_F12.raw 1.2567E6 1 0001000000000 338 352 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
1CDT
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)NKLIPIAYK.T N 64.76 1218.6794 10 0.0 610.3470 2 27.82 11 F11:13604 NaNaKA16_F7.raw 4.8462E62.3967E71.338E6 6 0000000002220 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.LIPIAYKTC(+57.02)PEGK.N Y 51.73 1488.8010 13 -0.2 745.4077 2 37.95 10 F10:22266 NaNaKA16_F6.raw 2.4904E82.7013E65.7501E71.6839E63.5494E61.9896E6 14 0800000012111 6 18 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.LIPIAYK.T N 44.45 816.5109 7 0.5 409.2629 2 54.15 9 F9:34957 NaNaKA16_F5.raw 3.0941E72.6175E72.3481E709.2494E600 12 0000010270200 6 12 PEAKS DB
total 3 peptides
P01452.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)NKLIPIAYK.T N 64.76 1218.6794 10 0.0 610.3470 2 27.82 11 F11:13604 NaNaKA16_F7.raw 4.8462E62.3967E71.338E6 6 0000000002220 3 12 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.LIPIAYKTC(+57.02)PEGK.N Y 51.73 1488.8010 13 -0.2 745.4077 2 37.95 10 F10:22266 NaNaKA16_F6.raw 2.4904E82.7013E65.7501E71.6839E63.5494E61.9896E6 14 0800000012111 6 18 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
K.LIPIAYK.T N 44.45 816.5109 7 0.5 409.2629 2 54.15 9 F9:34957 NaNaKA16_F5.raw 3.0941E72.6175E72.3481E709.2494E600 12 0000010270200 6 12 PEAKS DB
total 3 peptides
XP_013925940.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
I.TLDNDIMLIK.L N 66.86 1174.6267 10 0.5 588.3209 2 56.32 9 F9:36929 NaNaKA16_F5.raw 1.0093E62.61E64.6175E64.0613E74.4662E61.8032E64.6095E63.5083E6 10 1001111221000 105 114 PEAKS DB
I.TLDNDIM(+15.99)LIK.L N 54.91 1190.6217 10 0.0 596.3181 2 48.16 6 F6:30625 NaNaKA16_F2.raw 1.1327E7 2 0000020000000 105 114 Oxidation (M) M7:Oxidation (M):1000.00 PEAKS DB
G.ELQGIVSWGR.G Y 48.20 1143.6036 10 0.1 572.8091 2 48.96 4 F4:29286 NaNaKA16_F12.raw 3.8043E5 1 0001000000000 211 220 PEAKS DB
L.DNDIMLIK.L N 42.58 960.4950 8 0.7 481.2551 2 48.07 6 F6:30522 NaNaKA16_F2.raw 8.6792E5 1 0000010000000 107 114 PEAKS DB
total 4 peptides
XP_029139862.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TLDNDIMLIK.L N 66.86 1174.6267 10 0.5 588.3209 2 56.32 9 F9:36929 NaNaKA16_F5.raw 1.0093E62.61E64.6175E64.0613E74.4662E61.8032E64.6095E63.5083E6 10 1001111221000 150 159 PEAKS DB
R.TLDNDIM(+15.99)LIK.L N 54.91 1190.6217 10 0.0 596.3181 2 48.16 6 F6:30625 NaNaKA16_F2.raw 1.1327E7 2 0000020000000 150 159 Oxidation (M) M7:Oxidation (M):1000.00 PEAKS DB
G.ELQGIVSWGR.G Y 48.20 1143.6036 10 0.1 572.8091 2 48.96 4 F4:29286 NaNaKA16_F12.raw 3.8043E5 1 0001000000000 256 265 PEAKS DB
L.DNDIMLIK.L N 42.58 960.4950 8 0.7 481.2551 2 48.07 6 F6:30522 NaNaKA16_F2.raw 8.6792E5 1 0000010000000 152 159 PEAKS DB
total 4 peptides
XP_015670838.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TLDNDIMLIK.L N 66.86 1174.6267 10 0.5 588.3209 2 56.32 9 F9:36929 NaNaKA16_F5.raw 1.0093E62.61E64.6175E64.0613E74.4662E61.8032E64.6095E63.5083E6 10 1001111221000 105 114 PEAKS DB
R.TLDNDIM(+15.99)LIK.L N 54.91 1190.6217 10 0.0 596.3181 2 48.16 6 F6:30625 NaNaKA16_F2.raw 1.1327E7 2 0000020000000 105 114 Oxidation (M) M7:Oxidation (M):1000.00 PEAKS DB
G.ELQGIVSWGR.G Y 48.20 1143.6036 10 0.1 572.8091 2 48.96 4 F4:29286 NaNaKA16_F12.raw 3.8043E5 1 0001000000000 211 220 PEAKS DB
L.DNDIMLIK.L N 42.58 960.4950 8 0.7 481.2551 2 48.07 6 F6:30522 NaNaKA16_F2.raw 8.6792E5 1 0000010000000 107 114 PEAKS DB
total 4 peptides
ETE63009.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QGEALNQLELQFTR.C Y 84.93 1645.8423 14 1.2 823.9294 2 65.43 3 F3:40903 NaNaKA16_F11.raw 4.1542E71.6447E74.5596E6 6 0222000000000 136 149 PEAKS DB
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 239 250 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_034280930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QGEALNQLELQFTR.C Y 84.93 1645.8423 14 1.2 823.9294 2 65.43 3 F3:40903 NaNaKA16_F11.raw 4.1542E71.6447E74.5596E6 6 0222000000000 156 169 PEAKS DB
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 290 301 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ETE67452.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVGREEMEQIFR.M Y 63.24 1506.7249 12 1.4 503.2496 3 38.31 3 F3:19369 NaNaKA16_F11.raw 1.6125E69.1581E5 2 0011000000000 242 253 PEAKS DB
K.YLHYDPITSR.Q Y 62.44 1263.6248 10 -0.1 632.8196 2 23.18 10 F10:10782 NaNaKA16_F6.raw 7.4787E7 3 0000000003000 28 37 PEAKS DB
R.YLNIEFC(+57.02)LR.H Y 49.96 1226.6117 9 -0.2 614.3130 2 67.95 10 F10:48613 NaNaKA16_F6.raw 5.7078E6 1 0000000001000 112 120 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_026576072.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SYLGHVSLLR.R Y 70.48 1143.6400 10 1.0 572.8279 2 35.15 4 F4:17845 NaNaKA16_F12.raw 1.3801E55.5659E6 3 0102000000000 322 331 PEAKS DB
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 286 297 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026576070.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SYLGHVSLLR.R Y 70.48 1143.6400 10 1.0 572.8279 2 35.15 4 F4:17845 NaNaKA16_F12.raw 1.3801E55.5659E6 3 0102000000000 323 332 PEAKS DB
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 287 298 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG67228.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.IANIVFANSGLK.M N 53.29 1245.7081 12 -0.5 623.8610 2 51.01 5 F5:20652 NaNaKA16_F13.raw 7.0934E5 1 0000100000000 109 120 PEAKS DB
R.SENIYVSQLLQK.A Y 52.64 1420.7561 12 0.9 711.3860 2 55.38 5 F5:22493 NaNaKA16_F13.raw 5.1493E5 1 0000100000000 329 340 PEAKS DB
K.FTAEAETDLKEPLK.E N 48.53 1590.8141 14 0.3 531.2788 3 30.97 5 F5:10833 NaNaKA16_F13.raw 3.3213E5 1 0000100000000 295 308 PEAKS DB
R.NSEVFQC(+57.02)PVK.N N 48.20 1206.5703 10 1.0 604.2930 2 22.94 5 F5:6259 NaNaKA16_F13.raw 3.6129E5 1 0000100000000 129 138 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
XP_034295297.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.IANIVFANSGLK.M N 53.29 1245.7081 12 -0.5 623.8610 2 51.01 5 F5:20652 NaNaKA16_F13.raw 7.0934E5 1 0000100000000 109 120 PEAKS DB
R.SENIYVSQLLQK.A Y 52.64 1420.7561 12 0.9 711.3860 2 55.38 5 F5:22493 NaNaKA16_F13.raw 5.1493E5 1 0000100000000 329 340 PEAKS DB
K.FTAEAETDLKEPLK.E N 48.53 1590.8141 14 0.3 531.2788 3 30.97 5 F5:10833 NaNaKA16_F13.raw 3.3213E5 1 0000100000000 295 308 PEAKS DB
R.NSEVFQC(+57.02)PVK.N N 48.20 1206.5703 10 1.0 604.2930 2 22.94 5 F5:6259 NaNaKA16_F13.raw 3.6129E5 1 0000100000000 129 138 Carbamidomethylation C7:Carbamidomethylation:1000.00 PEAKS DB
total 4 peptides
P82462.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FLFSETTETC(+57.02)PDGQNVC(+57.02)FNQAHLIYPGK.Y Y 74.46 3272.4907 28 0.8 1091.8384 3 69.74 11 F11:47367 NaNaKA16_F7.raw 4.7405E74.4988E7 2 0000000000110 8 35 Carbamidomethylation C10:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
BAN08536.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SAAIC(+57.02)FAGAPYNK.E Y 76.75 1368.6495 13 0.2 685.3322 2 36.97 10 F10:21587 NaNaKA16_F6.raw 7.9588E61.268E6 2 0000000001001 127 139 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.NLLQFSNMIK.C N 56.92 1206.6431 10 0.5 604.3291 2 65.68 2 F2:42174 NaNaKA16_F10.raw 8.2085E61.7232E6 2 0110000000000 27 36 PEAKS DB
total 2 peptides
BAM76245.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SAAIC(+57.02)FAGAPYNK.E Y 76.75 1368.6495 13 0.2 685.3322 2 36.97 10 F10:21587 NaNaKA16_F6.raw 7.9588E61.268E6 2 0000000001001 127 139 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
R.NLLQFSNMIK.C N 56.92 1206.6431 10 0.5 604.3291 2 65.68 2 F2:42174 NaNaKA16_F10.raw 8.2085E61.7232E6 2 0110000000000 27 36 PEAKS DB
total 2 peptides
XP_034292109.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EC(+57.02)PLGSHAC(+57.02)GPC(+57.02)LPQFVEDR.E Y 82.45 2328.0085 20 5.3 777.0103 3 51.07 7 F7:28442 NaNaKA16_F3.raw 1.2208E73.9264E74.6158E74.2897E6 6 0000012210000 56 75 Carbamidomethylation C2:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
R.KEC(+57.02)PLGSHAC(+57.02)GPC(+57.02)LPQFVEDR.E Y 42.19 2456.1035 21 -0.3 615.0330 4 42.77 6 F6:26226 NaNaKA16_F2.raw 8.3877E5 1 0000010000000 55 75 Carbamidomethylation C3:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAB53674.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 85 95 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 106 125 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 98 105 PEAKS DB
total 3 peptides
LAB42085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 118 128 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 139 158 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 131 138 PEAKS DB
total 3 peptides
LAB42082.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 118 128 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 139 158 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 131 138 PEAKS DB
total 3 peptides
XP_026560089.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 86 96 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 107 126 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 99 106 PEAKS DB
total 3 peptides
XP_026560087.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 86 96 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 107 126 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 99 106 PEAKS DB
total 3 peptides
LAA51478.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 9 19 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 30 49 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 22 29 PEAKS DB
total 3 peptides
XP_034286468.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 50 60 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 71 90 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 63 70 PEAKS DB
total 3 peptides
XP_026560088.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 86 96 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 107 126 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 99 106 PEAKS DB
total 3 peptides
AFJ50955.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 87 97 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 108 127 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 100 107 PEAKS DB
total 3 peptides
JAI12034.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 87 97 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 108 127 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 100 107 PEAKS DB
total 3 peptides
XP_015676418.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 87 97 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 108 127 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 100 107 PEAKS DB
total 3 peptides
LAA51474.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 9 19 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 30 49 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 22 29 PEAKS DB
total 3 peptides
XP_007426296.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 87 97 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 108 127 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 100 107 PEAKS DB
total 3 peptides
XP_025021193.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 72 82 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 93 112 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 85 92 PEAKS DB
total 3 peptides
XP_015743230.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 87 97 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 108 127 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 100 107 PEAKS DB
total 3 peptides
XP_026540879.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SVEEAIPAVC(+57.02)K.T Y 59.34 1201.6012 11 0.8 601.8083 2 28.40 10 F10:14244 NaNaKA16_F6.raw 1.8435E6 1 0000000001000 93 103 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SQIDPTSANFLIWPPC(+57.02)VEVK.R Y 55.24 2300.1511 20 -0.4 1151.0824 2 93.15 12 F12:67124 NaNaKA16_F8.raw 1.4123E7 2 0000000000020 114 133 Carbamidomethylation C16:Carbamidomethylation:1000.00 PEAKS DB
R.TVIYEIPR.S Y 41.82 989.5546 8 -0.1 495.7845 2 37.13 10 F10:21430 NaNaKA16_F6.raw 3.051E6 1 0000000001000 106 113 PEAKS DB
total 3 peptides
ETE63349.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)GIGLNDYGLSFK.V Y 67.09 1442.6864 13 -0.2 722.3503 2 66.05 4 F4:43579 NaNaKA16_F12.raw 1.3331E6 1 0001000000000 113 125 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
K.C(+57.02)FYPPTSVNIHSR.K Y 43.53 1576.7456 13 -0.1 526.5891 3 32.35 4 F4:15444 NaNaKA16_F12.raw 6.0638E5 1 0001000000000 44 56 Carbamidomethylation C1:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ETE61477.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
N.VVQEALIPIIPDYK.C N 71.29 1596.9126 14 0.6 799.4641 2 76.22 4 F4:51790 NaNaKA16_F12.raw 7.806E53.194E68.6522E6 4 0112000000000 58 71 PEAKS DB
R.FIQPIC(+57.02)LPEASMSFPDYYK.C Y 54.41 2305.0798 19 1.1 769.3680 3 90.19 4 F4:63215 NaNaKA16_F12.raw 6.87E5 1 0001000000000 21 39 Carbamidomethylation C6:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAS05124.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05123.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
AET85561.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 16 25 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 16 26 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 16 41 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05125.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05128.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05127.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05126.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAB52812.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 41 50 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 41 51 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 41 66 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAB52803.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05033.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAI09044.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05025.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05019.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAI09030.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAI09036.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAB52789.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAS05020.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAI09031.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
JAB52781.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SWWDFADYGC(+57.02).Y N 45.71 1305.4761 10 0.8 653.7458 2 109.86 11 F11:80150 NaNaKA16_F7.raw 6.5059E6 1 0000000000100 43 52 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)Y.C N 44.81 1468.5394 11 0.1 735.2771 2 111.77 10 F10:82113 NaNaKA16_F6.raw 1.9586E71.4496E7 2 0000000001010 43 53 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
R.SWWDFADYGC(+57.02)YC(+57.02)GSGGSGTPVDDLDK.C Y 43.00 2914.1487 26 4.7 729.5479 4 82.68 11 F11:57840 NaNaKA16_F7.raw 5.5123E7 2 0000000000200 43 68 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
ETE59007.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.DLYDAPINHPYVQK.A Y 60.45 1671.8257 14 0.8 558.2830 3 37.41 4 F4:19732 NaNaKA16_F12.raw 3.1543E6 2 0002000000000 13 26 PEAKS DB
Q.YNLDNEESANYFK.V Y 43.01 1605.6947 13 -6.3 803.8495 2 43.62 4 F4:24676 NaNaKA16_F12.raw 6.8453E6 1 0001000000000 35 47 PEAKS DB
total 2 peptides
ETE65528.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WLIFQMAQK.Q N 56.71 1163.6161 9 0.5 582.8156 2 72.93 3 F3:47124 NaNaKA16_F11.raw 1.6779E61.2456E61.6279E63.0604E68.2771E68.1378E5 6 0111000000111 162 170 PEAKS DB
K.GNYLPMQC(+57.02)HSSSGY.C Y 44.91 1599.6447 14 0.9 800.8303 2 34.42 6 F6:19369 NaNaKA16_F2.raw 1.6385E6 1 0000010000000 203 216 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026560868.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.DPNTGFLYNLEPLALEK.A Y 69.80 1932.9833 17 -0.4 967.4985 2 94.92 2 F2:66309 NaNaKA16_F10.raw 1.0243E6 1 0100000000000 932 948 PEAKS DB
K.WGFC(+57.02)VNEAGQR.E Y 42.42 1322.5826 11 -0.1 662.2985 2 42.60 9 F9:25257 NaNaKA16_F5.raw 0 0 0000000000000 1929 1939 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_026531033.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.DPNTGFLYNLEPLALEK.A Y 69.80 1932.9833 17 -0.4 967.4985 2 94.92 2 F2:66309 NaNaKA16_F10.raw 1.0243E6 1 0100000000000 965 981 PEAKS DB
K.WGFC(+57.02)VNEAGQR.E Y 42.42 1322.5826 11 -0.1 662.2985 2 42.60 9 F9:25257 NaNaKA16_F5.raw 0 0 0000000000000 1962 1972 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ETE64374.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.DPNTGFLYNLEPLALEK.A Y 69.80 1932.9833 17 -0.4 967.4985 2 94.92 2 F2:66309 NaNaKA16_F10.raw 1.0243E6 1 0100000000000 733 749 PEAKS DB
K.WGFC(+57.02)VNEAGQR.E Y 42.42 1322.5826 11 -0.1 662.2985 2 42.60 9 F9:25257 NaNaKA16_F5.raw 0 0 0000000000000 1626 1636 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_034284419.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.DPNTGFLYNLEPLALEK.A Y 69.80 1932.9833 17 -0.4 967.4985 2 94.92 2 F2:66309 NaNaKA16_F10.raw 1.0243E6 1 0100000000000 932 948 PEAKS DB
K.WGFC(+57.02)VNEAGQR.E Y 42.42 1322.5826 11 -0.1 662.2985 2 42.60 9 F9:25257 NaNaKA16_F5.raw 0 0 0000000000000 1929 1939 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_032090066.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 285 296 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)QLSEDQRLPC(+57.02)ASNEWEK.S Y 47.26 2409.0146 19 -3.3 804.0095 3 34.83 10 F10:19694 NaNaKA16_F6.raw 1.5737E60 1 0001000000000 165 183 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_032090065.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SQFITAFC(+57.02)SSQR.R N 53.09 1430.6613 12 0.0 716.3379 2 41.78 2 F2:22780 NaNaKA16_F10.raw 3.9839E64.2283E6 2 0110000000000 295 306 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
R.C(+57.02)C(+57.02)QLSEDQRLPC(+57.02)ASNEWEK.S Y 47.26 2409.0146 19 -3.3 804.0095 3 34.83 10 F10:19694 NaNaKA16_F6.raw 1.5737E60 1 0001000000000 165 183 Carbamidomethylation C1:Carbamidomethylation:1000.00;C2:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAA74930.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PTTDK.T Y 47.27 1507.6647 14 8.1 754.8457 2 23.07 9 F9:10080 NaNaKA16_F5.raw 8.4235E5 1 0000000010000 60 73 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026544110.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.YIMHPDYSVFNPTENDIVLIK.L Y 60.56 2507.2407 21 1.3 836.7553 3 77.64 4 F4:52998 NaNaKA16_F12.raw 1.4523E7 1 0001000000000 378 398 PEAKS DB
R.SPDEDEQPWC(+57.02)YFIK.D N 53.69 1812.7665 14 0.0 907.3905 2 80.04 2 F2:54723 NaNaKA16_F10.raw 2.0014E6 1 0100000000000 235 248 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
P0DI84.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HVVVVGAGMSGLSAAYVLAGAGHK.V Y 65.98 2250.1943 24 0.0 563.5558 4 52.57 2 F2:30863 NaNaKA16_F10.raw 1.7954E6 1 0100000000000 33 56 PEAKS DB
total 1 peptides
3KVE
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.HVVVVGAGMSGLSAAYVLAGAGHK.V Y 65.98 2250.1943 24 0.0 563.5558 4 52.57 2 F2:30863 NaNaKA16_F10.raw 1.7954E6 1 0100000000000 35 58 PEAKS DB
total 1 peptides
JAA75029.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SALDYMDYGC(+57.02)YC(+57.02)GKGDSGTPVDDLDR.C Y 48.14 2929.1841 26 -1.3 1465.5974 2 104.51 13 F13:74071 NaNaKA16_F9.raw 1.751E6 1 0000000000001 45 70 Carbamidomethylation C10:Carbamidomethylation:1000.00;C12:Carbamidomethylation:1000.00 PEAKS DB
D.SGTPVDDLDR.C N 45.52 1073.4989 10 0.9 537.7572 2 20.23 11 F11:7497 NaNaKA16_F7.raw 1.1072E7 1 0000000000100 61 70 PEAKS DB
total 2 peptides
ADI47614.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VTLDLFGEWR.Q N 61.73 1234.6346 10 0.5 618.3249 2 82.47 11 F11:57626 NaNaKA16_F7.raw 1.9987E54.7038E5 2 0000000000110 166 175 PEAKS DB
R.LYC(+57.02)FDNLPEHK.N Y 44.50 1434.6602 11 0.7 479.2277 3 34.30 10 F10:19382 NaNaKA16_F6.raw 1.1234E6 1 0000000001000 460 470 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
P0DMT2.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SPFPSYTSYGC(+57.02)FC(+57.02)GGGER.G Y 83.46 2027.8142 18 0.0 1014.9144 2 56.41 12 F12:36093 NaNaKA16_F8.raw 1.7369E61.2456E7 2 0000000000110 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
3BJW
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SPFPSYTSYGC(+57.02)FC(+57.02)GGGER.G Y 83.46 2027.8142 18 0.0 1014.9144 2 56.41 12 F12:36093 NaNaKA16_F8.raw 1.7369E61.2456E7 2 0000000000110 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
2QHD
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SPFPSYTSYGC(+57.02)FC(+57.02)GGGER.G Y 83.46 2027.8142 18 0.0 1014.9144 2 56.41 12 F12:36093 NaNaKA16_F8.raw 1.7369E61.2456E7 2 0000000000110 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P48650.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SPFPSYTSYGC(+57.02)FC(+57.02)GGGER.G Y 83.46 2027.8142 18 0.0 1014.9144 2 56.41 12 F12:36093 NaNaKA16_F8.raw 1.7369E61.2456E7 2 0000000000110 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
2QHE
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SPFPSYTSYGC(+57.02)FC(+57.02)GGGER.G Y 83.46 2027.8142 18 0.0 1014.9144 2 56.41 12 F12:36093 NaNaKA16_F8.raw 1.7369E61.2456E7 2 0000000000110 16 33 Carbamidomethylation C11:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026571379.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WNLPSPEC(+57.02)K.K Y 59.14 1129.5226 9 0.7 565.7690 2 39.67 4 F4:21853 NaNaKA16_F12.raw 1.8284E61.4947E77.0028E64.4868E6 4 0111000000001 209 217 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
S.DC(+57.02)PRPVLPPHSSLR.G Y 47.89 1629.8409 14 1.0 544.2881 3 11.80 3 F3:2167 NaNaKA16_F11.raw 5.4229E5 1 0010000000000 27 40 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
XP_032085287.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NLLQFSNMIK.C N 56.92 1206.6431 10 0.5 604.3291 2 65.68 2 F2:42174 NaNaKA16_F10.raw 8.2085E61.7232E6 2 0110000000000 28 37 PEAKS DB
R.SAAIC(+57.02)FAGAPYNEEYKK.L Y 50.34 1917.8931 17 0.3 640.3052 3 34.35 2 F2:16469 NaNaKA16_F10.raw 1.8111E6 1 0100000000000 128 144 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
JAG46496.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.WMEDSDVEDLRK.E Y 58.39 1521.6769 12 0.3 508.2330 3 33.02 4 F4:16009 NaNaKA16_F12.raw 2.3013E6 1 0001000000000 237 248 PEAKS DB
K.LMATNDIYEAK.A N 47.30 1267.6118 11 0.5 634.8135 2 29.68 4 F4:13304 NaNaKA16_F12.raw 1.2791E6 1 0001000000000 319 329 PEAKS DB
total 2 peptides
ACD43466.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
P31100.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
CAA48457.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
S29299
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AAZ53184.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
ACD43468.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
G.NLFQFGEMILEK.T Y 58.42 1467.7432 12 0.9 734.8795 2 93.40 4 F4:65640 NaNaKA16_F12.raw 1.3999E6 1 0001000000000 17 28 PEAKS DB
R.AAAIC(+57.02)LGQNVNTYDK.N Y 46.79 1636.7878 15 1.1 819.4021 2 36.24 4 F4:18606 NaNaKA16_F12.raw 1.3298E6 1 0001000000000 107 121 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AXL95289.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
S.VSPTASNM(+15.99)LK.M N 56.73 1062.5380 10 0.7 532.2766 2 11.45 4 F4:1800 NaNaKA16_F12.raw 1.2798E7 1 0001000000000 47 56 Oxidation (M) M8:Oxidation (M):1000.00 PEAKS DB
S.VSPTASNMLK.M N 54.02 1046.5430 10 -0.7 524.2784 2 11.74 4 F4:2287 NaNaKA16_F12.raw 1.7067E8 2 0002000000000 47 56 PEAKS DB
Q.QSNC(+57.02)QDDWIK.S Y 50.04 1292.5455 10 -0.2 647.2799 2 44.84 4 F4:26184 NaNaKA16_F12.raw 2.2338E8 3 0003000000000 216 225 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 3 peptides
XP_034262239.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LEDEEEMNAELTAK.K Y 52.69 1620.7189 14 0.6 811.3672 2 34.79 1 F1:14100 NaNaKA16_F1.raw 4.3764E5 1 1000000000000 640 653 PEAKS DB
R.LEEAGGATSVQIEMNK.K Y 49.97 1675.8087 16 1.0 838.9125 2 34.20 1 F1:13672 NaNaKA16_F1.raw 1.2438E6 1 1000000000000 864 879 PEAKS DB
total 2 peptides
XP_032092515.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LEDEEEMNAELTAK.K Y 52.69 1620.7189 14 0.6 811.3672 2 34.79 1 F1:14100 NaNaKA16_F1.raw 4.3764E5 1 1000000000000 929 942 PEAKS DB
R.LEEAGGATSVQIEMNK.K Y 49.97 1675.8087 16 1.0 838.9125 2 34.20 1 F1:13672 NaNaKA16_F1.raw 1.2438E6 1 1000000000000 1153 1168 PEAKS DB
total 2 peptides
XP_026538839.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LEDEEEMNAELTAK.K Y 52.69 1620.7189 14 0.6 811.3672 2 34.79 1 F1:14100 NaNaKA16_F1.raw 4.3764E5 1 1000000000000 929 942 PEAKS DB
R.LEEAGGATSVQIEMNK.K Y 49.97 1675.8087 16 1.0 838.9125 2 34.20 1 F1:13672 NaNaKA16_F1.raw 1.2438E6 1 1000000000000 1153 1168 PEAKS DB
total 2 peptides
XP_015677713.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LEDEEEMNAELTAK.K Y 52.69 1620.7189 14 0.6 811.3672 2 34.79 1 F1:14100 NaNaKA16_F1.raw 4.3764E5 1 1000000000000 930 943 PEAKS DB
R.LEEAGGATSVQIEMNK.K Y 49.97 1675.8087 16 1.0 838.9125 2 34.20 1 F1:13672 NaNaKA16_F1.raw 1.2438E6 1 1000000000000 1154 1169 PEAKS DB
total 2 peptides
ETE67243.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGLDPTMAC(+57.02)QK.V Y 44.93 1232.5894 11 0.4 617.3022 2 34.45 4 F4:17128 NaNaKA16_F12.raw 1.6499E5 1 0001000000000 374 384 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032079951.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGLDPTMAC(+57.02)QK.V Y 44.93 1232.5894 11 0.4 617.3022 2 34.45 4 F4:17128 NaNaKA16_F12.raw 1.6499E5 1 0001000000000 285 295 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034298591.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGLDPTMAC(+57.02)QK.V Y 44.93 1232.5894 11 0.4 617.3022 2 34.45 4 F4:17128 NaNaKA16_F12.raw 1.6499E5 1 0001000000000 285 295 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026555457.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGLDPTMAC(+57.02)QK.V Y 44.93 1232.5894 11 0.4 617.3022 2 34.45 4 F4:17128 NaNaKA16_F12.raw 1.6499E5 1 0001000000000 285 295 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013912092.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LGLDPTMAC(+57.02)QK.V Y 44.93 1232.5894 11 0.4 617.3022 2 34.45 4 F4:17128 NaNaKA16_F12.raw 1.6499E5 1 0001000000000 16 26 Carbamidomethylation C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9YGJ6.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSETPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 51.33 2945.1863 26 6.0 982.7419 3 11.71 1 F1:2367 NaNaKA16_F1.raw 1.582E8 1 1000000000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
O57326.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSETPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 51.33 2945.1863 26 6.0 982.7419 3 11.71 1 F1:2367 NaNaKA16_F1.raw 1.582E8 1 1000000000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AAC69915.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSETPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 51.33 2945.1863 26 6.0 982.7419 3 11.71 1 F1:2367 NaNaKA16_F1.raw 1.582E8 1 1000000000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
AAD08812.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LEC(+57.02)HNQQSSETPTTTGC(+57.02)SGGETNC(+57.02)YK.K Y 51.33 2945.1863 26 6.0 982.7419 3 11.71 1 F1:2367 NaNaKA16_F1.raw 1.582E8 1 1000000000000 22 47 Carbamidomethylation C3:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00;C24:Carbamidomethylation:1000.00 PEAKS DB
K.GIEINC(+57.02)C(+57.02)TTDR.C N 48.70 1337.5704 11 -0.5 669.7922 2 18.63 6 F6:6296 NaNaKA16_F2.raw 4.8926E5 1 0000010000000 70 80 Carbamidomethylation C6:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 2 peptides
Q53B55.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PIVK.P Y 44.43 1402.6948 13 0.5 702.3550 2 39.33 9 F9:22998 NaNaKA16_F5.raw 2.7231E6 1 0000000010000 62 74 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAT97253.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PIVK.P Y 44.43 1402.6948 13 0.5 702.3550 2 39.33 9 F9:22998 NaNaKA16_F5.raw 2.7231E6 1 0000000010000 62 74 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P01387.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PIVK.P Y 44.43 1402.6948 13 0.5 702.3550 2 39.33 9 F9:22998 NaNaKA16_F5.raw 2.7231E6 1 0000000010000 38 50 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q53B53.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PIVK.P Y 44.43 1402.6948 13 0.5 702.3550 2 39.33 9 F9:22998 NaNaKA16_F5.raw 2.7231E6 1 0000000010000 58 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAT97255.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.VDLGC(+57.02)AATC(+57.02)PIVK.P Y 44.43 1402.6948 13 0.5 702.3550 2 39.33 9 F9:22998 NaNaKA16_F5.raw 2.7231E6 1 0000000010000 58 70 Carbamidomethylation C5:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAZ39881.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SHDNALLFTDMR.F Y 53.98 1418.6613 12 0.4 473.8945 3 41.71 4 F4:23364 NaNaKA16_F12.raw 7.5878E4 1 0001000000000 282 293 PEAKS DB
total 1 peptides
AAB22477.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SHDNALLFTDMR.F Y 53.98 1418.6613 12 0.4 473.8945 3 41.71 4 F4:23364 NaNaKA16_F12.raw 7.5878E4 1 0001000000000 94 105 PEAKS DB
total 1 peptides
CAL69604.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
A8Y7N6.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AFD04724.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAL69605.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
A8Y7N7.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ABD24042.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q2ES48.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FC(+57.02)YLPADPGEC(+57.02)MAYIR.S Y 57.54 1961.8474 16 5.8 981.9314 2 72.26 8 F8:48595 NaNaKA16_F4.raw 1.1621E6 1 0000000100000 30 45 Carbamidomethylation C2:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084681.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DDC(+57.02)DFPELC(+57.02)TGR.S Y 55.95 1483.5708 12 0.7 742.7932 2 50.53 10 F10:33305 NaNaKA16_F6.raw 6.4023E52.2329E7 2 0000100001000 473 484 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013922279.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DDC(+57.02)DFPELC(+57.02)TGR.S Y 55.95 1483.5708 12 0.7 742.7932 2 50.53 10 F10:33305 NaNaKA16_F6.raw 6.4023E52.2329E7 2 0000100001000 25 36 Carbamidomethylation C3:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P25679.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 1 13 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P60814.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA06888.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
2MJ0
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
M.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 2 14 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
P82935.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA04578.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAL87467.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
O42255.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAB87415.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAB87416.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
O42256.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
CAA10530.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9YGI4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAL87466.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAD39353.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q802B3.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAD39354.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9W7I3.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
AAL87465.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
T.LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 22 34 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
C0HJW9.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
LTC(+57.02)LNC(+57.02)PEMFC(+57.02)GK.F Y 71.90 1628.6819 13 0.7 815.3488 2 46.10 10 F10:29493 NaNaKA16_F6.raw 1.8887E7 1 0000000001000 1 13 Carbamidomethylation C3:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00;C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
E5L0E4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TSTYIAPLSLPSSPPR.V Y 71.71 1685.8988 16 0.9 843.9575 2 59.90 2 F2:37072 NaNaKA16_F10.raw 3.9103E63.6573E61.9316E6 4 0121000000000 120 135 PEAKS DB
total 1 peptides
ADP88560.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TSTYIAPLSLPSSPPR.V Y 71.71 1685.8988 16 0.9 843.9575 2 59.90 2 F2:37072 NaNaKA16_F10.raw 3.9103E63.6573E61.9316E6 4 0121000000000 120 135 PEAKS DB
total 1 peptides
ETE73990.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.R Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 499 511 PEAKS DB
total 1 peptides
XP_032078632.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.G Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_013911097.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.G Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_013911096.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.G Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_013911098.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.G Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_026526159.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.R Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_026526158.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.R Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
XP_026526157.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LNPDTLIGQVNLK.R Y 71.44 1423.8035 13 0.8 712.9095 2 62.87 2 F2:39695 NaNaKA16_F10.raw 7.3137E64.6581E6 2 0100000000001 46 58 PEAKS DB
total 1 peptides
ETE67110.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.MHLETILQELK.A Y 70.63 1353.7327 11 0.8 677.8741 2 62.78 3 F3:38731 NaNaKA16_F11.raw 1.0165E61.4658E6 4 0220000000000 74 84 PEAKS DB
total 1 peptides
JAB53705.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FHLGTPVASTQFVTK.D Y 47.35 1631.8671 15 1.0 544.9635 3 44.16 4 F4:25169 NaNaKA16_F12.raw 1.0968E6 1 0001000000000 184 198 PEAKS DB
K.YVLLMVDPDAPSR.S Y 46.37 1474.7490 13 0.1 738.3818 2 65.12 4 F4:42632 NaNaKA16_F12.raw 4.9917E5 1 0001000000000 89 101 PEAKS DB
total 2 peptides
XP_026539772.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FHLGTPVASTQFVTK.D Y 47.35 1631.8671 15 1.0 544.9635 3 44.16 4 F4:25169 NaNaKA16_F12.raw 1.0968E6 1 0001000000000 184 198 PEAKS DB
K.YVLIMVDPDAPSR.S Y 46.37 1474.7490 13 0.1 738.3818 2 65.12 4 F4:42632 NaNaKA16_F12.raw 4.9917E5 1 0001000000000 89 101 PEAKS DB
total 2 peptides
XP_026539773.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FHLGTPVASTQFVTK.D Y 47.35 1631.8671 15 1.0 544.9635 3 44.16 4 F4:25169 NaNaKA16_F12.raw 1.0968E6 1 0001000000000 184 198 PEAKS DB
K.YVLIMVDPDAPSR.S Y 46.37 1474.7490 13 0.1 738.3818 2 65.12 4 F4:42632 NaNaKA16_F12.raw 4.9917E5 1 0001000000000 89 101 PEAKS DB
total 2 peptides
XP_026570986.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FHLGTPVASTQFVTK.D Y 47.35 1631.8671 15 1.0 544.9635 3 44.16 4 F4:25169 NaNaKA16_F12.raw 1.0968E6 1 0001000000000 184 198 PEAKS DB
K.YVLIMVDPDAPSR.S Y 46.37 1474.7490 13 0.1 738.3818 2 65.12 4 F4:42632 NaNaKA16_F12.raw 4.9917E5 1 0001000000000 89 101 PEAKS DB
total 2 peptides
XP_026570987.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.FHLGTPVASTQFVTK.D Y 47.35 1631.8671 15 1.0 544.9635 3 44.16 4 F4:25169 NaNaKA16_F12.raw 1.0968E6 1 0001000000000 184 198 PEAKS DB
K.YVLIMVDPDAPSR.S Y 46.37 1474.7490 13 0.1 738.3818 2 65.12 4 F4:42632 NaNaKA16_F12.raw 4.9917E5 1 0001000000000 89 101 PEAKS DB
total 2 peptides
JAC94989.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.QNSGTYNNQYMILDTK.K N 46.65 1888.8625 16 -0.1 945.4385 2 44.83 5 F5:18100 NaNaKA16_F13.raw 7.159E5 1 0000100000000 351 366 PEAKS DB
K.QVVPESLLAWER.V Y 45.42 1425.7616 12 0.0 713.8881 2 101.54 5 F5:38599 NaNaKA16_F13.raw 1.7683E4 1 0000100000000 319 330 PEAKS DB
total 2 peptides
JAB52813.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.DYGC(+57.02)YC(+57.02)GFGGSGTPVDQLDR.C Y 69.00 2222.8997 20 1.0 1112.4583 2 63.32 2 F2:40217 NaNaKA16_F10.raw 2.1439E61.8341E6 2 0100000000001 49 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAI09045.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.DYGC(+57.02)YC(+57.02)GFGGSGTPVDQLDR.C Y 69.00 2222.8997 20 1.0 1112.4583 2 63.32 2 F2:40217 NaNaKA16_F10.raw 2.1439E61.8341E6 2 0100000000001 49 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05034.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.DYGC(+57.02)YC(+57.02)GFGGSGTPVDQLDR.C Y 69.00 2222.8997 20 1.0 1112.4583 2 63.32 2 F2:40217 NaNaKA16_F10.raw 2.1439E61.8341E6 2 0100000000001 49 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAS05141.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.DYGC(+57.02)YC(+57.02)GFGGSGTPVDQLDR.C Y 69.00 2222.8997 20 1.0 1112.4583 2 63.32 2 F2:40217 NaNaKA16_F10.raw 2.1439E61.8341E6 2 0100000000001 49 68 Carbamidomethylation C4:Carbamidomethylation:1000.00;C6:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026558006.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GSSPNC(+57.02)YHFYFPAQETC(+57.02)PVKPALGLITYR.I Y 68.99 3372.6060 29 1.5 844.1600 4 69.38 2 F2:45476 NaNaKA16_F10.raw 9.5542E6 1 0100000000000 89 117 Carbamidomethylation C6:Carbamidomethylation:1000.00;C17:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084613.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084612.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084615.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084614.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026534403.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026534402.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026564759.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026564758.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026534405.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026534404.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026564761.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026564760.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 56 68 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA59850.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
F.AVAEPQIAMFC(+57.02)GK.L Y 51.18 1420.6842 13 -9.2 711.3428 2 51.26 2 F2:29587 NaNaKA16_F10.raw 0 0 0000000000000 30 42 Carbamidomethylation C11:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE57873.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
A.QVTQSGPVSVAIAGR.T Y 67.63 1468.7998 15 0.4 735.4075 2 59.76 4 F4:38474 NaNaKA16_F12.raw 8.0605E5 1 0001000000000 33 47 PEAKS DB
total 1 peptides
E3P6P4.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.YYLMMELVK.T Y 65.98 1188.5923 9 3.8 595.3057 2 71.44 2 F2:47172 NaNaKA16_F10.raw 1.0741E85.9073E58.0349E5 3 0110000000001 80 88 PEAKS DB
K.YYLMM(+15.99)ELVK.T Y 58.06 1204.5872 9 0.1 603.3009 2 71.52 2 F2:47461 NaNaKA16_F10.raw 6.0185E6 1 0100000000000 80 88 Oxidation (M) M5:Oxidation (M):33.98 PEAKS DB
K.YYLM(+15.99)MELVK.T Y 45.07 1204.5872 9 0.1 603.3009 2 71.52 2 F2:47228 NaNaKA16_F10.raw 6.0185E69.6788E5 2 0100000000001 80 88 Oxidation (M) M4:Oxidation (M):21.94 PEAKS DB
total 3 peptides
ACR83850.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.YYLMMELVK.T Y 65.98 1188.5923 9 3.8 595.3057 2 71.44 2 F2:47172 NaNaKA16_F10.raw 1.0741E85.9073E58.0349E5 3 0110000000001 80 88 PEAKS DB
K.YYLMM(+15.99)ELVK.T Y 58.06 1204.5872 9 0.1 603.3009 2 71.52 2 F2:47461 NaNaKA16_F10.raw 6.0185E6 1 0100000000000 80 88 Oxidation (M) M5:Oxidation (M):33.98 PEAKS DB
K.YYLM(+15.99)MELVK.T Y 45.07 1204.5872 9 0.1 603.3009 2 71.52 2 F2:47228 NaNaKA16_F10.raw 6.0185E69.6788E5 2 0100000000001 80 88 Oxidation (M) M4:Oxidation (M):21.94 PEAKS DB
total 3 peptides
JAS03127.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SC(+57.02)EPFIYHGC(+57.02)PGNR.N Y 64.42 1692.7136 14 0.3 565.2453 3 20.59 10 F10:7927 NaNaKA16_F6.raw 1.7968E7 1 0000000001000 48 61 Carbamidomethylation C2:Carbamidomethylation:1000.00;C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
S68801
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
L.ETQLLLGVVK.D Y 44.12 1098.6648 10 1.3 550.3404 2 54.20 4 F4:33688 NaNaKA16_F12.raw 2.7542E5 1 0001000000000 56 65 PEAKS DB
total 1 peptides
XP_026524106.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LITMEEFIR.S Y 46.77 1150.6056 9 0.4 576.3103 2 67.32 4 F4:44606 NaNaKA16_F12.raw 6.5993E56.3396E5 2 0011000000000 319 327 PEAKS DB
total 1 peptides
XP_026562300.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LITMEEFIR.S Y 46.77 1150.6056 9 0.4 576.3103 2 67.32 4 F4:44606 NaNaKA16_F12.raw 6.5993E56.3396E5 2 0011000000000 319 327 PEAKS DB
total 1 peptides
XP_026562299.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LITMEEFIR.S Y 46.77 1150.6056 9 0.4 576.3103 2 67.32 4 F4:44606 NaNaKA16_F12.raw 6.5993E56.3396E5 2 0011000000000 319 327 PEAKS DB
total 1 peptides
XP_034262406.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.P Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 73 82 PEAKS DB
total 1 peptides
XP_015678953.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Q.SSDNDFLIFK.S Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
JAG66558.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.T Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
XP_026545516.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.D Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
ETE56526.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.N Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 52 61 PEAKS DB
total 1 peptides
XP_034261801.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.E Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
XP_026572193.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.D Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
XP_015678948.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SSDNDFLIFK.D Y 62.29 1184.5713 10 0.1 593.2930 2 64.20 4 F4:42212 NaNaKA16_F12.raw 1.462E7 1 0001000000000 75 84 PEAKS DB
total 1 peptides
XP_015680851.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LTC(+57.02)NFQVWSR.P Y 61.93 1309.6238 10 -1.1 655.8184 2 47.95 2 F2:27930 NaNaKA16_F10.raw 1.9911E7 1 0100000000000 116 125 Carbamidomethylation C3:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026553567.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.KNQLLHWQAVGNPR.C Y 44.56 1659.8958 14 0.0 554.3058 3 20.07 9 F9:7331 NaNaKA16_F5.raw 5.4621E5 1 0000000010000 229 242 PEAKS DB
total 1 peptides
XP_013928420.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SIGLDITVNC(+57.02)QTLTSK.C Y 60.77 1748.8978 16 0.9 875.4570 2 60.29 6 F6:40580 NaNaKA16_F2.raw 7.5948E5 1 0000010000000 49 64 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE70163.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.SIGLDITVNC(+57.02)QTLTSK.C Y 60.77 1748.8978 16 0.9 875.4570 2 60.29 6 F6:40580 NaNaKA16_F2.raw 7.5948E5 1 0000010000000 49 64 Carbamidomethylation C10:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032073624.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VTFGC(+57.02)DYGFR.I Y 60.71 1220.5284 10 0.2 611.2716 2 46.60 3 F3:26349 NaNaKA16_F11.raw 1.2432E78.5152E73.2948E6 3 0111000000000 117 126 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032073625.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VTFGC(+57.02)DYGFR.I Y 60.71 1220.5284 10 0.2 611.2716 2 46.60 3 F3:26349 NaNaKA16_F11.raw 1.2432E78.5152E73.2948E6 3 0111000000000 117 126 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032073626.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VTFGC(+57.02)DYGFR.I Y 60.71 1220.5284 10 0.2 611.2716 2 46.60 3 F3:26349 NaNaKA16_F11.raw 1.2432E78.5152E73.2948E6 3 0111000000000 117 126 Carbamidomethylation C5:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE72142.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VGIKPGSTYYQLTAIK.E Y 42.50 1737.9664 16 -0.1 580.3293 3 43.57 4 F4:24771 NaNaKA16_F12.raw 0 0 0000000000000 103 118 PEAKS DB
total 1 peptides
LAB36464.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.RPLHLHNQELSFLVHTWDLEGR.K Y 59.68 2696.3936 22 0.4 675.1060 4 64.77 12 F12:43187 NaNaKA16_F8.raw 2.7719E6 1 0000000000010 89 110 PEAKS DB
total 1 peptides
XP_015686076.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.SYGLFSYATR.S Y 59.64 1163.5610 10 0.4 582.7880 2 52.44 4 F4:32236 NaNaKA16_F12.raw 1.2509E7 1 0001000000000 43 52 PEAKS DB
total 1 peptides
XP_034262785.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 976 989 PEAKS DB
total 1 peptides
LAB27223.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 975 988 PEAKS DB
total 1 peptides
XP_026537394.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 961 974 PEAKS DB
total 1 peptides
XP_026537257.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 961 974 PEAKS DB
total 1 peptides
XP_026552070.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 961 974 PEAKS DB
total 1 peptides
LAB59085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 310 323 PEAKS DB
total 1 peptides
LAB59082.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 450 463 PEAKS DB
total 1 peptides
LAA55510.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 469 482 PEAKS DB
total 1 peptides
LAB59086.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LDPAHIELSPMQIR.T Y 58.50 1618.8501 14 0.5 540.6243 3 56.64 3 F3:33454 NaNaKA16_F11.raw 1.4943E68.1117E5 3 0210000000000 305 318 PEAKS DB
total 1 peptides
ADI47719.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DLINVVSSSSDTLR.S Y 57.47 1504.7733 14 -0.3 753.3937 2 64.92 4 F4:42619 NaNaKA16_F12.raw 8.4323E5 1 0001000000000 85 98 PEAKS DB
total 1 peptides
ADI47718.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.DLINVVSSSSDTLR.S Y 57.47 1504.7733 14 -0.3 753.3937 2 64.92 4 F4:42619 NaNaKA16_F12.raw 8.4323E5 1 0001000000000 18 31 PEAKS DB
total 1 peptides
JAA95034.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TDEFQLHTNVNDGTEFGGSIYQK.V Y 57.46 2599.1826 23 0.6 867.4020 3 53.88 1 F1:20872 NaNaKA16_F1.raw 3.2728E6 1 1000000000000 175 197 PEAKS DB
total 1 peptides
XP_032066440.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TDEFQLHTNVNDGTEFGGSIYQK.V Y 57.46 2599.1826 23 0.6 867.4020 3 53.88 1 F1:20872 NaNaKA16_F1.raw 3.2728E6 1 1000000000000 217 239 PEAKS DB
total 1 peptides
XP_015680353.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032073085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 164 180 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAA97490.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAG45445.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034289001.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026520698.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA68286.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 185 201 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026553211.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 172 188 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032074969.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 174 190 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026553213.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 166 182 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034289002.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 152 168 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAB21704.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 105 121 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015685975.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 83 99 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA25473.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 150 166 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015679450.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 164 180 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026520697.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.FNQC(+57.02)GTC(+57.02)TTFGEC(+57.02)HVIK.N Y 54.64 2057.8757 17 -0.1 686.9658 3 25.86 4 F4:9996 NaNaKA16_F12.raw 5.9741E5 1 0001000000000 170 186 Carbamidomethylation C4:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00;C13:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA93895.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.LAELEEALQK.A Y 53.72 1142.6183 10 0.0 572.3164 2 38.98 4 F4:20941 NaNaKA16_F12.raw 1.1234E69.9306E53.8362E55.7822E5 4 0001110001000 68 77 PEAKS DB
total 1 peptides
AFJ50537.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
JAI12652.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
JAV50078.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
JAA96599.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
JAG44071.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
JAG46413.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.NVIIWGNHSSTQYPDVNHAK.V Y 53.67 2279.1084 20 0.7 760.7106 3 12.27 1 F1:2617 NaNaKA16_F1.raw 3.364E5 1 1000000000000 180 199 PEAKS DB
total 1 peptides
LAB38707.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 159 172 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAB61292.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 163 176 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026529938.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE65500.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 78 91 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA35956.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026556047.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAG68264.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032074982.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013913807.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034293020.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 77 90 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
JAC95858.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_007444773.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA35964.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015674483.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GLEC(+57.02)NFGASSTALK.G Y 53.63 1453.6871 14 -0.2 727.8507 2 36.19 10 F10:20628 NaNaKA16_F6.raw 2.8031E6 1 0000000001000 76 89 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE57293.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFLQYGYEGR.D Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 13 23 PEAKS DB
total 1 peptides
XP_015683643.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFLQYGYEGR.T Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 134 144 PEAKS DB
total 1 peptides
XP_032065690.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFIQYGYEGR.T Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 133 143 PEAKS DB
total 1 peptides
XP_032065704.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFIQYGYEGR.T Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 107 117 PEAKS DB
total 1 peptides
XP_032065705.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFIQYGYEGR.T Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 107 117 PEAKS DB
total 1 peptides
XP_032065706.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.GGFIQYGYEGR.T Y 53.44 1245.5778 11 0.4 623.7964 2 42.87 13 F13:22748 NaNaKA16_F9.raw 1.4409E64.0652E6 2 0100000000001 107 117 PEAKS DB
total 1 peptides
XP_034291155.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
P.PPGGNMTQSTSK.Q Y 53.27 1203.5554 12 -3.2 602.7800 2 52.78 7 F7:29948 NaNaKA16_F3.raw 8.9276E64.6145E68.6948E6 3 0000001110000 876 887 PEAKS DB
total 1 peptides
XP_026531535.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 408 420 PEAKS DB
total 1 peptides
XP_026531534.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 408 420 PEAKS DB
total 1 peptides
ETE74005.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 344 356 PEAKS DB
total 1 peptides
JAB54701.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 380 392 PEAKS DB
total 1 peptides
XP_026557565.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 408 420 PEAKS DB
total 1 peptides
LAB18462.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 416 428 PEAKS DB
total 1 peptides
XP_026557564.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 408 420 PEAKS DB
total 1 peptides
LAA60085.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 428 440 PEAKS DB
total 1 peptides
LAB18463.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 416 428 PEAKS DB
total 1 peptides
LAA60082.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 428 440 PEAKS DB
total 1 peptides
LAA19315.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 157 169 PEAKS DB
total 1 peptides
LAA19316.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.EGDLIMLLVPEAR.D Y 52.58 1454.7803 13 0.2 728.3976 2 93.56 4 F4:65889 NaNaKA16_F12.raw 8.0879E4 1 0001000000000 193 205 PEAKS DB
total 1 peptides
AAT91068.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
N.C(+57.02)EEPYPFVC(+57.02)K.V Y 51.75 1327.5576 10 0.0 664.7861 2 38.00 4 F4:20313 NaNaKA16_F12.raw 1.2405E6 1 0001000000000 144 153 Carbamidomethylation C1:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q696W1.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
N.C(+57.02)EEPYPFVC(+57.02)K.V Y 51.75 1327.5576 10 0.0 664.7861 2 38.00 4 F4:20313 NaNaKA16_F12.raw 1.2405E6 1 0001000000000 144 153 Carbamidomethylation C1:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ADJ67473.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.C(+57.02)EEPYPFVC(+57.02)K.V Y 51.75 1327.5576 10 0.0 664.7861 2 38.00 4 F4:20313 NaNaKA16_F12.raw 1.2405E6 1 0001000000000 144 153 Carbamidomethylation C1:Carbamidomethylation:1000.00;C9:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026572109.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VLIIGGGVAGLASAGAAK.S Y 49.86 1523.9034 18 0.0 762.9590 2 60.25 1 F1:23322 NaNaKA16_F1.raw 2.9152E5 1 1000000000000 227 244 PEAKS DB
total 1 peptides
XP_032070506.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.VLIIGGGVAGLASAGAAK.S Y 49.86 1523.9034 18 0.0 762.9590 2 60.25 1 F1:23322 NaNaKA16_F1.raw 2.9152E5 1 1000000000000 229 246 PEAKS DB
total 1 peptides
XP_034260774.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.EIDASWMR.D Y 49.84 1006.4542 8 -0.4 504.2342 2 41.14 4 F4:22801 NaNaKA16_F12.raw 3.2782E6 1 0001000000000 238 245 PEAKS DB
total 1 peptides
XP_034289344.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.LVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1002 1018 PEAKS DB
total 1 peptides
XP_013916282.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 816 832 PEAKS DB
total 1 peptides
XP_032094866.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1010 1026 PEAKS DB
total 1 peptides
XP_032094851.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1010 1026 PEAKS DB
total 1 peptides
XP_032094842.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1010 1026 PEAKS DB
total 1 peptides
XP_032094874.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1005 1021 PEAKS DB
total 1 peptides
XP_032094858.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IVSETPSTALVTWKPPR.A Y 48.34 1881.0360 17 0.6 628.0197 3 49.37 4 F4:29904 NaNaKA16_F12.raw 1.1177E5 1 0001000000000 1005 1021 PEAKS DB
total 1 peptides
XP_026542806.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 55 70 PEAKS DB
total 1 peptides
XP_026580482.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 19 34 PEAKS DB
total 1 peptides
XP_026580485.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 19 34 PEAKS DB
total 1 peptides
JAV49206.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
XP_015684492.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 68 83 PEAKS DB
total 1 peptides
JAI11473.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
XP_034284638.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
XP_034284637.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
XP_025025635.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 94 109 PEAKS DB
total 1 peptides
XP_007433335.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 94 109 PEAKS DB
total 1 peptides
JAB54287.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
JAG66604.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
XP_032085178.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 219 234 PEAKS DB
total 1 peptides
LAB57412.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 94 109 PEAKS DB
total 1 peptides
LAB57416.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 94 109 PEAKS DB
total 1 peptides
LAA36529.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.AMGVVVATGVNTEIGK.I Y 47.72 1544.8232 16 0.8 773.4195 2 46.75 1 F1:19054 NaNaKA16_F1.raw 1.7359E6 1 1000000000000 253 268 PEAKS DB
total 1 peptides
JAC94981.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.PWLDKMELTK.M Y 47.55 1259.6583 10 -0.2 420.8933 3 40.93 2 F2:21482 NaNaKA16_F10.raw 1.441E7 1 0100000000000 130 139 PEAKS DB
total 1 peptides
XP_015678946.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.YYTLLSR.A Y 46.46 914.4861 7 -0.2 458.2503 2 34.88 4 F4:17671 NaNaKA16_F12.raw 4.1362E6 1 0001000000000 61 67 PEAKS DB
total 1 peptides
XP_032064447.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_026537276.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_015670807.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_007421035.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_026552097.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_032064446.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_013928980.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_026537409.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
XP_015670805.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.QITVNDLPVGR.S Y 46.08 1210.6670 11 -0.3 606.3406 2 42.41 6 F6:26061 NaNaKA16_F2.raw 1.2045E5 1 0000010000000 140 150 PEAKS DB
total 1 peptides
AAG17443.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IC(+57.02)FAGAPYN.K Y 45.43 1011.4484 9 1.3 506.7321 2 51.41 9 F9:32713 NaNaKA16_F5.raw 2.7171E63.4765E7 2 0000000011000 131 139 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
Q9DF56.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.IC(+57.02)FAGAPYN.K Y 45.43 1011.4484 9 1.3 506.7321 2 51.41 9 F9:32713 NaNaKA16_F5.raw 2.7171E63.4765E7 2 0000000011000 131 139 Carbamidomethylation C2:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026558429.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TDMVDPIMVFVTK.S Y 45.05 1494.7462 13 0.6 748.3809 2 90.18 3 F3:61254 NaNaKA16_F11.raw 1.8019E5 1 0010000000000 123 135 PEAKS DB
total 1 peptides
JAB54031.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.TDMVDPIMVFVTK.S Y 45.05 1494.7462 13 0.6 748.3809 2 90.18 3 F3:61254 NaNaKA16_F11.raw 1.8019E5 1 0010000000000 123 135 PEAKS DB
total 1 peptides
XP_026544668.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.KGYSISPQASIMLGQ.D Y 44.91 1578.8075 15 0.9 790.4117 2 56.12 4 F4:35404 NaNaKA16_F12.raw 1.1359E6 1 0001000000000 184 198 PEAKS DB
total 1 peptides
JAA75006.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TWC(+57.02)DAHC(+57.02)GER.G Y 44.86 1290.4869 10 -3.0 646.2454 2 28.01 8 F8:12554 NaNaKA16_F4.raw 1.2644E8 2 0000000200000 45 54 Carbamidomethylation C3:Carbamidomethylation:1000.00;C7:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015666657.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KLENWVGVYTVK.D Y 44.69 1434.7871 12 0.6 718.4012 2 43.29 3 F3:23610 NaNaKA16_F11.raw 2.6513E5 1 0010000000000 153 164 PEAKS DB
total 1 peptides
ETE58174.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.KLENWVGVYTVK.D Y 44.69 1434.7871 12 0.6 718.4012 2 43.29 3 F3:23610 NaNaKA16_F11.raw 2.6513E5 1 0010000000000 141 152 PEAKS DB
total 1 peptides
XP_026544778.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 293 303 PEAKS DB
total 1 peptides
XP_013920173.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 293 303 PEAKS DB
total 1 peptides
XP_032086793.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 273 283 PEAKS DB
total 1 peptides
XP_034281500.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 293 303 PEAKS DB
total 1 peptides
XP_034281501.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 293 303 PEAKS DB
total 1 peptides
XP_026544777.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 293 303 PEAKS DB
total 1 peptides
XP_026570249.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 204 214 PEAKS DB
total 1 peptides
XP_026570250.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 204 214 PEAKS DB
total 1 peptides
LAA68381.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 18 28 PEAKS DB
total 1 peptides
XP_029139218.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 318 328 PEAKS DB
total 1 peptides
XP_025028950.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 297 307 PEAKS DB
total 1 peptides
XP_007438289.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.TESEILLATLK.M Y 44.50 1216.6914 11 0.1 609.3530 2 58.83 4 F4:37393 NaNaKA16_F12.raw 7.2941E5 1 0001000000000 297 307 PEAKS DB
total 1 peptides
XP_034279548.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 121 135 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_034279549.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 121 135 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_029140167.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 106 120 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026558172.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 171 185 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_007441538.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 121 135 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
ETE66347.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 1 15 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026535207.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 30 44 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_007441537.2
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 121 135 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084106.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 161 175 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032084105.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 161 175 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_013924423.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 33 47 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015685842.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
K.MDSC(+57.02)ETYLYWHSVAK.E Y 44.11 1888.8124 15 7.6 630.6129 3 46.26 8 F8:26387 NaNaKA16_F4.raw 0 0 0000000000000 122 136 Carbamidomethylation C4:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026519977.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
V.NSVTEPVTSK.N Y 42.97 1060.5400 10 8.5 531.2791 2 95.91 7 F7:66269 NaNaKA16_F3.raw 3.9466E5 1 0000001000000 322 331 PEAKS DB
total 1 peptides
XP_026519976.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
V.NSVTEPVTSK.N Y 42.97 1060.5400 10 8.5 531.2791 2 95.91 7 F7:66269 NaNaKA16_F3.raw 3.9466E5 1 0000001000000 322 331 PEAKS DB
total 1 peptides
XP_026519975.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
V.NSVTEPVTSK.N Y 42.97 1060.5400 10 8.5 531.2791 2 95.91 7 F7:66269 NaNaKA16_F3.raw 3.9466E5 1 0000001000000 322 331 PEAKS DB
total 1 peptides
XP_026519974.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
V.NSVTEPVTSK.N Y 42.97 1060.5400 10 8.5 531.2791 2 95.91 7 F7:66269 NaNaKA16_F3.raw 3.9466E5 1 0000001000000 322 331 PEAKS DB
total 1 peptides
QGC85377.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
M.NDNAQLLTGIDFDGK.T Y 42.88 1619.7791 15 0.7 810.8973 2 66.09 5 F5:27114 NaNaKA16_F13.raw 4.1894E5 1 0000100000000 168 182 PEAKS DB
total 1 peptides
XP_032078280.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 101 110 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032078278.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 101 110 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_032078279.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 101 110 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAB44273.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 101 110 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
LAA56518.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 109 118 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026570835.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 117 126 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_026532440.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
R.NQPQFQFC(+57.02)GK.K Y 42.65 1252.5659 10 0.5 627.2905 2 27.46 5 F5:9002 NaNaKA16_F13.raw 1.5541E6 1 0000100000000 117 126 Carbamidomethylation C8:Carbamidomethylation:1000.00 PEAKS DB
total 1 peptides
XP_015673175.1
back to list

| Protein Coverage | Supporting Peptides |
Protein Coverage:
Supporting Peptides:
Peptide Uniq -10lgP Mass Length ppm m/z z RT Fraction Scan Source File Area F1Area F10Area F11Area F12Area F13Area F2Area F3Area F4Area F5Area F6Area F7Area F8Area F9 #Feature #Feature F1#Feature F10#Feature F11#Feature F12#Feature F13#Feature F2#Feature F3#Feature F4#Feature F5#Feature F6#Feature F7#Feature F8#Feature F9 Start End PTM AScore Found By
Y.QTGKNVPLM(+15.99)YK.E Y 42.36 1293.6750 11 4.4 647.8477 2 75.94 3 F3:50078 NaNaKA16_F11.raw 2.6866E6 1 0010000000000 47 57 Oxidation (M) M9:Oxidation (M):1000.00 PEAKS DB
total 1 peptides
Peptide List


 


Prepared with PEAKS ™ (bioinfor.com)