Abstract
Background:
Primary biliary cholangitis (PBC) is a cholestatic, autoimmune liver disease with the presence of characteristic autoantibodies. The aim of the work was to determine the level of antibodies directed against bacterial antigens: Chlamydia pneumoniae (anti-Cpn), Yersinia enterolitica (anti-Y.e), Helicobacter pylori (anti-Hp), Mycoplasma pneumoniae (anti- Mp.) and Escherichia coli (E.coli) in sera of PBC patients. We also performed in vitro studies on the impact of the bacterial peptides on the specific antigen-antibody binding.
Method:
We screened 92 Polish PBC patients and sera samples from healthy donors and pathological controls. Autoantibodies and anti-bacterial antibodies were determined by commercially available ELISA kits. Specific inhibition of antibody binding was also detected by the in house ELISA method.
Results:
Anti-Cpn, anti-Y. enterolitica, anti-Hp, anti-M. pneumoniae and anti-E. coli antibodies were significantly more common in the group of PBC patients than in the pathological and healthy control groups: 74%, 40%, 84%, 39% and 69% respectively. The mean level of anti-Cpn, anti- Y.e, anti-Hp and anti- M.p in the PBC group was significantly higher than those in the healthy group (p < 0.001). and in patients with other liver diseases. In sera of patients with the presence of positive anti-mitochondrial antibodies (AMA), specific for PBC, anti-bacterial antibodies have been found in 80% vs. 50% in sera with AMA negative. We observed inhibition of specific antigen-antibody binding by the bacterial peptide: EClpP (E. coli caseinolytic protease) and adenine glycosylase from E. coli caseinolytic protease P, ClpP Y.e from peptide of Y. enterolitica, Mp PDC from M. pneumonia peptide and adenine glycosylase of E. coli. Bacterial factors influence the specific binding of antibodies to pyruvate dehydrogenase (PDC-E2), gp210 and KLHL12 (kelch-like peptide 12) antigens.
Conclusion:
Microbial mimics may be the major targets of cross-reactivity with human pyruvate dehydrogenase, gp210, and KLHL12 in PBC.
Introduction
Primary biliary cholangitis (PBC) is a cholestatic, autoimmune liver disease, characterized by the existence of anti-mitochondrial (AMA) and antinuclear antibodies like anti-gp210 and anti-Sp100 in the patients’ sera (Ma et al., 2017; ; ; You et al., 2022; Trivella et al., 2023; Wang et al., 2023; Xu et al., 2023; Wang et al., 2024). Antibodies to kelch-like peptide 12 (KLHL12) and to hexokinase 1 (HK1) have also been recognized as another PBC biomarker (Norman et al., 2015; ). AMA is found in up to 90% of patients with PBC. AMA identifies a family of enzymes located in the inner membrane of mitochondria, coined the 2-oxo-acid dehydrogenase complexes (2-OADC), which primarily include PDC-E2, branched chain 2-oxo-acid dehydrogenase complex (BCOADC-E2), 2-oxo-glutaric acid dehydrogenase complex (OGDC-E2) and dihydrolipoamide dehydrogenase binding protein (E3BP) (; ). The main subtype of AMA is anti-M2, directed against PDC-E2 (Juran and Lazaridis, 2008; ; Xu et al., 2023). The influence of the genetic background in the context of environmental factors, and interactions between effects in conferring predisposition to disease, has been evaluated. Specific disease-contributing alleles are not necessarily sufficient or necessary for the development of PBC, but they may be risk factors that modify the probability of the disease, through modulation of pathogenic processes (). The described genetic factors connected with PBC, include the HLA locus and outside HLA loci (Invernizzi et al., 2008). The HLA class II locus on chromosome 6 includes groups of genes encoding HLA class II proteins that are strongly related with predisposition to various autoimmune diseases, also to PBC. In European populations, HLA-DQA1*04:01, HLA-DQB1*04:02, and HLA-DRB1*08:01 were described as influencing alleles, whereas HLA-DQB1*03:01 was recognized as a protective allele (Matsumoto et al., 2022; Tanaka et al., 2018)
Over the last 20 years, some attempts have been made to explain the relationship between environmental factors and the etiopathogenesis of the disease (; Tanakaa et al., 2017; Tanaka et al., 2017; Jang et al., 2021; Wang et al., 2022). Many researchers, based on epidemiological data, suggest a higher incidence of autoimmune diseases during or after infection with certain microorganisms (). Bacterial infections have been studied as a major environmental factor in the etiology of PBC and one of the causes of loss of tolerance to mitochondrial autoantigens in PBC through the mechanism of molecular mimicry between human PDC-E2 and E. coli PDC-E2 (; Juran and Lazaridis, 2014; Leung et al., 2016; Lule et al., 2017; Tanaka et al., 2019). The cross-reactivity of AMA against some prokaryotic antigens has been described for several microbes, including E. coli, Klebsiella pneumoniae, Proteus mirabilis, Staphylococcus aureus, and Salmonella Minnesota (; Tanaka et al., 2019). Bogdanos et al. informed that IgG3 antibodies directed to the SxGDL[ILV]AE motif of L. delbrueckii-galactosidase were existing in AMA-positive PBC sera and cross-react with humanPDC-E2. L. delbrueckii subspecies bulgaricus is thus implicated as a probable environmental trigger for breaking tolerance against mitochondrial autoantigens. These antibodies also cross-reacted with human PDC-E2 (). Extensive research has confirmed the association of recurrent urinary tract infections (UTIs) with PBC (Smyk et al., 2011; Lule et al., 2017; ). Novosphingobium aromaticivorans, a bacterium that metabolizes xenobiotics was also studied, suggesting that this type of bacteria can also associated with the etiology of PBC ().
Our study aimed to evaluate the level of antibodies directed against some bacterial antigens in sera of Polish patients with PBC. We determined anti-Ch. pneumoniae, anti-Y. enterolitica, anti-H. pylori anti-M. pneumoniae and E. coli antibodies. We verified AMA-positive and AMA-negative PBC patients’ sera for antibodies (Abs) against numerous infectious agents. We calculated also in vitro the influence of the bacterial peptide on specific binding antigen-antibody.
Materials and methods
Patients
We studied 92 Polish patients with PBC (87 women, 5 men; median age 51, range 26–74 years), diagnosed over the past 10 years. The diagnosis was based on the internationally accepted criteria (). The sera of patients positive for the hepatitis B surface antigen (HBsAg), anti-hepatitis A (IgM), and hepatitis C virus were excluded, and we also excluded patients with alcoholism, and AIH (autoimmune hepatitis)/PBC overlap syndrome. We also excluded patients with other autoimmune diseases. The control group contained serum samples from 30 healthy adult blood donors and pathological controls - 47 serum samples from patients with other autoimmune liver diseases: primary sclerosing cholangitis (PSC) and autoimmune hepatitis (AIH), 15 serum samples from patients with alcoholic liver cirrhosis (ALC). The study procedure was conducted according to the ethical guidelines of the Declaration of Helsinki and was accepted by the Centre of Postgraduate Medical Education’s ethical committee (Warsaw; approval number 71/PB/2019).
Detection of autoantibodies and anti-bacterial antibodies
AMA and anti-nuclear antibodies were detected by commercially available kits (IMTEC-Human, Euroimmun; Germany and Inova Diagnostics; USA). Anti-Cpn, anti-Y. enterolitica, anti-Hp, anti- M. pneumoniae, and anti-Chlamydia trachomatis antibodies were tested by ELISA kits (Euroimmun; Germany), anti-E.coli antibodies were evaluated by ELISA kit (Chondrex, Inc, USA). Determination of antibodies was provided according to the manufacturer’s instructions
Synthetic peptides
ECLpP - E. coli caseinolytic protease P, ClpPYe – peptide of Yersinia enterolitica, Mp PDC – mycoplasma pneumoniae peptide and adenine glycosylase of E. coli were obtained from Yale University (New Haven, CT, USA).
Table 1. presents these synthetic peptides used in the study. The peptides corresponded to the region of similarity between bacterial peptide and human PDC-E2 or gp210, and to this region with residues from its vicinity. A negative control peptide was also included.
Table 1
| Antigen | Amino acid sequence of peptides |
|---|---|
| Control peptide | LEHLKELIARNTWLTKKLPLSLSCF |
| Human PDC-E2 | KKVGEKLSEGDLLAEIETDKATIGFEVQEEG |
| E. coli caseinolytic protease P | KASEGELLAQVEPED |
| ClpP Y.e | KATEGELLAQVEPED |
| Mp PDC | KKVGDTIKVDEALFVVETDKVTTELPSPYAG |
| Human Gp210 | DRKASPPSGLWSPAYASH |
| E.coli adenine glycosylase | QRPPSGLWGGLY |
The antigens used in this study.
Detection of inhibition of antibody-antigen binding
Inhibition of antibody binding to human PDC-E2 by bacterial peptides; ECLpP - E. coli caseinolytic protease P, ClpPYe – peptide of Yersinia enterolitica, Mp PDC – Mycoplasma pneumoniae peptide
Inhibition of antibody binding to human gp210 antigen by bacterial peptides E. coli peptide - Adenine glycosylase of E. coli - QRPPSQLWGGLY, Gp210 antigen – DRKASPPSGLWSPAYASH.
Inhibition of antibody binding to human KLHL12 protein by bacterial peptide of Yersinia enterolitica - Yersinia adhesin A (YadA)
Inhibition of antibody binding to human HK-1 protein by bacterial peptide – caseinolytic protease subunit X of borrelia Burgdorferi
We detected the specific inhibition of antibody-antigen binding by the in-house ELISA method. To investigate whether the simultaneous reactivity to bacterial peptides was due to cross reactivity, competition ELISA was performed measuring antibody reactivity after exposure to these bacterial peptides and control peptide as liquid phase competitors (final concentrations: 0, 1, 2, 5, 9, 15, 30, 60, 150, 250 µg/mL).
All experiments were performed in 96-well microplates (maxi-sorp, Nunc, Denmark) coated with appropriate PBC-specific antigens. Plates (maxi-sorp, Nunc, Denmark) were coated overnight with suitable concentrations of the antigens (PDC-E2, Gp210, KLHL12, HK-1, respectively) in 0.1M bicarbonate buffer pH 9.6. After removing the antigen solution and rinsing the plate, non-specific absorption was prevented by the addition of 200 ml/well of 5% bovine serum albumin (BSA) in phosphate-buffered saline (PBS) and plates were incubated at 4°C overnight.
The bacterial peptides in consecutive dilutions were incubated for 2 h with shaking with PBC specific antibody at a constant dilution (1:100). After equilibrium had been reached, 100 ml of each solution was transferred to an ELISA plate coated with the PBC specific antigen, incubated for 1 h and washed. Next, the plates were incubated for 1 h at room temperature with peroxidase-conjugated anti-human rabbit IgG (Daco A/S Denmark, dilution 1:3000), and washed once again. The color reaction was developed by adding tetramethylbenzidine (TMB, Serva) for 15 min and stopping the reaction with 1N H2SO4. The optical density (OD) was measured at 450 nm. Each sample was tested in duplicate in at least three plates.
Statistical analysis
Prevalence rates were compared between groups using the chi-square test and Fisher’s exact test. Continuous data were summarized as mean ± standard deviation (SD), and categorical data were summarized as frequencies. Continuous variables were evaluated using the Mann-Whitney test and were expressed as median ± interquartile range (IQR). P < 0.05 was considered statistically significant. All statistical analyses were presented using MedCalc for Windows, version 7.4.1.0 (MedCal Software, Mariakerke, Belgium).
Results
The demographic, biochemical, and immunological characteristics of patients with PBC, other autoimmune liver diseases, ALC, and healthy controls are presented in Table 2.
Table 2
| PBC (n=92) | Other autoimmune liver diseses (n=47) | ALC (n=15) | Healthy adult blood donors (n = 30) | |
|---|---|---|---|---|
| Age, years | 50 (27-75) | 49 (22 -67) | 49 (24-69) | 33 (19 – 53) |
| Females/males | 87/5 | 25/22 | 20/20 | 22/8 |
| Bilirubin (Total), mg/dL | 1.9 (1.9) | 1.5 (2.4) | 2.9 (4.5) | 0.7 (0.5) |
| AST, U/L | 88.6 (54.4) | 70.8 (71.0) | 83.7 (70.1) | 22.5 (21.6) |
| ALT, U/L | 92.5 (72.0) | 73.3 (59.4) | 57.6 (128.3) | 15.1 (26.2) |
| AP, U/L | 403.3 (377.6) | 269.2 (175.4) | 308.3 (196.5) | 38.7 (16.8) |
| γ-GT, U/L | 262.3 (226.2) | 291.9 (204.0) | 132.7 (58.7) | 18.6 (4.8) |
| Albumin (g/dl) | 3.6 (0.9) | 3.1 (1.8) | 2.9 (0.9) | 4.5 (2.3) |
| γ-globulin (g/dl) | 1.7 (1.1) | 1.6 (1.7) | 1.5 (1.8) | 1.1 (0.2) |
| AMA M2 | 78 (85%) | 0 (0%) | 0 (0%) | 0 (0%) |
| Anti-gp210 antibodies | 30 (33%) | 0 (0%) | 0 (0%) | 0 (0%) |
| Anti- KLHL12 antibodies | 31 (34%) | 0 (0%) | 0 (0%) | 0 (0%) |
| Anti- HK1 antibodies | 27 (29%) | 0 (0%) | 0 (0%) | 0 (0%) |
| Early histological stage (I/II) | 60 (65%) | 21 (45%) | 8 (53%) | 0 |
| Advanced histological stage (III/IV) | 26 (28%) | 4 (21%) | 4 (27%) | 0 |
| Ambiguous histological stage | 6 (7%) | 0 | 0 | 0 |
The demographic, biochemical, immunological and histological features of PBC patients and control groups.
Data are presented as mean ± SD. γ-GT, γ-glutamyl transpeptidase; ALT, alanine aminotransferase; AP, alkaline phosphatase; AST, aspartate aminotransferase. Normal value: bilirubin < 1.2 mg/dL; AST < 40 U/L; ALT < 40 U/L; AP < 115U/mg/dL; γ-GT < 50 U/L; albumin 3.5-5,5 g/dL, γ-globulin.
In the studied PBC group, 87 out of 92 patients were females. The mean age at PBC diagnosis was 50 years. The total bilirubin concentration was higher in over 50% of the tested patients. We found increased activity of AP and γ-GT in over 75% of the verified samples, and the activity of AST and ALT was also higher in over 55% of them. AMA M2, specific autoantibodies for PBC, was found in 85% of patients’ sera, and specific anti-nuclear antibodies—anti-gp210 autoantibodies were noticed in 33% of patient’s sera.
Detection of anti-bacterial antibodies
Seroprevalence of anti-Cpn, anti-Y. enterolitica, anti-Hp, anti-M. pneumoniae and anti-E.coli antibodies in the PBC group were significantly higher than those in pathological and healthy control and were: 74%, 40%, 84%, 39% and 69% respectively. The odds ratios (ORs) of the presence of anti-bacterial antibodies for the PBC patients versus the healthy control and p-value are shown in Table 3.
Table 3
| PBC patients (n = 92) % | Controls (n = 92) % | Odds ratio (CI ± 95%) | p value | |
|---|---|---|---|---|
| Anti-Chlamydia pneumoniae | 74 | 25 | 8.5 (4.4-16.5) | < 0.0001 |
| Anti-Helicobacter pylori. | 84 | 47 | 5.8 (2.9-11.6) | < 0.0001 |
| Anti-Mycoplasma pneumoniae | 39 | 18 | 2.8 (1.4-5.6) | 0.0024 |
| Anti-Yersinia enterolitica. | 40 | 27 | 1.9 (1.0-3.6) | 0.0430 |
| Anti-Chlamydia trachomatis Anti-E.coli | 16 69 | 8 18 | 2.4 (0.9-6.1) 6.3 (3.2-12.3) | 0.0753 < 0.0001 |
Percentage of positive sera samples of patients with PBC against various infections agents.
Distribution the antibodies to these bacterial antigens in PBC patients and the control groups is presented in Figures 1–5. The mean level of anti-Cpn, anti-Hp, anti- M. pneumoniae, anti-Y. enterolitica and anti-E.coli antibodies in the PBC group was significantly higher than those in the healthy group 80 ± 44 vs. 43 ± 10 RU/ml, p < 0.0001; 60 ± 22 vs. 41 ± 10 RU/ml, p < 0.0001; 36 ± 30 vs. 23 ± 5 RU/ml; p = 0.020 and 59 ± 50 vs. 20 ± 8 RU/ml, p < 0.001, 6.8 ± 2.6 vs. 3.3 ± 1.1 units/ml, p < 0.0001, respectively (Supplementary Figures 1-5).
Figure 1
Figure 2
Figure 3
Figure 4
Figure 5
The mean level of antibodies directed against bacterial antigens in sera of patients with PBC was also higher than in alcoholic liver cirrhosis: 80 ± 44 vs. 45 ± 17 RU/ml, p < 0.0001 for anti-Cpn; 60 ± 33 vs. 41 ± 16 RU/ml, p = 0.003 for anti-Hp; 36 ± 30 vs. 23 ± 5 RU/ml; p = 0.059 for anti- M. pneumoniae, 59 ± 50 vs. 20 ± 8 RU/ml, p < 0.0001 for anti- Y. enterolitica, and 6.8 ± 2.6 vs. 4.0 ± 2.1 units/ml, p = 0.0001for anti-E.coli (Supplementary Figures 1-5).
The mean level of antibodies directed against bacterial antigens in sera of patients with PBC was also elevated than in other liver diseases with a significant difference: 80 ± 44 vs. 62 ± 15 RU/ml, p < 0.0001 for anti-Cpn; 60 ± 22 vs. 45 ± 26 RU/ml, p < 0.0001for anti-Hp; 36 ± 30 vs. 26 ± 7 RU/ml; p = 0.059 for anti- M. pneumoniae, 59 ± 50 vs. 41 ± 20 RU/ml, p < 0.0001 for anti- Y. enterolitica and 6.8 ± 2.6 vs. 4.9 ± 1.7 units/ml, p < 0.0001 for anti-E.coli (Supplementary Figures 1-5).
Significantly lower concentrations of antibodies against bacterial antigens were observed in the sera of patients with other autoimmune diseases, in all cases except anti-M. pneumoniae antibodies, the differences compared to the healthy group were also statistically significant: p < 0.0030 for anti-Cpn antibodies, p < 0.001 for anti- Y. enterolitica antibodies, p =0.018 for anti-Hp, p = 0.499 for anti-M. pneumoniae and p < 0.0001 for anti-E.coli antibodies (Supplementary Figures 1-5).
The concentration of antibacterial antibodies in the sera of patients with ALC was at the level of the healthy group, and no significant statistical difference was found: p = 0.584 for anti-Cpn antibodies, p = 0.099 for anti- Y. enterolitica antibodies, p =0.694 for anti-Hp, p = 0.276 for anti- M. pneumoniae and p = 0.148 for anti- E.coli antibodies (Supplementary Figures 1-5).
In sera of patients with positive AMA, specific for PBC, antibodies directed against bacterial antigens have been found in 80% vs. 50% in sera with AMA negative. Distribution of the antibodies to these bacterial antigens in PBC AMA M2 positive and AMA M2 negative patients has been shown in Figures 6–8. The mean level of, anti-Hp, M. pneumoniae and anti- Y. enterolitica antibodies in the PBC AMA M2 positive group was significantly higher than those in the AMA M2 negative group 64 ± 20 vs. 35 ± 10 RU/ml, p < 0.0001; 40 ± 31 vs. 16 ± 3 RU/ml, p = 0.005 and 65 ± 53 vs. 27 ± 8 RU/ml; p = 0.009, respectively. However, the level of antibodies against Cpn and E.coli in both groups was not statistically different.
Figure 6
Figure 7
Figure 8
Seroprevalence of anti-Ch. pneumoniae antibodies and anti-Hp antibodies were definitely higher in PBC patients with AMA positive than in PBC patients without AMA, p=0.047 and p=0.038, respectively. Among patients with AMA-negative PBC, the presence of anti-Ch. pneumoniae antibodies were found in 50% and anti-Hp antibodies were found in 63% of patients (Supplementary Figures 6, 7). Anti-M. pneumoniae antibodies and anti-Y. enterolitica. antibodies were positive only in PBC patients with AMA positive, p=0.022 (Supplementary Figures 8, 9) In PBC sera of patients with positive AMA, antibodies directed against E.coli antigen have been found in 74% vs. 50% in sera with AMA negative.
We evaluated the correlation of individual patient values against each other shown them in Table 4. The levels of AMA M2 antibodies versus the levels of anti-Cpn, AMA M2 antibodies versus the levels of anti-Y. enterolitica, AMA M2 antibodies versus anti-Hp, AMA M2 antibodies versus anti-M. pneumoniae and AMA M2 versus anti-E.coli. Also mutual relationship between these measured antibacterial antibodies has been presented (Table 4).
Table 4
| Anti-Ch. pneumoniae | Anti-H. pylori | Anti-M. neumoniae | Anti- Y. enterolitica | Anti- E. coli | |
|---|---|---|---|---|---|
| AMA M2 | r = 0.28 p = 0.017 | r = 0.51 p < 0.001 | r = 0.69 p < 0.001 | r = 0.61 p < 0.001 | r = 0.45 p < 0.001 |
| Anti- Ch. pneumoniae | r = 0.40 p < 0.001 | r = 0.23 p < 0.003 | r = 0.20 p < 0.061 | r = 0.58 p < 0.001 | |
| Anti-H. pylori | r = 0.52 p < 0.001 | r = 0.39 p < 0.001 | r = 0.33 p < 0.001 | ||
| Anti- M. pneumoniae | r = 0.65 p < 0.001 | r = 0.28 p < 0.008 | |||
| Anti- Y. enterolitica | r = 0.18 p < 0.080 |
Relationship between measured antibacterial antibodies and AMA M2 antibodies.
Detection of inhibition of antibody-antigen binding
We noticed inhibition of specific antigen-antibody binding to the human PDC M2 antigen by the bacterial peptides: EClpP and adenine glycosylase from E. coli caseinolytic protease P, ClpP Y.e from the peptide of Y. enterolitica and Mp PDC from M. pneumonia peptide (Figure 9). Reactivity to the EClpP peptide was detected in 39 out of the 92 sera PBC patients (42%), to the ClpP Y.e was determined in 28 out of 92 sera PBC patients (30%). The immunological activity of bacterial peptides expressed as the amount of protein needed to inhibit 50% of the binding of autoantibodies to the human PDC M2 antigen were 12 µg/mL for EClpP and 30 µg/mL for ClpP Y.e. The inhibition of autoantibody-antigen binding by MpPDC was much weaker. For the bacterial peptides E.coli peptide - adenine glycosylase of E.coli amount of protein necessary to obtain 50% inhibition of autoantibody binding to the gp210 antigen was 14 µg/mL (Figure 10).
Figure 9
Figure 10
We observed inhibition of specific antigen-antibody binding to the human KLHL12 protein by the bacterial peptide: adhesin A (YadA) from Yersinia (Figure 11). Reactivity to the YadA peptide was detected in 27 out of the 92 sera PBC patients (29%). The immunological activity of bacterial peptides expressed as the amount of protein needed to inhibit 50% of the binding of autoantibodies to the human KLHL12 antigen was 70 µg/mL.
Figure 11
We studied also, the inhibition of antibody binding to human HK-1 protein by bacterial peptide – caseinolytic protease subunit X of borrelia Burgdorferi and we observed the immunological activity of this bacterial peptides – the inhibition 50% of the binding of autoantibodies to the human HK1 antigen was 150 µg/mL.
Discussion
Environmental factors‐mediated activation of autoimmune response and subsequent autoimmunity disease, including PBC could be caused through molecular mimicry, bystander activation, or both (Principi et al., 2017; Tanaka et al., 2019). The phenomenon of molecular mimicry includes in its structure the similarity of the antigenic determinants of the causative agent (microbial, xenobiotic) to the epitopes of some host proteins, which initiates an immunological cross-reaction. There is an association between PBC and exposure to specific infections (Münz et al., 2009). It is supposed that the development of AMA in PBC may be the effect of contact with infectious agents. Kikuchi et al. incubated peripheral blood mononuclear cells of PBC patients with short non-protein CpG-DNA sequences (unmethylated cytosine-phosphate-guanine - CpG motifs), commonly present in the cells of various bacteria. An increase in the number of activated B lymphocytes was found in PBC patients (Kikuchi et al., 2005).
We tried to determine the association between tested infectious agents and AMA status, in the light of the mechanism of cross-reactivity of microbial and human PDC-E2. We studied whether the presence of anti-infectious agents - Abs found in high frequency in Polish PBC patients (and their co-occurrences) correlates with the presence of anti-mitochondrial antibodies. The prevalence of anti-infectious antibodies was significantly elevated among our PBC patients when compared with controls. We observed also high levels of anti-Ch. pneumoniae, anti-Y. enterocolitica, anti-H. pylori, anti- M. pneumoniae and E.coli antibodies in sera of patients with PBC. But reactivity was also detected in the sera of AMA-negative PBC patients, while control sera did not react against bacterial proteins. Anti-M. pneumoniae antibodies and anti-Y. enterolitica. antibodies were positive only in PBC patients with AMA positive, but anti-Ch. pneumoniae antibodies and anti-H. pylori antibodies we determined also in the sera of AMA-negative PBC patients. Tanaka et al. also made similar observations (Tanaka et al., 2019). Jun Zhang et al. found high levels of autoantigen-specific peripheral plasma blasts, suggesting activation of memory B cells (Zhang et al., 2014).
Cpn plays a role in autoimmune diseases such as multiple sclerosis or primary sclerosing cholangitis (Layh-Schmitt et al., 2000; Ponsioen et al., 2002). A high Cpn IgG level indicates a past infection. The study of Lamacchia et al. describes a potential role of past chlamydial infection in the development of RA (Rheumatoid arthritis) (Lamacchia et al., 2023). In our study, about 70% of PBC patients have anti-Cpn antibodies. Their occurrence and mean levels were higher than in healthy and pathological controls. This is why it could be concluded that Cpn infection could be a potential cause of PBC. Hai-Ying Liu et al. also reported that up to 68.3% PBC patients were infected with Cpn (Liu et al., 2005). The first study showing that Ch. pneumoniae antigens were noticed more frequently in the livers of PBC patients compared to control groups was performed by Abdulkarim et al. ().
We have shown that there may be a relationship between PBC and a form of chronic Y. enterocolitica. Anti-Y. enterocolitica antibodies were positive only in PBC patients with AMA positive. We noticed inhibition of specific antigen-autoantibody binding by the bacterial ClpP from Y. enterolitica. Research on the influence of Y. enterolitica on the development of PBC has already been undertaken by Roesler et al. (Roesler et al., 2003). The authors did not demonstrate that this bacterial factor triggers PBC. They attempted to identify the β-subunit of bacterial RNA-Polymerase—a non-species-specific bacterial protein as a target of antibodies in PBC and rather suggested that antibodies to the β-subunit of bacterial RNA polymerase belong to the pool of natural antibodies, the level of which can be elevated in autoimmune liver diseases. A little earlier the PBC-specificity of anti-microbial ClpP reactivity was confirmed by Bogdanos et al (). Fang et al. discussed the recent data on how Y. enterocolitica may link to the pathogenesis of Crohn’s disease ().
Positive anti-M. pneumoniae antibodies we found also only in PBC patients with AMA positive. The mean level of antibodies directed against these bacterial antigens in sera of patients with PBC was also higher than in other studied groups with a significant difference. Mycoplasma antigens as a probable trigger for the induction of antimitochondrial antibodies in PBC was also found by Berg et al. (). They concluded that patients with PBC demonstrate a higher occurrence of Mp PDC-E2-related antibodies and, molecular mimicry between surface molecules of mycoplasma and epitopes of the autoantigen can play a main role in the etiopathology of PBC. In turn, Iwasa et al. studied autoimmune neurological diseases and found that the difference of anti-acetylcholine receptor antibody titer in myasthenia gravis is connected to incidence of M. pneumoniae and influenza virus (Iwasa et al., 2018). The level of antibodies against Y. enterolitica and M. pneumoniae correlated best with the level of AMA M2 antibodies in the sera of our patients.
The work of Abenavoli et al. suggests a pathogenetic role of increased intestinal permeability in the course of H. pylori infection and the role of infection in the development of PBC (). Perhaps H. pylori penetrates the bile ducts, causing some predisposed patients to develop an autoimmune disease. Wang et al. provide the latest review of current support or opposition for H. pylori as a factor in autoimmune diseases, including autoimmune liver diseases (Wang et al., 2022). The mitochondrial autoepitopic area of pyruvate dehydrogenase complex E2 (PDC-E2) has been similar to urease β of H. pylori, which suggests that H. pylori infection can be linked to the prevalence of PBC. Waluga et al. reached similar conclusions (Waluga et al., 2015). The presence of Hp DNA in liver tissue, and antibodies against the microorganism in the bile and serum of PBC patients were also discovered by Bogdanos et al (). There are also more studies on the intestinal microbial flora, containing more genes than the human genome, which may be an important factor inducing diseases on the intestinal-liver axis, also in the case of Hp (Kummen et al., 2017; ; Tang et al., 2018; Wei et al., 2020). Only a few studies have focused on AIH. H. pylori DNA was determined in the liver tissues of some patients with AIH, but no significant differences were noticed in the comparison between these patients and controls (Smyk et al., 2014). It is known that H. pylori can affect the intestinal microflora and can also cause the translocation of pathogens, which in turn may promote the development of PBC. Kitahata et al. discovered dysbiosis in the mucosa-associated microbiota profile of the small intestine in patients with PBC and typical bacterial overgrowth that has been reported to be associated with PBC (Kitahata et al., 2021). Work by Eamonn and Quigley presents epidemiological, clinical and some experimental evidence for the role of bacteria in the pathogenesis of PBC (). Currently, there is little literature on the impact of gut microbiota on PBC and further research is needed. Works continuing this topic could seem very interesting. In our serological diagnosis, seroprevalence of anti-Hp antibodies in the PBC group were significantly higher than those in healthy control, lower concentrations of antibodies against Hp antigen were observed in the sera of patients with other autoimmune diseases, also with statistically significant difference. AMA positive and AMA negative PBC patients’ sera have been tested for antibodies against multiple infectious agents, including h. pylori by Shapira et al. (Shapira et al., 2012). They also observed, that the prevalence of anti-H. pylori antibodies was significantly elevated among PBC patients when compared with controls. Finally, no differences they observed between AMA negative sera and their AMA positive counterparts with regard to seroprevalence of the investigated infectious agent, but they suggested that exposure to infectious agents may contribute to PBC risk.
The relationship between among others infection, like vaginal infection and PBC was studied by Gershwin et al (). They showed a higher incidence of PBC associated with a history of vaginal infection (P value = 0.0018). However, only UTI, no vaginal infection has been presented as a possible risk factor at PBC. Additionally, we also checked the presence of antibodies against Chlamydia trachomatis. We did not find any significant statistical differences, so we did not take this infectious agent into explanation in the next research. The pathogen that is detected in most UTI patients is E. coli. Tanaka et al. and Wang et al. discovered that E. coli infection may lead to the recognition of self-antigens by autoreactive T cells and B cells (Wang et al., 2014; Tanaka et al., 2019). An E. coli infection, may be associated with PBC through molecular mimicry between human and bacterial PDC-E2. Floreani et al. observed that E. coli infection may be a factor that breaks the immunological tolerance to the mitochondrial autoantigen, resulting in the production of AMA (). PDC-E2 is highly conserved in both prokaryotes and higher organisms. E. coli PDC-E2 titers in the serum of some patients were lower, and in others, they appeared later in the disease than human PDC-E2. Therefore, it seems that other bacteria may also be involved in the etiopathogenesis of PBC, also through molecular mimicry (Tanaka et al., 2019). The cross-reaction of antibodies against the human mitochondrial pyruvate dehydrogenase complex with the E. coli pyruvate dehydrogenase complex in PBC has already been reported by Bogdanos et al. (). Hou et al. presented the TCRβ repertoire of memory T cells and suggested a potential role of Escherichia coli in the pathogenesis of primary biliary cholangitis (Hou et al., 2019). The bacterial peptides of E.coli, Yersinia enterolitica and M. pneumoniae with a similar structure to human PDC-E2 react with sera from patients with PBC. We have demonstrated that PDC-E2 cross-reacts with homologous sequence in E. coli PDC-E2. Recent studies demonstrate that contact with E. coli induces specific antibodies against ePDC-E2, resulting in determinant spreading and the development of classic autoantibodies, leading to the development of PBC (Yang et al., 2022). We also observed the influence of antibody binding to PDC-E2 and gp210 antigens by bacterial agents. The level of anti-E.coli antibodies in patients with AMA M2 positive and AMA M2 negative PBC was not characterized by a significant statistical difference, therefore it seems that molecular mimicry between the bacterial antigen and the specific gp210 antigen may play an additional role.
We have included to the manuscript our pilot studies on possible molecular mimicry between the sequence of PBC-specific antigens discovered a few years ago (KLHL12 and HK1) and bacterial pathogens. We explored novel protein candidates in Yersinia enterolitica - adhesin A, based on probability of molecular mimicry between YadA (NSVAIGXXS) and KLHL12 (SVAPMNURRG) and caseinolytic protease subunit X of borrelia Burgdorferi based on probability of molecular mimicry between this bacterial pathogen and HK1. Future studies are needed to clarify this link, because no research has yet been conducted on the relationship between these PBC-specific antigens and infectious agents.
We also read interesting articles discussing autoimmune diseases following viral infections. Among other things, there have been works on autoimmune hepatitis after infection with the SARS-CoV-2 virus (Kabaçam et al., 2021; Marabotto et al., 2021). The authors suggest that an increase in the level of inflammatory cytokines, including INF-α (tumor necrosis factor-α), INF- γ (interferon-γ), and IL-10 (interleukin-10), after SARS-CoV-2 infection initiates autoimmune disease (Rodríguez et al., 2020). Marabotto et al. and Boettler et al.and Lee et al. showed that SARS-CoV-2-specific CD8+ T cells can cause AIH-like conditions after infection (Marabotto et al., 2021; ; Lee et al., 2022). However, there are no data related to the development of primary biliary cholangitis after SARS-CoV-2 infection, but it seems that a similar mechanism may occur. The interaction between bacteria and host cells also modulates the immune system and results in the release of one or more cytokines. Chlamydia pneumonia for example might be a factor initiating the cytokine cascade in PBC. The bacterium may infect and live in number of the host cells (including circulating monocytes, tissue macrophages, or endothelial cells). If human immune system is unable to eliminate Chlamydia pneumoniae, the inflammation progresses to a self-supporting chronic process, in which are essentially involved macrophages infiltrating also liver tissue, increased synthesis of the pro-inflammatory cytokines. H. pylori having cag PAI stimulate epithelial cell lines to secrete large amounts of the pro-inflammatory cytokine IL-8. H. pylori infection increases the concentration of many pro-inflammatory cytokines, including IFN-γ TNF-α, IL-1β, IL-6, IL-7,IL-8,IL-12 and IL-18. The release of chemoattractants contributes to the infiltration of immune cells, especially neutrophils, which contributes to the exacerbation of inflammatory processes and cell destruction by free oxygen radicals (Moyat and Velin, 2014). In pulmonary infection, large numbers of neutrophils and lymphocytes accumulate in the alveolar fluid. CD4+ cells, B lymphocytes and plasma cells infiltrate the lungs. Immune response is a consequence of lymphocyte proliferation, Ig production, secretion of TNF-α, IFN-γ and interleukins (Mettelman et al., 2022). The release of pro-inflammatory cytokines in M. pneumoniae infections causes exacerbation of the chronic disease process in the lungs or contributes to a weakened immune response, resulting in epitope spreading to other organs. In epitope spreading, the immune response to a persisting pathogen, or direct lysis of self-tissue by the persisting pathogen, causes damage to self-tissue. Antigens released from damaged tissue are taken up by APCs, and this initiates an immune response directed towards self-antigens.
Our study also has some limitations. We attempted to link the concept of molecular mimicry in autoimmune development to M. pneumoniae and Y. enterolitica, observing positive antibody results only in AMA-positive PBC patients. Really, AMA-positive patients (85%) constitute a significant portion of PBC cases. The observed positivity rates for these antibodies (39% for M.p, 40% for Y. e) among PBC patients do not exceed half of the AMA-positive population. It would be interesting to study the presence of these antibodies in a larger population of AMA negative PBC patients, but it is very difficult to collect a large group of such patients. The scattered antibody levels anti-Mycoplasma pneumoniae level in studied group may suggest the need for cautious interpretation of the findings. Unfortunately, we did not have the opportunity to histologically evaluate liver biopsies from our patients for the presence of bacterial antigens. It would certainly be interesting to compare the serological results with the presence of pathogens in the biopsy sample. But on the other hand, our intention was to focus on non-invasive methods and material available after basic tests laboratory tests assessing the condition of the liver in PBC (biochemistry, autoantibodies), such as serum. We wanted to obtain as much information as possible from the patient’s serum.
In conclusion, as previously suggested, PBC is an autoimmune disease influenced by both genetic predisposing factors and environmental factors. It is very likely that these factors may not only vary from patient to patient, but may also be related to geographic location. What is new is that Polish patients were tested; previously, such tests had not been carried out in Poland. In a group of Polish patients with PBC, bacterial infection, especially E. coli infection, but also Ch. pneumoniae, Y. enterolitica, H. pylori, and M. pneumoniae infections may be also associated with the development of autoimmune disease through molecular mimicry between human and bacterial proteins
Statements
Data availability statement
The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.
Ethics statement
The studies involving human participants were reviewed and approved by Ethical Committee of the Centre of Postgraduate Medical Education, Warsaw (approval number 71/PB/2019). The studies were conducted in accordance with the local legislation and institutional requirements. The human samples used in this study were acquired from primarily isolated as part of your previous study for which ethical approval was obtained. Written informed consent for participation was not required from the participants or the participants’ legal guardians/next of kin in accordance with the national legislation and institutional requirements.
Author contributions
AB: Conceptualization, Data curation, Formal analysis, Funding acquisition, Investigation, Methodology, Project administration, Supervision, Validation, Visualization, Writing – original draft, Writing – review & editing. AH: Data curation, Formal analysis, Resources, Writing – review & editing.
Funding
The author(s) declare financial support was received for the research, authorship, and/or publication of this article. The study was supported by grant: 501-1-025-01-24 from the Centre of Postgraduate Medical Education, Warsaw, Poland.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcimb.2024.1410282/full#supplementary-material
References
1
AbdulkarimA. S.PetrovicL. M.KimW. R.AnguloP.LloydR. V.LindorK. D. (2004). Primary biliary cirrhosis: an infectious disease caused by Chlamydia pneumoniae? J. Hepatol.40, 380–384. doi: 10.1016/j.jhep.2003.11.033
2
AbenavoliL.ArenaV.GiancottiF.VecchioF. M.AbenavoliS. (2010). Celiac disease, primary biliary cirrhosis and helicobacter pylori infection: one link for three diseases. Int. J. Immunopathol. Pharmacol.23, 1261–1265. doi: 10.1177/039463201002300431
3
AdolphT. E.GranderC.MoschenA. R.TilgH. (2018). Liver-microbiome axis in health and disease. Trends Immunol.39, 712–723. doi: 10.1016/j.it.2018.05.002
4
BauerA.HabiorA.GawelD. (2022). Diagnostic and clinical value of specific autoantibodies against kelch-like 12 peptide and nuclear envelope proteins in patients with primary biliary cholangitis. Biomedicines10, 801. doi: 10.3390/biomedicines10040801
5
BauerA.HabiorA.WieszczyP.GawelD. (2021). Analysis of autoantibodies against promyelocytic leukemia nuclear body components and biochemical parameters in sera of patients with primary biliary cholangitis. Diagnostics (Basel)11, 587. doi: 10.3390/diagnostics11040587
6
BergC. P.KannanT. R.KleinR.GregorM.BasemanJ. B.WesselborgS.et al. (2009). Mycoplasma antigens as a possible trigger for the induction of antimitochondrial antibodies in primary biliary cirrhosis. Liver Int.29, 797–809. doi: 10.1111/j.1478-3231.2008.01942.x
7
BoettlerT.CsernalabicsB.SaliéH.LuxenburgerH.WischerL.Salimi AlizeiE.et al. (2022). SARS-CoV-2 vaccination can elicit a CD8 T-cell dominant hepatitis. J. Hepatol.77, 653–659. doi: 10.1016/j.jhep.2022.03.040
8
BogdanosD. P.BaumH.GrassoA.OkamotoM.ButlerP.MaY.et al. (2004). Microbial mimics are major targets of crossreactivity with human pyruvate dehydrogenase in primary biliary cirrhosis. J. Hepatol.40, 31–39. doi: 10.1016/s0168-8278(03)00501-4
9
BogdanosD. P.BaumH.OkamotoM.MontaltoP.SharmaU. C.RigopoulouE. I.et al. (2005). Primary biliary cirrhosis is characterized by IgG3 antibodies cross-reactive with the major mitochondrial autoepitope and its Lactobacillus mimic. Hepatology42, 458–465. doi: 10.1002/hep.20788
10
BogdanosD. P.BaumH.SharmaU. C.GrassoA.MaY.BurroughsA. K.et al. (2002). Antibodies against homologous microbial caseinolytic proteases P characterise primary biliary cirrhosis. J. Hepatol.36, 14–21. doi: 10.1016/s0168-8278(01)00252-5
11
BogdanosD. P.BaumH.VerganiD.BurroughsA. K. (2010). The role of E. coli infection in the pathogenesis of primary biliary cirrhosis. Dis. Markers29, 301–311. doi: 10.3233/DMA-2010-0745
12
BogdanosD. P.VerganiD. (2009). Bacteria and primary biliary cirrhosis. Clin. Rev. Allergy Immunol.36, 30–39. doi: 10.1007/s12016-008-8087-9
13
ChenB. H.WangQ. Q.ZhangW.ZhaoL. Y.WangG. Q. (2016). Screening of anti-mitochondrial antibody subtype M2 in residents at least 18 years of age in an urban district of Shanghai, China. Eur. Rev. Med. Pharmacol. Sci.20, 2052–2060.
14
ChenR. C.NaiyanetrP.ShuS. A.WangJ.YangG. X.KennyT. P.et al. (2013). Antimitochondrial antibody heterogeneity and the xenobiotic etiology of primary biliary cirrhosis. Hepatology57, 1498–1508. doi: 10.1002/hep.26157
15
DonaldsonP. T.BaragiottaA.HeneghanM. A.FloreaniA.VenturiC.UnderhillJ.Aet al. (2006). HLA class II alleles, genotypes, haplotypes, and amino acids in primary biliary cirrhosis: A large-scale study. Hepatology44, 667–674. doi: 10.1002/hep.21316
16
DronamrajuD.OdinJ.BachN. (2010). Primary biliary cirrhosis: Environmental risk factors. Dis. Markers29, 323–328. doi: 10.3233/DMA-2010-0770
17
EamonnM.QuigleyM. (2016). Primary biliary cirrhosis and the microbiome. Semin. Liver Dis.36, 349–353. doi: 10.1055/s-0036-1594006
18
ErgencI.GozaydinogluB.KeklikkiranC.YilmazY. (2023). The risk of development of primary biliary cholangitis among incidental antimitochondrial M2 antibody-positive patients. Hepatol. Forum4, 69–73. doi: 10.14744/hf.2023.2023.0016
19
European Association for the Study of the Liver (2017). EASL Clinical Practice Guidelines: The diagnosis and management of patients with primary biliary cholangitis. J. Hepatol.67, 145–172. doi: 10.1016/j.jhep.2017.03.022
20
FangX.KangL.QiuY. F.LiZ. S.BaiY. (2023). Yersinia enterocolitica in Crohn’s disease. Front. Cell Infect. Microbiol.13. doi: 10.3389/fcimb.2023.1129996
21
FloreaniA.LeungP. S.GershwinM. E. (2016). Environmental basis of autoimmunity. Clin. Rev. Allergy Immunol.50, 287–300. doi: 10.1007/s12016-015-8493-8
22
GershwinM. E.SelmiC.WormanH. J.GoldE. B.WatnikM.UttsJ.et al. (2005). Risk factors and comorbidities in primary biliary cirrhosis: a controlled interview-based study of 1032 patients. Hepatology42, 1194–1202. doi: 10.1002/hep.20907
23
GranitoA.MuratoriL.TovoliF.MuratoriP. (2021). Autoantibodies to speckled protein family in primary biliary cholangitis. Allergy Asthma Clin. Immunol.17, 35. doi: 10.1186/s13223-021-00539-0
24
HimotoT.YamamotoS.MorimotoK.TadaS.MimuraS.FujitaK.et al. (2021). Clinical impact of antibodies to Sp100 on a bacterial infection in patients with primary biliary cholangitis. J. Clin. Lab. Anal.35, e24040. doi: 10.1002/jcla.24040
25
HitomiY.NakamuraM. (2023). The genetics of primary biliary cholangitis: A GWAS and post-GWAS update. Genes14, 405. doi: 10.3390/genes14020405
26
HouX. L.YangY. D.ChenJ. N.JiaH. Y.ZengP.LvL. X.et al. (2019). TCRβ repertoire of memory T cell reveals potential role for Escherichia coli in the pathogenesis of primary biliary cholangitis. Liver Int.39, 956–966. doi: 10.1111/liv.14066
27
InvernizziP.SelmiC.PoliF.FrisonS.FloreaniA.AlmasioPet al. (2008). Human leukocyte antigen polymorphisms in italian primary biliary cirrhosis: A multicenter study of 664 patients and 1992 healthy controls. Hepatology48, 1906–1912. doi: 10.1002/hep.22567
28
IwasaK.YoshikawaH.HamaguchiT.SakaiK.Shinohara-NoguchiM.SamurakiM.et al. (2018). Time-series analysis: variation of anti-acetylcholine receptor antibody titer in myasthenia gravis is related to incidence of Mycoplasma pneumoniae and influenza virus infections. Neurological Res.40, 102–109. doi: 10.1080/01616412.2017.1407021
29
JangE. S.KimK. A.KimY. S.KimI. H.LeeB. S.LeY. J. (2021). Effectiveness and safety of elbasvir/grazoprevir in Korean patients with hepatitis C virus infection: a nationwide real-world study. J. Intern. Med.36, S1–S8. doi: 10.3904/kjim.2019.357
30
JuranB. D.LazaridisK. N. (2008). Genetics and genomics of primary biliary cirrhosis. Clin. Liver Dis.12, 349–365. doi: 10.1016/j.cld.2008.02.007
31
JuranB. D.LazaridisK. N. (2014). Environmental factors in primary biliary cirrhosis. Semin. Liver Dis.34, 265–272. doi: 10.1055/s-0034-1383726
32
KabaçamG.WahlinS.EfeC. (2021). Autoimmune hepatitis triggered by COVID-19: a report of two cases. Liver Int.41, 2527–2528. doi: 10.1111/liv.15044
33
KikuchiK.LianZ. X.YangG. X.AnsariA. A.IkeharaS.KaplanM.et al. (2005). Bacterial CpG induces hyper-IgM production in CD27(+) memory B cells in primary biliary cirrhosis. Gastroenterology128, 304–312. doi: 10.1053/j.gastro.2004.11.005
34
KitahataS.YamamotoY.YoshidaO.TokumotoY.KawamuraT.FurukawaS.et al. (2021). Ileal mucosa-associated microbiota overgrowth associated with pathogenesis of primary biliary cholangitis. Sci. Rep.11, 19705. doi: 10.1038/s41598-021-99314-9
35
KummenM.HolmK.AnmarkrudJ. A.NygårdS.VesterhusM.HøivikM. L.et al. (2017). The gut microbial profile in patients with primary sclerosing cholangitis is distinct from patients with ulcerative colitis without biliary disease and healthy controls. GUT66, 611–619. doi: 10.1136/gutjnl-2015-310500
36
LamacchiaC.AymonR.HattelB. C.AebyS.Kebbi-BeghdadiC.GilbertB.et al. (2023). A potential role for chlamydial infection in rheumatoid arthritis development. Rheumatology13, kead682. doi: 10.1093/rheumatology/kead682
37
Layh-SchmittG.BendlC.HildtU.Dong-SiT.JüttlerE.SchnitzlerP.et al. (2000). Evidence for infection with Chlamydia pneumoniae in a subgroup of patients with multiple sclerosis. Ann. Neurol.47, 652–655. doi: 10.1002/1531-8249(200005)47:5<652::AID-ANA15>3.0.CO;2-5
38
LeeS. K.KwonJ. H.YoonN.LeeS. H.SungP. S. (2022). Immune-mediated liver injury represented as overlap syndrome after SARS-CoV-2 vaccination. J. Hepatol.77, 1209–1211. doi: 10.1016/j.jhep.2022.06.029
39
LeungP. S.ChoiJ.YangG.WooE.KennyT. P.GershwinM. E. (2016). A contemporary perspective on the molecular characteristics of mitochondrial autoantigens and diagnosis in primary biliary cholangitis. Expert Rev. Mol. Diagn.16, 697–705. doi: 10.1586/14737159.2016.1164038
40
LiuH. Y.DengA. M.ZhangJ.ZhouY.YaoD. K.TuX. Q.et al. (2005). Correlation of Chlamydia pneumoniae infection with primary biliary cirrhosis. World J. Gastroenterol.11, 4108–4110. doi: 10.3748/wjg.v11.i26.4108
41
LuleS.ColpakA. I.Balci-PeynirciogluB.Gursoy-OzdemirY.PekerS.KalyoncuU.et al. (2017). Disease serum is immunoreactive to neurofilament medium which share common epitopes to bacterial HSP-65, a putative trigger. J. Autoimmun84, 87–96. doi: 10.1016/j.jaut.2017.08.002
42
MaW. T.ChangC.GershwinM. E.LianZ. X. (2017). Development of autoantibodies precedes clinical manifestations of autoimmune diseases: a comprehensive review. J. Autoimmune83, 95–112. doi: 10.1016/j.jaut.2017.07.003
43
MarabottoE.ZiolaS.SheijaniA. D.GianniniE. G. (2021). COVID-19 and liver disease: not all evil comes to harm. Liver Int.41, 237–238. doi: 10.1111/liv.14721
44
MatsumotoK.OhfujiS.AbeM.KomoriA.TakahashiA.FujiiH.et al2022. Environmental factors, medical and family history, and comorbidities associated with primary biliary cholangitis in Japan: a multicenter case-control study. J. Gastroenterol.57, 19–29. doi: 10.1007/s00535-021-01836-6
45
MettelmanR. C.AllenE. K.ThomasP. G. (2022). Mucosal immune responses to infection and vaccination in the respiratory tract. Immunity55, 749–780. doi: 10.1016/j.immuni.2022.04.013
46
MoyatM.VelinD. (2014). Immune responses to Helicobacter pylori infection. World J. Gastroenterol.20, 5583–5593. doi: 10.3748/wjg.v20.i19.5583
47
MünzC.LünemannJ. D.GettsM. T.MillerS. D. (2009). Antiviral immune responses: triggers of or triggered by autoimmunity? Nat. Rev. Immunol.9, 246–258. doi: 10.1038/nri2527
48
NormanG. L.YangC.-Y.OstendorffH. P.ShumsZ.LimM. J.WangJ.et al. (2015). Anti-kelch-like 12 and anti-hexokinase 1: Novel autoantibodies in primary biliary cirrhosis. Liver Int.35, 642–651. doi: 10.1111/liv.12690
49
PonsioenC. Y.DefoerJ.Ten KateF. J.WeverlingG. J.TytgatG. N.PannekoekY.et al. (2002). A survey of infectious agents as risk factors for primary sclerosing cholangitis: are Chlamydia species involved? Eur. J. Gastroenterol. Hepatol.14, 641–648. doi: 10.1097/00042737-200206000-00009
50
PrincipiN.BerioliM. G.BianchiniS.EspositoS. (2017). Type 1 diabetes and viral infections: What is the relationship? J. Clin. Virol.96, 26–31. doi: 10.1016/j.jcv.2017.09.003
51
RodríguezY.NovelliL.RojasM.De SantisM.Acosta-AmpudiaY.MonsalveD. M.et al. (2020). Autoinflammatory and autoimmune conditions at the crossroad of COVID-19. J. Autoimmun114, 102506. doi: 10.1016/j.jaut.2020.102506
52
RoeslerK. W.SchmiderW.KistM.BatsfordS.SchiltzE.OelkeetM.et al. (2003). Identification of β-subunit of bacterial RNA-polymerase—A non-species-specific bacterial protein—As target of antibodies in primary biliary cirrhosis. Dig Dis. Sci.48, 561–569. doi: 10.1023/A:1022501102877
53
ShapiraY.Agmon-LevinN.RenaudineauY.Porat-KatzB. S.BarzilaiO.RamM.et al. (2012). Serum markers of infections in patients with primary biliary cirrhosis: evidence of infection burden. Exp. Mol. Pathol.93, 386–390. doi: 10.1016/j.yexmp.2012.09.012
54
SmykD. S.KoutsoumpasA. L.MytilinaiouM. G.RigopoulouE. I.SakkasL. I.BogdanosD. P. (2014). Helicobacter pylori and autoimmune disease: cause or bystander. World J. Gastroenterol.20, 613–629. doi: 10.3748/wjg.v20.i3.613
55
SmykD. S.RigopoulouE. I.LleoA.AbelesR. D.MavropoulosA.BillinisetC.et al. (2011). Immunopathogenesis of primary biliary cirrhosis: an old wives’ tale. Immun. Ageing8, 12. doi: 10.1186/1742-4933-8-12
56
TanakaA.LeungP. S.GershwinM. E. (2018). Environmental basis of primary biliary cholangitis. Exp. Biol. Med.243, 184–189. doi: 10.1177/1535370217748893
57
TanakaA.LeungP. S. C.GershwinM. E. (2019). Pathogen infections and primary biliary cholangitis. Clin. Exp. Immunol.195, 25–34. doi: 10.1111/cei.13198
58
TanakaT.ZhangW.SunY.ShuaiZ.ChidaA. S.KennyT. P.et al. (2017). Autoreactive monoclonal antibodies from patients with primary biliary cholangitis recognize environmental xenobiotics. Hepatology66, 885–895. doi: 10.1002/hep.29245
59
TanakaaA.LeungP. S.YoungH. A.GershwinM. E. (2017). Toward solving the etiological mystery of primary biliary cholangitis. Hepatol. Commun.1, 275–287. doi: 10.1002/hep4.1044
60
TangR.WeiY.LiY.ChenW.ChenH.WangQ.et al. (2018). Gut microbial profile is altered in primary biliary cholangitis and partially restored after UDCA therapy. GUT67, 534–541. doi: 10.1136/gutjnl-2016-313332
61
TrivellaJ.JohnB. V.LevyC. (2023). Primary biliary cholangitis: Epidemiology, prognosis, and treatment. Hepatol. Commun.7, e0179. doi: 10.1097/HC9.0000000000000179
62
WalugaM.KuklaM.ŻorniakM.BacikA.KotulskiR. (2015). From the stomach to other organs: helicobacter pylori and the liver. World J. Hepatol.7, 2136–2146. doi: 10.4254/wjh.v7.i18.2136
63
WangL.CaoZ.-M.ZhangL.-L.DaiX.-c.LiuZ.-j.ZengY.-X.et al. (2022). Helicobacter pylori and autoimmune diseases: involving multiple systems. Front. Immunol.13. doi: 10.3389/fimmu.2022.83342
64
WangZ.LiY.RenL.LiY.XuT.LiWet al (2023). Diagnostic and prognostic value of quantitative detection of antimitochondrial antibodies subtype M2 using chemiluminescence immunoassay in primary biliary cholangitis. CCLM62, e53–e55. doi: 10.1515/cclm-2023-0742/html
65
WangZ.LiY.RenL.LiY.XuT.LiW.et al. (2024). Clinical performance of AMA-M2, anti-gp210 and anti-sp100 antibody levels in primary biliary cholangitis: when detected by multiplex bead-based flow fluorescent immunoassay. Immun. Inflammation Dis.12, e1161. doi: 10.1002/iid3.1161
66
WangJ. J.YangG. X.ZhangW. C.LuL.TsuneyamaK.KronenbergM.et al. (2014). Escherichia coli infection induces autoimmune cholangitis and anti-mitochondrial antibodies in non-obese diabetic (NOD).B6 (Idd10/Idd18) mice. Clin. Exp. Immunol.175, 192–201. doi: 10.1111/cei.12224
67
WeiY.LiY.YanL.SunC.MiaoQ.WangQ.et al. (2020). Alterations of gut microbiome in autoimmune hepatitis. GUT69, 569–577. doi: 10.1136/gutjnl-2018-317836
68
XuQ.ZhuW.YinY. (2023). Diagnostic value of anti-mitochondrial antibody in patients with primary biliary cholangitis: A systemic review and meta-analysis. Med. (Baltimore)102, e36039. doi: 10.1097/MD.0000000000036039
69
YangY.ChoiJ.ChenY.InvernizziP.YangG.ZhangW.et al. (2022). E. coli and the etiology of human PBC: Antimitochondrial antibodies and spreading determinants. Hepatology75, 266–279. doi: 10.1002/hep.32172
70
YouH.MaX.EfeC.WangG.JeongS. H.AbeK.et al. (2022). APASL clinical practice guidance: the diagnosis and management of patients with primary biliary cholangitis. Hepatol. Int.16, 1–23. doi: 10.1007/s12072-021-10276-6
71
ZhangJ.ZhangW.LeungP. S.BowlusC. L.DhaliwalS.CoppelR. L.et al. (2014). Ongoing activation of autoantigen-specific B cells in primary biliary cirrhosis. Hepatology60, 1708–1716. doi: 10.1002/hep.27313
Summary
Keywords
PBC, bacterial infection, autoantibodies, molecular mimicry, autoimmunity
Citation
Bauer A and Habior A (2025) Antibodies directed against bacterial antigens in sera of Polish patients with primary biliary cholangitis. Front. Cell. Infect. Microbiol. 14:1410282. doi: 10.3389/fcimb.2024.1410282
Received
31 March 2024
Accepted
04 December 2024
Published
07 January 2025
Volume
14 - 2024
Edited by
Mariola J. Ferraro, University of Florida, United States
Reviewed by
Sabahat Sarfaraz, Dow University of Health Sciences, Pakistan
Rajna Minic, Institute of Virology, Vaccines and Sera “Torlak”, Serbia
Updates
Copyright
© 2025 Bauer and Habior.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Alicja Bauer, alicja.bauer@cmkp.edu.pl
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.