Mutation of the Enterohemorrhagic Escherichia coli Core LPS Biosynthesis Enzyme RfaD Confers Hypersusceptibility to Host Intestinal Innate Immunity In vivo

Introduction

Enterohemorrhagic Escherichia coli (EHEC), the most recognized serotype of which is O157:H7, is a gram-negative foodborne pathogen which can cause diarrhea and other severe symptoms, like hemorrhagic colitis (HC), hemolytic-uremic syndrome (HUS) and acute renal failure in humans (Pennington, 2010). However, treatment of EHEC infection with antibiotics is not recommended because more EHEC virulence factors, such as Shiga toxins and endotoxins, may be released and exacerbate severe syndromes in patients (Pacheco and Sperandio, 2012; Freedman et al., 2016). Currently, only palliative care can be applied after EHEC infection. Therefore, the development of a novel therapeutic strategy for EHEC infection is urgently needed. Several virulence factors expressed by EHEC contribute to its pathogenicity (Nguyen and Sperandio, 2012). The Shiga toxins (Stxs) produced by EHEC are responsible for HUS and HC. The type III secretion system (T3SS) and effectors encoded by the locus of enterocyte effacement (LEE) pathogenicity island are required for formation of the attaching and effacing (A/E) lesions on host intestinal epithelium. Although many virulence factors and mechanisms of EHEC have been reported, therapeutic strategies targeting these specific virulence factors remain under investigation (Nguyen and Sperandio, 2012; Pacheco and Sperandio, 2012).

Lipopolysaccharides (LPS) are surface phosphorylated lipoglycans on the outer leaflet of the outer membrane in gram-negative bacteria (Raetz and Whitfield, 2002), including EHEC. E. coli LPS is a complex molecule that can be divided structurally into three parts (Figure 1A), lipid A, core oligosaccharides, and O-antigen polysaccharide chains (Raetz and Whitfield, 2002). The core oligosaccharide can be further divided into the inner and outer cores respectively. The inner core is composed of 3-deoxy-D-manno-oct-2-ulosonic acid (Kdo) and ADP-heptose residues, and the outer core provides the attachment site for the O-polysaccharide chain and is constructed of hexoses and 2-acetoamido-2-deoxy-hexoses. ADP-heptose is a crucial component of the LPS inner core, and it connects the outer part of LPS to Kdo between the Kdo₂-lipid A and O-antigen. Moreover, ADP-heptose is also required to maintain outer membrane integrity, restrict permeability and prevent attack by the complement system (Raetz and Whitfield, 2002; Chang et al., 2011). The E. coli chromosomal rfa, also known as gmh or waa, operons encode enzymes needed for the stepwise assembly of the major core oligosaccharides (Raetz and Whitfield, 2002). The biosynthetic pathway for the nucleotide-activated glycero-manno-heptose precursors of LPS has been characterized in E. coli (Figure 1B). It contains five catalytic steps that are required for generation of ADP-L-glycero-D-manno-heptose, a molecule essential for the first heptose and can be transferred to Kdo (Valvano et al., 2002). The rfaD gene, also named gmhD or waaD, encodes the ADP-L-glycero-D-manno-heptose-6-epimerase which catalyzes the conversion of ADP-D-glycero-D-manno-heptose to ADP-L-glycero-D-manno-heptose, the last step in the ADP-L-glycero-D- manno-heptose synthetic pathway. The biochemistry of this biosynthetic pathway in E. coli has long been characterized; however, targeting RfaD and the core LPS biosynthesis enzymes for the treatment of EHEC infection remains largely unexplored.

FIGURE 1

Figure 1. Lipopolysaccharide (LPS) structure and the core-lipid A biosynthetic pathway. (A) A graphic representation of the LPS structure of E. coli. LPS contains several conserved components: lipid A, inner core, outer core and O-antigen (Raetz and Whitfield, 2002). (B) Pathways for the biosynthesis of the LPS core lipid A (Raetz and Whitfield, 2002). The genes encode the catalytic enzymes for ADP-L-glycero-D-manno-heptose and core-lipid A biosynthesis are presented in rectangular boxes.

Many animal models have been developed to facilitate the study of EHEC pathogenesis. Such models have been used to explore differences in relative toxicity among different types of Stxs (Tesh et al., 1993), assess the protective capacity of novel therapeutic methods (Sheoran et al., 2005; Armstrong et al., 2006; Bentancor et al., 2009), and model the pathogenesis of HUS (Sauter et al., 2008). Here, we utilized the model organism Caenorhabditis elegans, which might encounter EHEC in its natural habitat, as a surrogate host to study EHEC infection (Kenney et al., 2005; Anderson et al., 2006; Chou et al., 2013). Several characteristics of C. elegans make it suitable for studying pathogen and host interactions, including its small size, rapid life cycle, ease of conducting forward, reverse and chemical genetic screens, and sharing of conserved innate immune pathways with humans (Irazoqui et al., 2010), which are invaluable for investigating infection. Of particular relevance, C. elegans intestinal cells share similar anatomic features with humans (McGhee, 2007), which makes it an attractive model for the study of intestinal pathogens, including EHEC. We have demonstrated that EHEC can colonize and induce characteristic A/E lesions in the intestine of C. elegans, and Shiga toxin 1 (Stx1) is also required for the full virulence of EHEC pathogenicity in C. elegans (Chou et al., 2013). All these facts suggest that EHEC exerts similar and conserved virulence mechanisms in C. elegans and humans.

Herein, we report that inactivation of the EHEC RfaD and other core LPS biosynthesis enzymes attenuated its toxicity to C. elegans. Moreover, deletion of the EHEC rfaD gene significantly reduced its intestinal colonization in animal hosts, including C. elegans and mouse in vivo, and increased its susceptibility to several antimicrobial peptides (AMPs) in vitro. Our results highlight the importance of RfaD and core LPS in host intestinal colonization and suggest targeting RfaD or the core LPS synthesis pathway in EHEC may provide as potential therapeutic strategies for EHEC infection.

Materials and Methods

Bacterial and C. elegans Strains

The bacterial strains and plasmids used for this study are listed in Tables S1, S2 respectively. The enterohemorrhagic E. coli O157:H7 clinical isolates, EDL933 and HER1266, were from the Bioresource Collection and Research Center (BCRC, Taiwan). The EHEC mutants were generated by the lambda Red recombinase system (Datsenko and Wanner, 2000) and described in the Supplementary Information. All EHE-related biohazardous wastes were disinfected and disposed according to the Biosafety Level 2 (BSL-2) regulation. The Bristol N2 is the wild-type Caenorhabditis elegans strain. The DA597 strain contains two mutations in the phm-2(ad597) allele and results in abnormal function of the pharynx (Avery, 1993). The GK454 strain with the mCherry::ACT-5 transgene was used to monitor the microvillar actin rearrangement (Sato et al., 2011; Chou et al., 2013). C. elegans strains were maintained on nematode growth medium (NGM) agar plates using the standard nonpathogenic E. coli strain OP50 and synchronized with alkaline hypochlorite solution as described (Brenner, 1974).

Survival Analysis

All survival assays were conducted as previously described (Chou et al., 2013). In brief, EHEC was cultured in Luria-Bertani (LB) broth overnight at 37°C. Thirty to fifty synchronized late L4 to young adult stage C. elegans animals were transferred to each NGM agar plate, which was spread with the 30 μl bacterial overnight cultures and kept at 20°C. Animals were monitored daily and transferred to fresh plates daily until no more progeny were produced. Animals that did not respond to gentle prodding by platinum wire and displayed no pharyngeal pumping were scored as dead. Survival was monitored over time until all animals had died. The experiment was performed independently three times with approximately 100 animals per EHEC strain each time. Survival analysis was performed using GraphPad Prism 5.0 (GraphPad Software, La Jolla, CA). The Mantel-Cox logrank test was used to assess statistical significance of difference in survival, and P < 0.05 were considered significant.

LPS Extraction and Visualization

Lipopolysaccharides of EHEC were prepared by a hot phenol–water method as described (Chang et al., 2011), resolved on 12% SDS–polyacrylamide gels and visualized by silver staining as described previously (Yan et al., 2000).

Bacterial Colonization

Experimental procedures were performed as described (Chou et al., 2013). For the Green fluorescent protein (GFP) image analysis, synchronized late L4 to young adult stage C. elegans animals (N2 or DA597) were fed with either GFP-labeled E. coli OP50, E. coli O157:H7 EDL933, EDL933:ΔrfaD or EDL933:ΔrfaD-prfaD bacteria for 1 day at 20°C and then transferred to non GFP-labeled E. coli OP50 bacterial plates for another 3 days. The infected animals were collected and mounted on glass slides with 2% agarose pads and anesthetized with 25 nM sodium azide (NaN₃). Colonization of the GFP-labeled bacteria in the animals was imaged by a Nikon Eclipse Ti inverted microscope system and quantified. For the colony forming unit (CFU) analysis, the infected animals were washed out from the plates, treated with 25 mM levamisole and washed in M9 medium 10 times. To eliminate the bacteria outsite of the animals, the infected animals were then treated with M9 buffer containing 25 mM levamisole, 100 μg/ml gentamicin, and 1mg/ml ampicillin for 1–2 h at room temperature. These antibiotics were eliminated by washing the worms in M9 buffer with 25 mM levamisole 3 times. Ten animals were picked randomly into 100 μl M9 buffer, pulverized for 1 minute using a sterile plastic pestle, and plated on LB agar containing ampicillin after serial dilution. The numbers of bacterial colonies were counted the next day and the colony forming unit (CFU) per animal was calculated.

Microvillar ACT-5 Cellular Localization

EHEC induces A/E lesion characterized by the effacement of intestinal microvilli and the rearrangement of actin cytoskeleton in the host intestinal cells. ACT-5 is the main actin isoform that constitutes the intestinal microvilli in C. elegans (MacQueen et al., 2005). To test whether EHEC induces intestinal microvillar actin rearrangement, we analyzed distribution of the mCherry-tagged ACT-5 in C. elegans as previously described (Chou et al., 2013). In brief, the GK454 animals, with the dkIs247(act-5p::mCherry::HA::act-5) transgene were fed with E. coli OP50, E. coli O157:H7 EDL933, EDL933 rfaD::Tn5, EDL933:ΔrfaD, or EDL933:ΔrfaD-prfaD for 4 days and the mislocalization of the mCherry::ACT-5 signals from the apical membrane to the cytoplasm of the intestinal cells (ectopic ACT-5 localization) was examined. The infected animals were paralyzed by the method described above and images were captured by Nikon C1-Si confocal microscope.

Serum Killing Assay

Experiments followed the procedures previously described (Wang et al., 2012). Briefly, Log-phase bacteria (~10⁵ CFU) were incubated in 100 μl of 10% normal human serum (NHS) or heat-inactivated normal human serum (HNHS) diluted in PBS at 37°C. Aliquots (10 μl) were collected after 60 min, and each sample was spread on to an LB agar plate. After culturing overnight, the bacterial numbers were counted. The survival ratios were calculated by the ratio of the bacterial counts to those of the originally inoculated.

In vivo and Ex vivo Imaging Analysis of EHEC Infected Mice

The experiments were approved by the Institutional Animal Care and Use Committee of National Cheng Kung University (NCKU) (Approval number 102-209 and 104-039), and all experiments were carried out in accordance with the approved guidelines and regulations. Experiments were conducted as described previously with slight modifications (Rhee et al., 2011). In brief, the 6-week-old C57BL/6 female mice were purchased and maintained at the Laboratory Animal Center of NCKU. Mice were supplied with drinking water containing streptomycin sulfate (5 g/L) for 24 h and then switched to regular water for another 24 h before infection. Bacteria transformed with pWF279 (luciferase expressing plasmid) were cultured overnight at 37°C in LB medium and diluted in 1:100 in LB medium for 2.5–3 h at 37°C. Bacteria then were centrifuged and washed with sterile normal saline twice and the bacterial concentration was adjusted to approximately 10⁹ CFU/100 μl in normal saline for mouse oral gavage with a 22 gage, ball-tipped feeding needle. The bacterial concentrations were confirmed by plating on LB agar plates. One hour after oral inoculations, the bioluminescent signals in infected mice were examined by Xenogen IVIS 200 imaging system under anesthesia by inhalation of 2.5% isoflurane with 1.5L/min oxygen. Two days post-infection, the bioluminescent signals in the mice were examined again. The mice were then euthanized by cervical dislocation by trained personnel and the entire intestines of infected mice were removed, positioned on a 9 cm Petri dish and imaged by IVIS ex vivo.

Susceptibility to Antimicrobial Peptides

LL-37 peptide ([LL-37, 37 aa]) was synthesized by MDBio, Taiwan. The purity (>97%) and molecular weight were confirmed by high performance liquid chromatography and mass spectroscopy. Polymyxin B (catalog number: P0972) and Colistin (catalog number: C4461) were purchased from Sigma-Aldrich. In order to test the susceptibility of EDL933 rfaD mutants to AMPs, including LL-37, Polymyxin B and Colistin, we measured the bacterial growth with different dosages of AMPs by the microtiter broth dilution method as described (Giacometti et al., 2000; Thwaite et al., 2006; Wiegand et al., 2008). In brief, 37°C overnight bacterial culture in cation-adjusted Mueller Hinton (MH) medium was diluted in 1:100 in MH medium and further cultured at 37°C for 2.5–3 h. The bacteria in the exponential phase were then adjusted to approximately 10⁴ CFU/100 μl by MH medium. Microtiter plates were prepared with serial concentrations of AMPs, ranging from 1.5625 to 100 μg/ml for LL-37 in MH broth. A suspension containing 100 μl of diluted bacteria (10⁴ CFU) was added to a well of a 96-well microtiter plate containing peptide, and then the plate was incubated at 37°C for 16 h. Bacterial growth was determined by measuring the absorbance at 595 nm with a Multiskan FC microplate photometer (Thermo Scientific), or by the OD-monitor (TAITEC, Japan). The bacterial CFU were confirmed by plating on the LB agar plates.

Data Analysis

All experiments were performed a minimum of three times independently. Statistical analysis between two values was compared with a paired t-test, and among three or more values of one independent variable was done with matched one-way ANOVA with Tukey's method and more than two independent variables by two-way ANOVA with the Bonferroni post test. All data analysis was performed using SPSS, ver 13.0 (SPSS, Chicago, IL). Statistical significance was set at P < 0.05.

Results

Disruptions of the rfaD and Core LPS Biosynthesis Genes Decrease Toxicity of EHEC O157:H7 to C. elegans

LPS has been reported to play important roles in the pathogenesis of many pathogenic bacteria, including EHEC (Miyashita et al., 2012). From a genetic screen for identification of attenuated EHEC mutants in C. elegans (unpublished results), we have identified an EHEC mutant strain YQ033 (EDL933 rfaD::Tn5) in which the rfaD gene was disrupted by a Tn5 transposon insertion in the EHEC O157:H7 strain EDL933. In order to confirm the notion that ablation of the rfaD gene attenuated the toxicity of EHEC, we generated an EDL933 isogenic mutant with rfaD deletion (EDL933:ΔrfaD) and tested the toxicity of the rfaD deletion mutant along with the Tn5 transposon mutant in C. elegans. As shown in Figure 2A, C. elegans N2 animals fed with EHEC O157:H7 strain EDL933 had significantly shorter life spans than if fed with E. coli strain OP50 (P < 0.001), the standard nonpathogenic food source for C. elegans. However, when fed with both EDL933:ΔrfaD (P < 0.001) and EDL933 rfaD::Tn5 (P < 0.001), C. elegans N2 animals lived significantly longer than animals fed with wild-type EDL933. These results suggest that disruption of the core LPS biosynthesis genes, including rfaD, confer less virulence of EHEC toward C. elegans.

FIGURE 2

Figure 2. Disruptions of rfaD and the genes involved in EHEC core LPS biosynthesis confer attenuated toxicity. (A–D) Survival curves of N2 animals fed with E. coli strain OP50 (OP50), EHEC strain EDL933 (EDL933), and EDL933 with Tn5 transposon insertion in rfaD (EDL933 rfaD::Tn5), rfaD deletion (EDL933:ΔrfaD), rfaE deletion (EDL933:ΔrfaE) and rfaC deletion (EDL933:ΔrfaC), and EDL933:ΔrfaD with prfaD complementation (EDL933:ΔrfaD-prfaD) were examined. All survival experiments were conducted independently at least three times with approximately 100 animals each time. (A) Animals feeding on the EDL933 rfaD::Tn5 mutant plates (P < 0.001) and the EDL933:ΔrfaD plates (P < 0.001) lived significantly longer than animals feeding on the wild-type EDL933 plates. (B) N2 animals fed with EDL933:ΔrfaE (P < 0.001) lived significantly longer than animals fed with the wild-type EDL933, but were similar to those fed with EDL933:ΔrfaD (P = 0.100). (C) Animals feeding on EDL933:ΔrfaC plates (P < 0.001) lived significantly longer than animals feeding on the wild-type EDL933 plates, but were similar to those on EDL933:ΔrfaD (P = 0.938). (D) N2 animals fed with EDL933:ΔrfaD (P < 0.001) lived significantly longer than animals fed with EDL933 wild type. The survival curve of N2 animals fed with EDL933:ΔrfaD-prfaD was similar to that of wild-type EDL933 (P = 0.128). (E) Growth curves of wild-type EDL933 and rfaD mutants in LB broth at 37°C. Both the growth kinetic curves of EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD, were similar to wild-type EDL933. (F) The LPS samples of OP50, EDL933, EDL933 rfaD::Tn5, EDL933:ΔrfaD, and EDL933:ΔrfaD-prfaD was examined by silver staining. O-antigens are indicated by the black arrow.

In order to strengthen our hypothesis that altering the EHEC core LPS biosynthesis genes attenuated toxicity, we generated the EDL933 isogenic mutants with rfaE (also known as gmhC and encoding the upstream enzyme of RfaD in the core LPS synthesis pathway, Figure 1B) deletion (EDL933:ΔrfaE) or rfaC (which encodes the downstream enzyme of RfaD, Figure 1B) deletion (EDL933:ΔrfaC), and tested their virulence toward C. elegans (Figures 2B,C, respectively). N2 animals lived significantly longer feeding on EDL933:ΔrfaE plates (P < 0.001) and EDL933:ΔrfaC plates (P < 0.001) compared to those on the wild-type EDL933 plates. Moreover, the survival curve of N2 animals fed with EDL933:ΔrfaD was similar to that with EDL933:ΔrfaE or EDL933:ΔrfaC. Taken together, the data demonstrated that the EHEC core LPS is required for its toxicity in C. elegans.

In order to reconfirm the role of rfaD in EHEC virulence against C. elegans, we complemented the rfaD deletion in the EDL933:ΔrfaD mutant by transformation of the RfaD protein expression plasmid, prfaD. As a result, the survival curve of N2 animals fed with the prfaD complement strain, EDL933:ΔrfaD-prfaD, was significantly different from that of animals fed with EDL933:ΔrfaD (P < 0.001), and was similar to that of animals fed with wild-type EDL933 (P = 0.128) (Figure 2D). Our data demonstrated that the attenuated toxicity of the rfaD deletion mutant in C. elegans was completely rescued by the RfaD expression plasmid. An interpretation for the rfaD deletion in EDL933 resulting in the attenuation of its virulence is that disruption of RfaD and the core LPS biosynthesis affects the general physiology of EHEC, i.e., the growth of bacterial cells. In order to address this question, we directly analyzed the growth kinetic curves of wild-type EDL933, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD bacteria. As shown in Figure 2E, the growth kinetics of EDL933:ΔrfaD mutant exhibited no significant difference to that of wild-type EDL933 and EDL933:ΔrfaD-prfaD bacteria. Taken together, our results suggested that ablation of rfaD leading to attenuation of EHEC is due to an unidentified mechanism other than retardation of bacterial growth.

To examine whether disruption of the rfaD gene in EDL933 affects its LPS composition, we also isolated the LPS from OP50, EDL933, EDL933 rfaD::Tn5, EDL933:ΔrfaD, and EDL933:ΔrfaD-prfaD bacteria. These LPS samples were resolved and visualized (Figure 2F). EDL933 mutant strains with transposon insertion and deletion in the rfaD gene lacked the O-antigen, but the wild-type EDL933 and EDL933:ΔrfaD-prfaD bacteria contained intact O-antigen. These data reconfirmed that the LPS structures were altered in these EHEC rfaD mutants. Moreover, the nonpathogenic E. coli OP50 also lacked O-antigen, which was in agreement with a previous report (Darby, 2005). In order to examine the role of rfaD gene per se in the virulence of E. coli and to test whether C. elegans lives longer feeding on the rfaD mutant of nonpathogenic E. coli, we generated the OP50 isogenic mutant with rfaD deletion (OP50:ΔrfaD) and tested the virulence. N2 animals fed with OP50:ΔrfaD exhibited a similar survival curve to those fed with wild-type OP50 (P = 0.795) (Figure S1). Taking the above data together, our results indicated that the genes involved in core LPS biosynthesis of EHEC strain EDL933, especially rfaD, are required for EDL933 infection in C. elegans.

In order to test whether the role of rfaD in the virulence against C. elegans is general to E. coli O157:H7, we also generated rfaD mutant in a clinical E. coli O157:H7 isolated strain HER1266 (HER1266:ΔrfaD). As shown in Figure S2, C. elegans fed with HER1266:ΔrfaD exhibited a significantly longer life span (P < 0.001) compared to that fed with wild-type HER1266. Moreover, the prfaD complement strain (HER1266:ΔrfaD-pfraD) was significantly more toxic than the HER1266:ΔrfaD (P < 0.001) and showed no statistical difference compared to the wild-type HER1266 (P = 0.088). Collectively, our data corroborated the notion that deletion of the rfaD gene attenuates the toxicity of E. coli O157:H7 in C. elegans. Moreover, the other two LPS biosynthesis mutants, EDL933 waaI::Tn5 (waaI encodes the α-1,3-D-galactosyltransferase and acts downstream of RfaD in O-oligosaccharide biosynthesis) and EDL933 wbdP::Tn5 (wbdP encodes a putative glycosyltransferase in O-antigen biosynthesis) also exhibited significant attenuated toxicity toward C. elegans (Figure S3). All together, our results indicated that the genes involved in LPS biosynthesis, including rfaD, are required for EHEC infection in C. elegans.

Mutation in rfaD Confers Reduced Bacterial Colonization and Less Microvillar Actin Rearrangement in the Intestine of C. elegans

E. coli O157:H7 is an enteric pathogen, which can colonize in the gastrointestinal tract of humans. We have demonstrated that EDL933 colonizes in the intestine of C. elegans (Chou et al., 2013). Therefore, we next examined whether EDL933:ΔrfaD reduces its colonization in the intestine of C. elegans. N2 animals were fed with green fluorescent protein (GFP) labeled OP50, EDL933, EDL933:ΔrfaD or EDL933:ΔrfaD-prfaD for 1 day and transferred to normal non-GFP-labeled OP50 for another 3 days. As shown in Figures 3A–D, the N2 animals pulsed previously with GFP-labeled EDL933 and GFP-labeled EDL933:ΔrfaD-prfaD showed enhanced GFP signals in their intestinal tract after chasing with non-GFP-labeled OP50. However, GFP signals were not detectable in the alimentary tract of the animals fed with either GFP-labeled OP50 or GFP-labeled EDL933:ΔrfaD previously. N2 animals fed with wild-type EDL933 and EDL933:ΔrfaD-prfaD were smaller, paler and had an unhealthy apperance compared to animals fed with OP50 and EDL933:ΔrfaD. Moreover, the average colony formation units (CFU) of the animals pulsed with GFP-labeled EDL933:ΔrfaD or EDL933 rfaD::Tn5 for 1 day and then chased with non-GFP-labeled OP50 for 3 days were significantly reduced (P < 0.001) compared to that of the control GFP-labeled EDL933 fed animals (Figure 3E). The rfaD complementation group showed a significantly increased intestinal colonization phenotype compared to the rfaD mutants (EDL933:ΔrfaD and EDL933 rfaD::Tn5). These data demonstrated that mutations in rfaD reduce the intestinal colonization ability of EDL933 in C. elegans.

FIGURE 3

Figure 3. Mutation in rfaD reduces EDL933 colonization in C. elegans. Images of wild-type N2 nematodes fed with GFP-labeled OP50 (A), EDL933 (B), EDL933: ΔrfaD (C) or EDL933:ΔrfaD-prfaD (D) for 1 days at 20°C and then chased with non GFP-labeled OP50 for 3 days at 20°C, respectively. Animals previously exposed on GFP-labeled EDL933 and EDL933:ΔrfaD-prfaD plates showed significant GFP signals in their intestines. Animals fed with wild-type EDL933 and EDL933:ΔrfaD-prfaD exhibited unhealthy apperances with smaller and paler body compared to animals fed with OP50 and EDL933:ΔrfaD. Representative images are shown, and the scale bar represents 100 μm. (E) The number of bacteria colonized in C. elegans was determined by the colony forming units (CFU) assay. Values represent the means of three independent assays, and error bars indicate the standard deviations. P-values denote the results of statistical analysis. The total numbers of animals tested in each group are indicated by n.

EHEC induced host A/E (attaching and effacing) lesion in intestinal tract, which caused cytoskeleton actin rearrangement in host intestinal cells. Our previous report demonstrates that the transgenic C. elegans animals expressing mCherry-tagged ACT-5 can serve as a good model to monitor EHEC-induced microvillar actin rearrangement in intestinal cells (Chou et al., 2013). We examined the mCherry signals of the transgenic C. elegans animals fed with wild-type EDL933 and rfaD mutants by confocal microscopy. As shown in Figure 4A, the mCherry::ACT-5 animals fed with wild-type EDL933 for 4 days at 20°C exhibited significant ectopic mCherry::ACT-5 signals from apical plasma membrane to the cytoplasm. However, the mislocalozation of ACT-5 significantly decreased in the animals fed with the rfaD mutants (EDL933:ΔrfaD and EDL933 rfaD::Tn5) compared to that with wild-type EDL933. The transgenic animals fed with EDL933:ΔrfaD-prfaD showed a similar phenotype to that of wild-type EDL933. Quantifications of animals with the ectopic mCherry::ACT-5 signal after the exposure to wild-type EDL933 and rfaD mutants were also determined (Figure 4B). The data showed that the rfaD mutants are significantly less virulent to C. elegans animals in terms of the induction of A/E lesions. Taking the above data together, we demonstrated that the rfaD mutations confer attenuation of EHEC to C. elegans in vivo.

FIGURE 4

Figure 4. Mutations in rfaD reduce EHEC-induced intestinal microvillar actin rearrangement in C. elegans. (A) The confocal images showed the mCherry-tagged ACT-5 (intestinal microvillar actin) of GK454 transgenic animals fed with OP50, EDL933, EDL933 rfaD::Tn5 (rfaD::Tn5), EDL933:ΔrfaD (ΔrfaD) or EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD) for 4 days respectively. Ectopic localization of the mCherry::ACT-5 signals from the apical membrane to the cytoplasm of the intestinal cells were significantly increased in the EDL933 treated group. Upper panels show mCherry images; lower panels are the merge images of the DIC and mCherry signals. Representative images are shown, and scale bar represents 10 μm. (B) Quantifications of animals with the EHEC-induced ectopic mCherry::ACT-5 signal were determined. Values represent the means of three independent assays, and error bars indicate the standard deviations. P-values denote the results of statistical analysis.

Disruption of rfaD Reduces Bacterial Colonization in the Intestine of Mouse

We next tested whether deletion of the rfaD gene in EHEC also confers less intestinal colonization in mammals. To this end, we generated the bioluminescence-labeled wild-type EDL933, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD bacteria by transformation of the luciferase expressing plasmid, pWF279, and examined the bioluminescent signal by the non-invasive in vivo imaging system (IVIS) after oral gavage of approximately 10⁹ CFU bioluminescent bacteria into 6 week-old female C57BL/6 mice pretreated with streptomycin (Figure 5). The mice infected intragastrically with bioluminescence-labeled wild-type EDL933, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD exhibited similar bioluminescent signal levels 1 h post infection (Figures 5A,B). While, the mice infected with bioluminescence-labeled wild-type EDL933 and EDL933:ΔrfaD-prfaD revealed significant bioluminescent signals 2 days post infection However, the bioluminescent signals of mice infected with EDL933:ΔrfaD were significantly decreased after 2 days post infection (Figures 5C,D).

FIGURE 5

Figure 5. Disruption of rfaD reduces EDL933 colonization in the intestines of mice. (A) Represent images of mice inoculated with bioluminescence-labeled wild-type EHEC EDL933 (EDL933), EDL933:ΔrfaD (ΔrfaD), and EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD) 1 h post infection. (B) Quantification of bioluminescence intensity of mice infected with EDL933, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD 1 h post infection. (C) Represent images of mice inoculated with bioluminescence-labeled wild-type EHEC EDL933 (EDL933), EDL933:ΔrfaD (ΔrfaD), and EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD) 2 days post infection. (D) Quantification of bioluminescence intensity of mice infected with EDL933, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD 2 days post infection. (E) Represent images of intestinal tissues of mice infected with bioluminescence-labeled wild-type EHEC EDL933 (EDL933), EDL933:ΔrfaD (ΔrfaD), and EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD). (F) Quantification of bioluminescence signals of intestinal tissues of bioluminescent EHEC infected mice 2 days post infection. The color scale represents the radiance (p/sec/cm²/sr). Representative images are shown. All experiments were conducted independently three times with 3 animals each time, and error bars indicate the standard deviations.

Next, we determined the localization of these bioluminescence-labeled bacteria. The intestines of mice 2 days post infection were removed and imaged by IVIS ex vivo. As shown in Figure 5E, the bioluminescent signals of wild-type EDL933 and EDL933:ΔrfaD-prfaD bacteria were detected in the cecum and colon, which suggest that EHEC can colonize in the cecum and colon of mice for at least 2 days, while the bioluminescent signal was not detectable in the intestines of mice infected by EDL933:ΔrfaD. The quantification of bioluminescent signals showed similar results, i.e., the bioluminescent signals were significantly decreased in the EDL933:ΔrfaD treated mice compared to the wild-type EDL933 (P < 0.01) and EDL933:ΔrfaD-prfaD (P < 0.01) treated groups (Figure 5F). Taken together, these data demonstrated that the abolishment of functional rfaD reduces EDL933 colonization to the intestine, specifically in the cecum and colon, of mouse. Given that EHEC is considered less virulent to mouse when infected orally (Mohawk and O'Brien, 2011), our data also suggested that loss of core LPS in EHEC may increase its susceptibility to host intestinal immunity and therefore accelerate the elimination rate of bacterial cells from the host body.

Deletion of rfaD Increases the Susceptibility of EHEC to Human Serum Killing

One characteristic of EHEC virulence is its serum resistance. Several virulence factors encoded by EHEC, including the iss, traT, and stcE genes, which confer EHEC serum resistance have been documented (Binns et al., 1979, 1982; Lathem et al., 2004). Chain length of LPS has also been reported to affect serum resistance in Salmonella (Bravo et al., 2008). However, the correlation between E coli O157:H7 LPS and serum resistance remains poorly understood. To assess whether the LPS protects EHEC from serum killing, we monitored the survival rate of EHEC cells in the presence of human serum. The relative survival ratios of EDL933, EDL933 rfaD::Tn5, EDL933:ΔrfaD, and EDL933:ΔrfaD-prfaD in either 10% normal human serum (NHS) or 10% heat-inactivated normal human serum (HNHS) were measured. In HNHS, the complement system in normal serum was inactivated after the pre-incubation of NHS at 56°C for 30 min. As shown in Figure 6A, the wild-type EDL933 cells exhibited a significantly greater survival ratio compared to the rfaD transposon mutant (EDL933 rfaD::Tn5, P = 0.001) and rfaD deletion mutant (EDL933:ΔrfaD, P = 0.001) in 10% NHS at 37°C for 1 h. The wild-type EDL933 cells still replicated (1.94 fold increase) in 10% NHS, but the EDL933 rfaD::Tn5 and EDL933:ΔrfaD cells were killed in the presence of NHS (0.03 fold and 0.02 fold, respectively). The rfaD complement (EDL933:ΔrfaD-prfaD) cells rescued the serum resistance defect of the rfaD mutation and showed similar survival ratio (1.21 fold increase, P = 0.101) compared to wild-type EDL933 cells. Together, our data demonstrated that rfaD is required for EHEC serum resistance.

FIGURE 6

Figure 6. Deletion of EHEC rfaD increases its susceptibility to human serum killing and the antimicrobial peptide LL-37. The fold changes of bacterial cell numbers of wild-type EDL933, EDL933 rfaD::Tn5, EDL933:ΔrfaD and EDL933:ΔrfaD-prfaD after incubation in 10% normal human serum (NHS) (A) or 10% heat-inactivated normal human serum (HNHS) (B) at 37°C for 60 min were measured. Experiments were conducted independently at least three times, and error bars indicate the standard deviations. (A) The rfaD transposon mutant (rfaD::Tn5, P = 0.001) and rfaD deletion mutant (ΔrfaD, P = 0.001) showed significant decreased survival ratio compared to that of wild-type EDL933 (EDL933) in 10% NHS. The rfaD complement bacteria (ΔrfaD-prfaD) showed comparable survival ratio compared to that of EDL933 (P = 0.101) in 10% NHS. (B) The rfaD transposon mutant (rfaD::Tn5, P = 0.031) and rfaD deletion mutant (ΔrfaD, P = 0.034) showed significantly decreased survival ratio compared to that of wild-type EDL933 (EDL933) in 10% HNHS. The rfaD complement bacteria (ΔrfaD-prfaD) showed comparable survival ratio compared to that of EDL933 (P = 0.854) in 10% HNHS. n.s. indicates no statistical significance. (C) The OD₅₉₅ values of wild-type EDL933 (EDL933), EDL933 rfaD::Tn5 (rfaD::Tn5), EDL933:ΔrfaD (ΔrfaD), and EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD) cultured with different dose of LL-37 at 37°C for 16 h were monitored. (D) The growth curves of EDL933, rfaD::Tn5, ΔrfaD and ΔrfaD-prfaD in the presence of 12.5 μg/ml LL-37 at 37°C.

When these bacterial cells were cultured in 10% HNHS (Figure 6B), the wild-type EDL933 (1.90 fold increase) and EDL933:ΔrfaD-prfaD cells (1.99 fold increase) still replicated normally. The survival ratios of these two strains in 10% HNHS and 10% NHS were similar (EDL933, P = 0.937; EDL933:ΔrfaD-prfaD, P = 0.05), which supports the notion that EHEC is serum resistant. Moreover, both the rfaD transposon mutant and deletion mutant showed significantly greater ability to survive in 10% HNHS (0.82 fold and 0.94 fold, respectively) than in 10% NHS (0.03 fold and 0.02 fold, respectively). These data demonstrated that rfaD is required for the defense of the complement system in human serum. Interestingly, the survival ratios of the rfaD mutants (EDL933 rfaD::Tn5, P = 0.031 and EDL933:ΔrfaD, P = 0.034) were still significantly decreased compared to the wild-type EDL933 in 10% HNHS (Figure 6B). These data suggested that the rfaD mutants are still hypersusceptible to the complement-independent killing effect of normal human serum compared to wild-type EDL933.

Disruptions of rfaD Increase the Susceptibility of EHEC to AMPs In vitro

Antimicrobial peptides (AMPs) are short peptides that inhibit bacterial cell growth and constitute a host innate immune system against bacterial infection. AMPs target the bacterial membrane and disrupt the membrane integrity of bacteria cells, and the lack of the protection of LPS barrier leads AMPs to target the bacteria membrane more easily (Rosenfeld and Shai, 2006; Bahar and Ren, 2013). It has been reported that mammalian serum contains a variety of AMPs, including Cathelicidin, and still maintains antibiotic activity after 65°C treatment (Mahoney et al., 1995), which resembles the complement-independent innate immunity that inhibited the growth of rfaD mutants in the 56°C heat-inactivated human serum (Figure 6B). In order to test whether disruption of rfaD could alter the susceptibility of EHEC to AMPs, we cultured the wild-type EDL933 and rfaD mutants in the presence of LL-37, a short peptide with the bactericidal function derived from the Cathelicidin family of AMP (Vandamme et al., 2012; Wang, 2014), and examined their growth kinetics in vitro. The minimum inhibitory concentrations (MIC) of LL-37 against the rfaD mutants, including EDL933 rfaD::Tn5 (6.25 μg/ml), and EDL933:ΔrfaD (6.25 μg/ml), were significantly lower than that of wild-type EDL933 (>100 μg/ml) and EDL933:ΔrfaD-prfaD (>100 μg/ml) (Figure 6C). The growth kinetics of bacteria cultured with LL-37 also showed that LL-37 significantly inhibits the replication of EDL933 rfaD::Tn5, and EDL933:ΔrfaD cells (Figure 6D). Moreover, the rfaD mutations also increased the susceptibility of EDL933 to the other two AMPs, Polymyxin B and Colistin (all P < 0.05, Table S3). Together, our data demonstrated that disruption of rfaD increases the susceptibility of EHEC to AMPs in vitro.

Deletion of rfaD Confers the Hypersusceptibility of EHEC to Host Intestinal Immunity In vivo

We showed that the GFP-labeled wild-type EDL933 can replicate and colonize in the intestinal lumen of C. elegans; however, the GFP-labeled rfaD mutants cannot (Figure 3). Given that C. elegans is a bacterivore and most of the bacteria cells ingested are ground up by the pharynx of C. elegans, another interpretation of these results is that the physiological integrity of the outer membrane in the rfaD mutants is weak and therefore makes them more vulnerable to the grinding force of the pharynx, other than simply increasing their susceptibility to innate immunity in the intestine of C. elegans. In order to test whether rfaD mutants are directly hypersusceptible to the intestinal antimicrobial immunity in vivo, we monitored the replication and colonization of the rfaD mutants in the pharynx-defect C. elegans strain DA597 (Figure 7). The DA597 animals contain two mutations in the phm-2(ad597) allele that result in abnormal position and function of the pharyngeal grinder (Avery, 1993). When DA597 animals were pulsed with GFP-labeled OP50, wild-type EDL933, EDL933:ΔrfaD, or EDL933:ΔrfaD-prfaD bacteria for 1 day, most of the animals exhibited GFP signals in their intestine and there was no significant difference among different bacteria-treated groups (Figures 7A–E). The data suggested that these GFP-labeled bacteria can pass into the intestinal lumen without being damaged by the pharynx in DA597 animals. However, when these GFP-labeled bacteria infected animals were further chased with non-GFP-labeled OP50 for another 3 days (Figures 7F–J), only DA597 animals infected previously by GFP-labeled wild-type EDL933 and EDL933:ΔrfaD-prfaD still maintained significant GFP signals in their intestines. However, the GFP signals were totally abolished in the GFP-labeled OP50 and EDL933:ΔrfaD-infected groups. These data support the notion that the EDL933:ΔrfaD, similar to the non-pathogenic OP50, is hypersensitive to the intestinal innate immunity in C. elegans, and are therefore quickly killed and eliminated by the animals in vivo. This phenomenon is similar to that in mice described in Figure 5. Together, our results suggested that disruptions of the rfaD gene increased the susceptibility of EHEC to host intestinal immunity.

FIGURE 7

Figure 7. The rfaD mutation increases the susceptibility of EHEC to host intestinal innate immunity. Images of DA597 pharynx defect C. elegans fed with (A) GFP-labeled OP50 (OP50-GFP), (B) EDL933 (EDL933-GFP), (C) EDL933:ΔrfaD (ΔrfaD-GFP), or (D) EDL933:ΔrfaD-prfaD (ΔrfaD-prfaD-GFP) at 20°C for 1 day. (E) Percentage of GFP-labeled bacteria (A–D) fed DA597 animals with GFP signals in intestine was calculated. Images of DA597 animals fed with (F) GFP-labeled OP50, (G) EDL933, (H) EDL933:ΔrfaD, or (I) EDL933:ΔrfaD-prfaD at 20°C for 1 days and chased on normal non-GFP OP50 plates for 3 days. (J) Percentage of GFP-labeled bacteria (F–I) fed DA597 animals with GFP signals in intestine was calculated. All experiments were conducted independently at least three times, and error bars indicate the standard deviations. The scale bar represents 100 μm.

Discussion

Our genetic analyses in the present study demonstrate that rfaD and genes involved in the LPS biosynthesis are required for EHEC infection in C. elegans. Disruption of E. coli O157:H7 LPS attenuates its toxicity to C. elegans. The E. coli O157:H7 rfaD mutants are significantly less virulent to C. elegans animals, as shown by significantly reduced bacterial colonization and microvillar actin rearrangement in the alimentary tract of C. elegans. Moreover, mutation of rfaD diminishes the colonization of E. coli O157:H7 in the intestine, specifically in the cecum and colon, in mouse. Our mechanistic study demonstrates that the attenuated phenotype of E. coli O157:H7 rfaD mutant to animal hosts may, at least in part, be due to an increase in susceptibility to antimicrobial peptides and host intestinal immunity in vivo.

The enzymatic product of RfaD, ADP-L-glycero-D-manno-heptose, links core LPS and O-antigen to Kdo₂-lipid A on the EHEC outer membrane (Figure 1). It has been reported that inhibition of the KdtA (also called WaaA), which links the ADP-L-glycero-D-manno-heptose to Kdo₂-lipid A for the core-lipid A formation, causes the accumulation of Lipid A Kdo₂ disaccharide on the outer membrane of E. coli (Belunis et al., 1995). Given that the RfaD is the last step enzyme for ADP-L-glycero-D-manno-heptose and inner core LPS biosynthesis, inactivation of RfaD may also result in the accumulation of Kdo₂-lipid A on the EHEC outer membrane. Of note, Kdo₂-lipid A has been reported to stimulate the innate immune system through the Toll-like receptor 4 (TLR4) signaling pathway (Raetz et al., 2006; Sims et al., 2010; Kim et al., 2015), and it has been suggested the E. coli rfaD mutants that produce more Kdo2-lipid A could be a good base strain for developing bacterial vaccine adjuvant (Wang et al., 2014). Our results demonstrate that the EHEC rfaD mutants are significantly attenuated to animal hosts, including C. elegans and mouse, in vivo, therefore testing whether the EDL933:ΔrfaD mutants can activate the innate immune response is warranted and the potential for these mutants in EHEC vaccine development is suggested.

In metazoans, including C. elegans and mammals, host antimicrobial peptides (AMPs) are crucial components of the innate immune system (Irazoqui et al., 2010; Nakatsuji and Gallo, 2012; Pukkila-Worley and Ausubel, 2012). Humans have approximately one hundred AMPs, and these AMPs have been found on the mucus surface layer of a variety of tissues, including intestine (Wang, 2014). It has been reported that the AMP Cathelicidin mediates innate intestinal defense against colonization with epithelial adherent bacterial pathogens, including Escherichia coli O157:H7 (Iimura et al., 2005), and protects mice from EHEC-mediated disease (Chromek et al., 2012). Our in vitro and in vivo data in Figures 5–7, which suggest that the EHEC rfaD mutants are hypersensitive to AMPs and confer less intestinal colonization, are in agreement with these reports. However, it also has been reported that the EHEC outer-membrane protease OmpT can degrade the human AMP LL-37 and has evolved as a strategy through which EHEC can resist AMPs (Thomassin et al., 2012). Our data demonstrated that targeting RfaD and core LPS biosynthesis can further sensitize the EHEC cells to AMP killing and host innate immunity, which are also in agreement with the recent findings (Ho and Waldor, 2007; Sheng et al., 2008; Miyashita et al., 2012; Youn et al., 2013). Therefore, future testing of whether inhibiting RfaD activity would affect the expression of OmpT on the outer-membrane of EHEC is also clinically relevant.

Bacterial pathogens that are resistant to antibiotics have become an urgent worldwide issue, and the antibiotic resistance of EHEC has also been reported (Venturini et al., 2010; Goldwater and Bettelheim, 2012). Pathogens resistant to currently available antibiotics are increasing drastically, not to mention that the treatment of EHEC infection by canonical antibiotics is contraindicated. For decades, targeting LPS biosynthesis and/or export has been considered as an attractive strategy for the treatment of Gram-negative pathogens infection (Cipolla et al., 2011; Walsh and Wencewicz, 2014). However, antibacterial drugs with this mechanism of action are still under development and have not yet been used clinically. It has not escaped our notice that the EHEC rfaD deletion strains are deep rough LPS mutants (Figure 2F), therefore another interpretation of our results for the attenuated toxicity of these EHEC LPS mutants in vivo could attribute to their general weakness. Nevertheless, the replication rate/growth kinetics of the rfaD mutant remained unaffected in vitro (Figure 2E). These data suggest that the inhibition of RfaD, in part, can sensitize EHEC to host intestinal immunity and/or microenvironment and enhance their clearance by host in vivo. Here, our study highlights the potential of targeting RfaD or the other enzymes in the LPS biosynthesis pathway, if druggable, as alternative therapeutic measure by which to combat EHEC infection.

Author Contributions

CK, JC, HC, CT, TH, WS, SW, TC, and CC conceived and designed the experiments. CK, TH, SW, and TC performed the experiments. CK, JC, HC, CT, SW, TC, and CC analyzed the data. JC, HC, CT, PL, and WS contributed reagents/materials/analysis tools. CK and CC wrote the paper.

Funding

This work is supported by the Minister of Science and Technology (MOST) grants (101-2311-B-006-005, 102-2311-B-006-005, 102-2321-B-006-022, and 104-2321-B-006-019) to CC.

Conflict of Interest Statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Acknowledgments

We are grateful to the assistance from the Taiwan C. elegans core facility, funded by the MOST Taiwan, and feedback from the Taiwan worm research community. We thank the Caenorhabditis Genetics Center (CGC), which is supported by the National Institutes of Health (United States)- Office of Research Infrastructure Programs (P40 OD010440), for the C. elegans strains. We acknowledge the proteomics core facility of the Clinical Medicine Research Center in National Cheng Kung University Hospital for the silver staining experiment, and Chi-Chung Chen from the Department of Medical Research, Chi Mei Medical Center (Tainan, Taiwan) for the help in mouse infection. We are grateful for the support from the laboratory animal center of National Cheng Kung University. We also thank Miranda Loney for editing the manuscript.

Supplementary Material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/article/10.3389/fcimb.2016.00082

References

Anderson, G. L., Kenney, S. J., Millner, P. D., Beuchat, L. R., and Williams, P.L. (2006). Shedding of foodborne pathogens by Caenorhabditis elegans in compost-amended and unamended soil. Food Microbiol. 23, 146–153. doi: 10.1016/j.fm.2005.01.018

PubMed Abstract | CrossRef Full Text | Google Scholar

Armstrong, G. D., Mulvey, G. L., Marcato, P., Griener, T. P., Kahan, M. C., Tennent, G. A., et al. (2006). Human Serum Amyloid P component protects against Escherichia coli O157:H7 Shiga Toxin 2 in vivo: therapeutic implications for hemolytic-uremic syndrome. J. Infect. Dis. 193, 1120–1124. doi: 10.1086/501472

PubMed Abstract | CrossRef Full Text | Google Scholar

Avery, L. (1993). The genetics of feeding in Caenorhabditis elegans. Genetics 133, 897–917.

PubMed Abstract | Google Scholar

Bahar, A. A., and Ren, D. (2013). Antimicrobial peptides. Pharmaceuticals (Basel) 6, 1543–1575. doi: 10.3390/ph6121543

PubMed Abstract | CrossRef Full Text | Google Scholar

Belunis, C. J., Clementz, T., Carty, S. M., and Raetz, C. R. H. (1995). Inhibition of lipopolysaccharide biosynthesis and cell growth following inactivation of the kdtA gene in Escherichia coli. J. Biol. Chem. 270, 27646–27652. doi: 10.1074/jbc.270.46.27646

PubMed Abstract | CrossRef Full Text | Google Scholar

Bentancor, L. V., Bilen, M., Brando, R. J., Ramos, M. V., Ferreira, L. C., Ghiringhelli, P. D., et al. (2009). A DNA vaccine encoding the enterohemorragic Escherichia coli Shiga-like toxin 2 A2 and B subunits confers protective immunity to Shiga toxin challenge in the murine model. Clin. Vaccine Immunol. 16, 712–718. doi: 10.1128/CVI.00328-08

PubMed Abstract | CrossRef Full Text | Google Scholar

Binns, M. M., Davies, D. L., and Hardy, K. G. (1979). Cloned fragments of the plasmid ColV,I-K94 specifying virulence and serum resistance. Nature 279, 778–781. doi: 10.1038/279778a0

PubMed Abstract | CrossRef Full Text | Google Scholar

Binns, M. M., Mayden, J., and Levine, R. P. (1982). Further characterization of complement resistance conferred on Escherichia coli by the plasmid genes traT of R100 and iss of ColV,I-K94. Infect. Immun. 35, 654–659.

PubMed Abstract | Google Scholar

Bravo, D., Silva, C., Carter, J. A., Hoare, A., Alvarez, S. A., Blondel, C. J., et al. (2008). Growth-phase regulation of lipopolysaccharide O-antigen chain length influences serum resistance in serovars of Salmonella. J. Med. Microbiol. 57(Pt 8), 938–946. doi: 10.1099/jmm.0.47848-0

PubMed Abstract | CrossRef Full Text | Google Scholar

Brenner, S. (1974). The genetics of Caenorhabditis elegans. Genetics 77, 71–94.

PubMed Abstract | Google Scholar

Chang, P. C., Wang, C. J., You, C. K., and Kao, M. C. (2011). Effects of a HP0859 (rfaD) knockout mutation on lipopolysaccharide structure of Helicobacter pylori 26695 and the bacterial adhesion on AGS cells. Biochem. Biophys. Res. Commun. 405, 497–502. doi: 10.1016/j.bbrc.2011.01.060

PubMed Abstract | CrossRef Full Text | Google Scholar

Chou, T. C., Chiu, H. C., Kuo, C. J., Wu, C. M., Syu, W. J., Chiu, W. T., et al. (2013). Enterohaemorrhagic Escherichia coli O157:H7 Shiga-like toxin 1 is required for full pathogenicity and activation of the p38 mitogen-activated protein kinase pathway in Caenorhabditis elegans. Cell. Microbiol. 15, 82–97. doi: 10.1111/cmi.12030

PubMed Abstract | CrossRef Full Text | Google Scholar

Chromek, M., Arvidsson, I., and Karpman, D. (2012). The antimicrobial peptide cathelicidin protects mice from Escherichia coli O157:H7-mediated disease. PLoS ONE 7:e46476. doi: 10.1371/journal.pone.0046476

PubMed Abstract | CrossRef Full Text | Google Scholar

Cipolla, L., Polissi, A., Airoldi, C., Gabrielli, L., Merlo, S., and Nicotra, F. (2011). New targets for antibacterial design: Kdo biosynthesis and LPS machinery transport to the cell surface. Curr. Med. Chem. 18, 830–852. doi: 10.2174/092986711794927676

PubMed Abstract | CrossRef Full Text | Google Scholar

Darby, C. (2005). “Interactions with microbial pathogens,” in The C. elegans Research Community, WormBook. doi: 10.1895/wormbook.1.21.1

CrossRef Full Text | Google Scholar

Datsenko, K. A., and Wanner, B. L. (2000). One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. Proc. Natl. Acad. Sci. U.S.A. 97, 6640–6645. doi: 10.1073/pnas.120163297

PubMed Abstract | CrossRef Full Text | Google Scholar

Freedman, S. B., Xie, J., Neufeld, M. S., Hamilton, W. L., Hartling, L., and Tarr, P. I. (2016). Shiga toxin-producing escherichia coli infection, antibiotics, and risk of developing hemolytic uremic syndrome: a meta-analysis. Clin. Infect. Dis. 62, 1251–1258. doi: 10.1093/cid/ciw099

PubMed Abstract | CrossRef Full Text | Google Scholar

Giacometti, A., Cirioni, O., Barchiesi, F., Del Prete, M. S., Fortuna, M., Caselli, F., et al. (2000). In vitro susceptibility tests for cationic peptides: comparison of broth microdilution methods for bacteria that grow aerobically. Antimicrob. Agents Chemother. 44, 1694–1696. doi: 10.1128/aac.44.6.1694-1696.2000

PubMed Abstract | CrossRef Full Text | Google Scholar

Goldwater, P. N., and Bettelheim, K. A. (2012). Treatment of enterohemorrhagic Escherichia coli (EHEC) infection and hemolytic uremic syndrome (HUS). BMC Med. 10:12. doi: 10.1186/1741-7015-10-12

PubMed Abstract | CrossRef Full Text | Google Scholar

Ho, T. D., and Waldor, M. K. (2007). Enterohemorrhagic Escherichia coli O157:H7 gal mutants are sensitive to bacteriophage P1 and defective in intestinal colonization. Infect. Immun. 75, 1661–1666. doi: 10.1128/IAI.01342-06

PubMed Abstract | CrossRef Full Text | Google Scholar

Iimura, M., Gallo, R. L., Hase, K., Miyamoto, Y., Eckmann, L., and Kagnoff, M. F. (2005). Cathelicidin mediates innate intestinal defense against colonization with epithelial adherent bacterial pathogens. J. Immunol. 174, 4901–4907. doi: 10.4049/jimmunol.174.8.4901

PubMed Abstract | CrossRef Full Text | Google Scholar

Irazoqui, J. E., Urbach, J. M., and Ausubel, F. M. (2010). Evolution of host innate defence: insights from Caenorhabditis elegans and primitive invertebrates. Nat. Rev. Immunol. 10, 47–58. doi: 10.1038/nri2689

PubMed Abstract | CrossRef Full Text | Google Scholar

Kenney, S. J., Anderson, G. L., Williams, P. L., Millner, P. D., and Beuchat, L. R. (2005). Persistence of Escherichia coli O157:H7, Salmonella Newport, and Salmonella Poona in the gut of a free-living nematode, Caenorhabditis elegans, and transmission to progeny and uninfected nematodes. Int. J. Food Microbiol. 101, 227–236. doi: 10.1016/j.ijfoodmicro.2004.11.043

PubMed Abstract | CrossRef Full Text | Google Scholar

Kim, E.-Y., Shin, H. Y., Kim, J.-Y., Kim, D.-G., Choi, Y.-M., Kwon, H.-K., et al. (2015). ATF3 plays a key role in Kdo2-lipid A-induced TLR4-dependent gene expression via NF-κB activation. PLoS ONE 5:e14181. doi: 10.1371/journal.pone.0014181

PubMed Abstract | CrossRef Full Text

Lathem, W. W., Bergsbaken, T., and Welch, R. A. (2004). Potentiation of C1 esterase inhibitor by StcE, a metalloprotease secreted by Escherichia coli O157:H7. J. Exp. Med. 199, 1077–1087. doi: 10.1084/jem.20030255

PubMed Abstract | CrossRef Full Text | Google Scholar

MacQueen, A. J., Baggett, J. J., Perumov, N., Bauer, R. A., Januszewski, T., Schriefer, L., et al. (2005). ACT-5 is an essential Caenorhabditis elegans actin required for intestinal microvilli formation. Mol. Biol. Cell 16, 3247–3259. doi: 10.1091/mbc.E04-12-1061

PubMed Abstract | CrossRef Full Text

Mahoney, M. M., Lee, A. Y., Brezinski-Caliguri, D. J., and Huttner, K. M. (1995). Molecular analysis of the sheep cathelin family reveals a novel antimicrobial peptide. FEBS Lett. 377, 519–522. doi: 10.1016/0014-5793(95)01390-3

PubMed Abstract | CrossRef Full Text | Google Scholar

McGhee, J.D. (2007). “The C. elegans intestine,” in The C. elegans Research Community, WormBook. doi: 10.1895/wormbook.1.133.1

CrossRef Full Text | Google Scholar

Miyashita, A., Iyoda, S., Ishii, K., Hamamoto, H., Sekimizu, K., and Kaito, C. (2012). Lipopolysaccharide O-antigen of enterohemorrhagic Escherichia coli O157:H7 is required for killing both insects and mammals. FEMS Microbiol. Lett. 333, 59–68. doi: 10.1111/j.1574-6968.2012.02599.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Mohawk, K. L., and O'Brien, A. D. (2011). Mouse models of Escherichia coli O157:H7 infection and shiga toxin injection. J. Biomed. Biotechnol. 2011:258185. doi: 10.1155/2011/258185

PubMed Abstract | CrossRef Full Text | Google Scholar

Nakatsuji, T., and Gallo, R. L. (2012). Antimicrobial peptides: old molecules with new ideas. J. Invest. Dermatol. 132(3 Pt 2), 887–895. doi: 10.1038/jid.2011.387

PubMed Abstract | CrossRef Full Text | Google Scholar

Nguyen, Y., and Sperandio, V. (2012). Enterohemorrhagic E. coli (EHEC) pathogenesis. Front. Cell. Infect. Microbiol. 2:90. doi: 10.3389/fcimb.2012.00090

PubMed Abstract | CrossRef Full Text

Pacheco, A. R., and Sperandio, V. (2012). Shiga toxin in enterohemorrhagic E.coli: regulation and novel anti-virulence strategies. Front. Cell. Infect. Microbiol. 2:81. doi: 10.3389/fcimb.2012.00081

PubMed Abstract | CrossRef Full Text | Google Scholar

Pennington, H. (2010). Escherichia coli O157. Lancet 376, 1428–1435. doi: 10.1016/S0140-6736(10)60963-4

PubMed Abstract | CrossRef Full Text | Google Scholar

Pukkila-Worley, R., and Ausubel, F. M. (2012). Immune defense mechanisms in the Caenorhabditis elegans intestinal epithelium. Curr. Opin. Immunol. 24, 3–9. doi: 10.1016/j.coi.2011.10.004

PubMed Abstract | CrossRef Full Text | Google Scholar

Raetz, C. R., Garrett, T. A., Reynolds, C. M., Shaw, W. A., Moore, J. D., Smith, D. C. Jr., et al. (2006). Kdo2-Lipid A of Escherichia coli, a defined endotoxin that activates macrophages via TLR-4. J. Lipid Res. 47, 1097–1111. doi: 10.1194/jlr.M600027-JLR200

PubMed Abstract | CrossRef Full Text

Raetz, C. R., and Whitfield, C. (2002). Lipopolysaccharide endotoxins. Annu. Rev. Biochem. 71, 635–700. doi: 10.1146/annurev.biochem.71.110601.135414

PubMed Abstract | CrossRef Full Text | Google Scholar

Rhee, K. J., Cheng, H., Harris, A., Morin, C., Kaper, J. B., and Hecht, G. (2011). Determination of spatial and temporal colonization of enteropathogenic E. coli and enterohemorrhagic E. coli in mice using bioluminescent in vivo imaging. Gut Microbes 2, 34–41. doi: 10.4161/gmic.2.1.14882

PubMed Abstract | CrossRef Full Text | Google Scholar

Rosenfeld, Y., and Shai, Y. (2006). Lipopolysaccharide (Endotoxin)-host defense antibacterial peptides interactions: role in bacterial resistance and prevention of sepsis. Biochim. Biophys. Acta 1758, 1513–1522. doi: 10.1016/j.bbamem.2006.05.017

PubMed Abstract | CrossRef Full Text | Google Scholar

Sato, M., Saegusa, K., Sato, K., Hara, T., and Harada, A. (2011). Caenorhabditis elegans SNAP-29 is required for organellar integrity of the endomembrane system and general exocytosis in intestinal epithelial cells. Mol. Biol. Cell 22, 2579–2587. doi: 10.1091/mbc.E11-04-0279

PubMed Abstract | CrossRef Full Text

Sauter, K. A., Melton-Celsa, A. R., Larkin, K., Troxell, M. L., O'Brien, A. D., and Magun, B. E. (2008). Mouse model of hemolytic-uremic syndrome caused by endotoxin-free Shiga toxin 2 (Stx2) and protection from lethal outcome by anti-Stx2 antibody. Infect. Immun. 76, 4469–4478. doi: 10.1128/IAI.00592-08

PubMed Abstract | CrossRef Full Text | Google Scholar

Sheng, H., Lim, J. Y., Watkins, M. K., Minnich, S. A., and Hovde, C. J. (2008). Characterization of an Escherichia coli O157:H7 O-antigen deletion mutant and effect of the deletion on bacterial persistence in the mouse intestine and colonization at the bovine terminal rectal mucosa. Appl. Environ. Microbiol. 74, 5015–5022. doi: 10.1128/AEM.00743-08

PubMed Abstract | CrossRef Full Text | Google Scholar

Sheoran, A. S., Chapman-Bonofiglio, S., Harvey, B. R., Mukherjee, J., Georgiou, G., Donohue-Rolfe, A., et al. (2005). Human antibody against shiga toxin 2 administered to piglets after the onset of diarrhea due to Escherichia coli O157:H7 prevents fatal systemic complications. Infect. Immun. 73, 4607–4613. doi: 10.1128/IAI.73.8.4607-4613.2005

PubMed Abstract | CrossRef Full Text | Google Scholar

Sims, K., Haynes, C. A., Kelly, S., Allegood, J. C., Wang, E., Momin, A., et al. (2010). Kdo2-Lipid A, a TLR4-specific agonist, induces de novo sphingolipid biosynthesis in RAW264.7 macrophages, which is essential for induction of autophagy. J. Biol. Chem. 285, 38568–38579. doi: 10.1074/jbc.M110.170621

PubMed Abstract | CrossRef Full Text | Google Scholar

Tesh, V. L., Burris, J. A., Owens, J. W., Gordon, V. M., Wadolkowski, E. A. O., Brien, A. D., et al. (1993). Comparison of the relative toxicities of shiga-like toxins type I and type II for mice. Infect. Immun. 61, 3392–3402.

PubMed Abstract | Google Scholar

Thomassin, J.-L., Brannon, J. R., Kaiser, J., Gruenheid, S., and Moual, H. L. (2012). Enterohemorrhagic and enteropathogenic Escherichia coli evolved different strategies to resist antimicrobial peptides. Gut Microb. 3, 556–561. doi: 10.4161/gmic.21656

PubMed Abstract | CrossRef Full Text | Google Scholar

Thwaite, J. E., Hibbs, S., Titball, R. W., and Atkins, T. P. (2006). Proteolytic degradation of human antimicrobial peptide LL-37 by Bacillus anthracis may contribute to virulence. Antimicrob. Agents Chemother. 50, 2316–2322. doi: 10.1128/AAC.01488-05

PubMed Abstract | CrossRef Full Text | Google Scholar

Valvano, M. A., Messner, P., and Kosma, P. (2002). Novel pathways for biosynthesis of nucleotide-activated glycero-manno-heptose precursors of bacterial glycoproteins and cell surface polysaccharides. Microbiology 148, 1979–1989. doi: 10.1099/00221287-148-7-1979

PubMed Abstract | CrossRef Full Text | Google Scholar

Vandamme, D., Landuyt, B., Luyten, W., and Schoofs, L. (2012). A comprehensive summary of LL-37, the factotum human cathelicidin peptide. Cell. Immunol. 280, 22–35. doi: 10.1016/j.cellimm.2012.11.009

PubMed Abstract | CrossRef Full Text | Google Scholar

Venturini, C., Beatson, S. A., Djordjevic, S. P., and Walker, M. J. (2010). Multiple antibiotic resistance gene recruitment onto the enterohemorrhagic Escherichia coli virulence plasmid. FASEB J. 24, 1160–1166. doi: 10.1096/fj.09-144972

PubMed Abstract | CrossRef Full Text | Google Scholar

Walsh, C. T., and Wencewicz, T. A. (2014). Prospects for new antibiotics: a molecule-centered perspective. J. Antibiot. 67, 7–22. doi: 10.1038/ja.2013.49

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, C. Y., Wang, S. W., Huang, W. C., Kim, K. S., Chang, N. S., Wang, Y. H., et al. (2012). Prc contributes to Escherichia coli evasion of classical complement-mediated serum killing. Infect. Immun. 80, 3399–3409. doi: 10.1128/IAI.00321-12

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, G. (2014). Human antimicrobial peptides and proteins. Pharmaceuticals (Basel) 7, 545–594. doi: 10.3390/ph7050545

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, J., Ma, W., Wang, Z., Li, Y., and Wang, X. (2014). Construction and characterization of an Escherichia coli mutant producing Kdo2-Lipid A. Mar. Drugs 12, 1495–1511. doi: 10.3390/md12031495

PubMed Abstract | CrossRef Full Text | Google Scholar

Wiegand, I., Hilpert, K., and Hancock, R. E. (2008). Agar and broth dilution methods to determine the minimal inhibitory concentration (MIC) of antimicrobial substances. Nat. Protoc. 3, 163–175. doi: 10.1038/nprot.2007.521

PubMed Abstract | CrossRef Full Text | Google Scholar

Yan, J. X., Wait, R., Berkelman, T., Harry, R. A., Westbrook, J. A., Wheeler, C. H., et al. (2000). A modified silver staining protocol for visualization of proteins compatible with matrix-assisted laser desorption/ionization and electrospray ionization- mass spectrometry. Electrophoresis 21, 3666–3672. doi: 10.1002/1522-2683(200011)21:17<3666::AID-ELPS3666>3.0.CO;2-6

PubMed Abstract | CrossRef Full Text | Google Scholar

Youn, M., Lee, K. M., Kim, S. H., Lim, J., Yoon, J. W., and Park, S. (2013). Escherichia coli O157:H7 LPS O-side chains and pO157 are required for killing Caenorhabditis elegans. Biochem. Biophys. Res. Commun. 436, 388–393. doi: 10.1016/j.bbrc.2013.05.111

PubMed Abstract | CrossRef Full Text | Google Scholar