Abstract
Dengue fever has become a global threat, causing millions of infections every year. An effective vaccine against all four serotypes of dengue virus (DENV) has not been developed yet. Among the different vaccination strategies available today, DNA vaccines are safe and practical, but currently induce relatively weak immune responses in humans. In order to improve immunogenicity, antigens may be targeted to dendritic cells (DCs), the main antigen presenting cells and orchestrators of the adaptive immune response, inducing T and B cell activation. It was previously shown that a DNA vaccine encoding a fusion protein comprised of an antigen and a single-chain Fv antibody (scFv) specific for the DC endocytic receptor DEC205 induced strong immune responses to the targeted antigen. In this work, we evaluate this strategy to improve the immunogenicity of dengue virus (DENV) proteins. Plasmids encoding the scFv αDEC205, or an isotype control (scFv ISO), fused to the DENV2 envelope protein domain III (EDIII) were generated, and EDIII specific immune responses were evaluated in immunized mice. BALB/c mice were intramuscularly (i.m.) immunized three times with plasmid DNAs encoding either scDEC-EDIII or scISO-EDIII followed by electroporation. Analyses of the antibody responses indicated that EDIII fusion with scFv targeting the DEC205 receptor significantly enhanced serum anti-EDIII IgG titers that inhibited DENV2 infection. Similarly, mice immunized with the scDEC-EDIII plasmid developed a robust CD4+ T cell response to the targeted antigen, allowing the identification of two linear epitopes recognized by the BALB/c haplotype. Taken together, these results indicate that targeting DENV2 EDIII protein to DCs using a DNA vaccine encoding the scFv αDEC205 improves both antibody and CD4+ T cell responses. This strategy opens perspectives for the use of DNA vaccines that encode antigens targeted to DCs as a strategy to increase immunogenicity.
Introduction
Dengue virus (DENV) is the causative agent of dengue fever, an infection that has become a serious public health issue. In the last decades, the alarming increase in the number of cases [50–100 million per year, ()] and also the increase in the incidence of more severe clinical forms of the disease (like dengue hemorrhagic fever, DHF or dengue shock syndrome, DSS) led the World Health Organization to prioritize the development of a vaccine against dengue (). DENV is transmitted to humans by the bite of mosquitoes of the genus Aedes (such as Aedes aegypti and Aedes albopictus) infected with one of the four virus serotypes (DENV 1–4) ().
The virus genome is translated into a polyprotein which is processed by virus and host proteases to produce three proteins that make up the viral particle: capsid (C), pre-membrane/membrane (prM/M) and envelope (E), and seven other non-structural proteins, NS1, NS2a, NS2b, NS3a, NS4a, NS4b, and NS5 (). The E protein plays an important role in the protective immunity against DENV as it contains the majority of epitopes that elicit neutralizing antibodies (–). This protein can be divided into three domains: the central domain (EDI), the domain responsible for dimerization containing the fusion peptide (EDII), and the domain that binds to the surface cell receptor (EDIII) (). EDIII has been extensively used in vaccine development for its ability to induce antibodies able to block DENV infection (–). In addition to neutralizing antibodies, T cell responses also play a relevant role in the development of protection. T cells limit the spread of viral infection because they kill infected cells and secrete pro-inflammatory cytokines (, ). IFNγ-secreting Th1 and CX3CR1+ cytotoxic CD4+ T cells are also associated with protection (, ).
Dendritic cells (DCs) are central for immunity induction, activating both T and B cells. These cells are excellent antigen presenting cells (APCs) because of their ability to acquire different antigens (either by pinocytosis, endocytosis, or phagocytosis), when compared to other cell types such as macrophages and B cells (). To accomplish their role as APCs, DCs express a large number of extra and intercellular receptors that are responsible for their ability to “sense” the environment. When they encounter an antigen in the context of infection/inflammation, DCs undergo a maturation process that results in the up-regulation of co-stimulatory and MHCII molecules, and increases their ability to present antigens in the context of MHC I and II ().
The last decades have proven to be extremely prolific for the study of DC biology and function, as different DC subsets were identified both in humans and in mice (). Each subset is normally characterized by the expression of different surface markers. The DEC205 is an endocytic C-type lectin receptor expressed by murine and human DCs in different organs (–) that uptakes antigens and directs them to MHCII rich late endosomes, increasing antigen presentation to CD4+ T cells (). In mice, DEC205+ DCs are resident in the T cell zone of lymphoid organs, and also express the CD8α marker (). The DEC205+CD8α+ DCs were involved in the uptake of dying cells, and in the resistance to some viral infections (–). Antigens derived from different pathogens have been targeted to DEC205+CD8α+ DCs using chimeric anti-DEC205 monoclonal antibodies (mAbs) genetically fused to them, administered in the presence of a DC maturation stimulus (–).
The use of chimeric mAbs to target antigens to different endocytic receptors has become more spread, and this concept was employed in the development of more effective DNA vaccines. These vaccines are usually safe, cheap, easy to produce but may fail to induce strong immune responses, especially in humans (). An improvement in the immune response was obtained after antigen targeting to the DEC205+ DCs using DNA vaccines consisting of plasmids encoding a single chain variable fragment (scFv) fused to the antigen of interest (–). However, other groups have shown that antigen targeting to DEC205+ DCs using DNA vaccines was also able to induce immune tolerance to the antigen of interest and consequently protect against experimental allergic encephalomyelitis ().
In this work, we generated a DNA vaccine encoding the anti-DEC205 scFv fused to DENV2 EDIII (pscDEC-EDIII). Vaccine administration by intramuscular immunization followed by electroporation elicited high titers of anti-EDIII antibodies in mice immunized with pscDEC-EDIII capable of blocking DENV2 infection in VERO cells. In addition, EDIII targeting to DEC205+ DCs within the context of a DNA vaccine elicited specific CD4+ T cell proliferation and pro-inflammatory cytokine production.
Materials and Methods
Plasmid Generation
Constructions of the pcDNA3 scDEC-OVA and scISO-OVA plasmids were described previously (). We digested the DNA fragment encoding ovalbumin (OVA) with the restriction enzymes NotI and XbaI (New England Biolabs) and purified the open vectors with the “PureLink Quick Plasmid DNA” kit (Invitrogen). The sequence corresponding to the ectodomain of the DENV2 envelope protein (HQ026763, lineage DENV-2/BR0690/RJ/2008) was synthetized and cloned into the pUC57 plasmid (Genscript USA Inc.). We amplified the EDIII sequence (aa 297–394) with the primers sense 5′ GGCGGCCGCATGTCCTACTCTATGTGCAC 3′ and anti-sense 5′ TCTAGATCAGTGATGGTGATGGTGATGTTTCTTAAACCAATTCAGCTTC 3′ with the Phusion High Fidelity DNA Polymerase (New England Biolabs) according to the manufacturer's instructions. The anti-sense primer was also designed to insert a 6 × His-tag at the end of the sequence. The PCR product was cloned into the pJET1.2/blunt vector (Thermo Scientific) and digested with the restriction enzymes NotI and XbaI (New England Biolabs). The digestion product was purified with the “PureLink Quick Plasmid DNA” kit (Invitrogen) and cloned in frame with the open reading frames of scDEC and scISO in the pcDNA3 vectors using the T4 DNA ligase enzyme (New England Biolabs). The final vectors, named pscDEC-EDIII and pscISO-EDIII were sequenced to confirm the presence of the EDIII sequence in frame with the antibody sequences. We transformed the plasmids into DH5α bacteria and purified the DNA in large scale using the “EndoFree Plasmid Maxi Kit” (QIAGEN) for subsequently transfection of human embryonic kidney (HEK) 293T cells and mice immunization.
HEK 293T Transient Transfection
The transfection of HEK293T cells was performed as described previously (). After 5 days in culture, the supernatants of cultures transfected with pscDEC-EDIII or pscISO-EDIII were collected, centrifuged at 1,000 × g for 30 min and filtered in 0.22 μM filters (Corning). The samples were concentrated in a dialysis membrane surrounded by sucrose and dialyzed twice in PBS for 4 h at 4°C.
Western Blotting
The scDEC-EDIII or scISO-EDIII containing samples were sorted in a 12% SDS-PAGE gel under reducing conditions. The proteins were transferred to a nitrocellulose membrane (GE Healthcare) and the membrane was blocked overnight at 4°C with PBS containing 0.05% Tween 20 (PBS-T 0.05%), 2.5% BSA and 5% non-fat milk. After three 5-min washes with PBS-T 0.05%, the membrane was incubated with 6x-HIS tag monoclonal antibody (1:5,000; Thermo Fisher Scientific) at room temperature (rt) for 2 h. Next, the membrane was incubated with goat anti-mouse total IgG-HRP antibody (1:2,000; Jackson ImmunoResearch Laboratories) for 2 h at rt and developed using quimioluminescence (ECL kit, GE Healthcare).
CHO-DEC Binding Assay
Transgenic CHO cells stably expressing the mouse DEC205 receptor (kindly provided by Dr. Michel Nussenzweig, The Rockefeller University, New York) were used for the binding assays. One hundred thousand cells were incubated with 4, 2, or 1 μg/mL of the scDEC-EDIII or scISO-EDIII scFvs for 40 min on ice. After two washes with FACS buffer (2% fetal bovine serum in PBS), cells were incubated with the 6x-HIS tag monoclonal antibody (1:5,000; Thermo Fisher Scientific) for 20 min on ice. The cells were washed two times again with FACS buffer and incubated with the anti-mouse IgG-Alexa488 antibody (1:2,000; Life technologies). After another round of washes, the cells were analyzed by flow cytometry and 20,000 events were acquired in the FACSCalibur™ flow cytometer (BD Biosciences).
Mice and Immunization
Six- to eight-weeks-old male BALB/c mice were bred at the Isogenic Mouse Facility of the Parasitology Department, University of São Paulo, Brazil. This study was carried out in accordance with the recommendations of the Federal Law 11.794 (2008), the Guide for the Care and Use of Laboratory Animals of the Brazilian National Council of Animal Experimentation (CONCEA) and the ARRIVE guidelines. The Institutional Animal Care and Use Committee (IACUC) of the University of São Paulo approved the protocol under the following number: 36/2016. Groups of eight animals were immunized with 100 μg of pscDEC-EDIII or pscISO-EDIII diluted in saline (0.9% NaCl). A control group consisting of 4 animals was injected with saline alone. Briefly, the animals were anesthetized by intraperitoneal (i.p) injection of a mixture of Ketamine and Xylazine (100 and 10 mg/kg, respectively). Next, the skin over the hind leg was sterilized with ethanol and the injections were carried out intramuscularly (i.m.) in the anterior tibial muscle of the mice followed immediately by electroporation. For the electroporation, two 130 V pulses with 1 ms duration and four 70 V pulses with 50 ms duration were applied with the CUY560-5-0.5 electrode using the NEPA21 Super Electroporator (Nepa Gene Co., Ltd.). The interval between each pulse was 450 ms. Three doses were administered in 2-week intervals. Animals were euthanized 2 weeks after the last dose, their sera were collected via cardiac puncture and the spleens were removed for subsequent analysis.
ELISA
We used sera collected from the different immunization groups for the detection of EDIII-specific antibodies by ELISA. High binding ELISA plates (Costar) were coated overnight at rt with 100 ng/well of the recombinant EDIII protein () diluted in PBS. In the following day, the plates were washed three times with PBS containing 0.02% Tween 20 (PBS-T 0.02%) and then blocked with PBS-T 0.02%, 1% BSA, and 5% non-fat milk for 1 h at rt. After three washes, serum samples were serially diluted in PBS-T 0.02%, 0.25% BSA, and 5% non-fat milk and incubated for 2 h at rt. Goat anti-mouse IgG antibody conjugated with horseradish peroxidase (HRP) (1:2,000; Jackson ImmunoResearch Laboratories) or HRP conjugated subclass-specific anti-mouse IgG (1:2,000; SouthernBiotech) were used as secondary antibodies, and plates were incubated for 2 h at rt. ELISA was developed with ortho-phenylenediaminedihydrochloride (Sigma) and H2O2 diluted in phosphate–citrate buffer, pH 4.7. The reaction was stopped with 4N H2SO4 and the OD490 was measured in a microplate reader (Biotek). Titers represent the highest serum dilution showing an OD490 > 0.1 normalized in a log10 scale. The IgG1/IgG2a ratio was calculated by dividing the mean values of the highest serum dilution obtained for IgG1 by the mean value of the highest serum dilution obtained for IgG2a without normalization. To determine the avidity of the antibodies, we performed an extra step before adding the secondary antibody. Fixed dilutions (OD490 = 0.7) of the samples were incubated with 7 M urea or PBS for 5 min. After three washes, the procedure continued exactly as described for the standard ELISA protocol. The avidity index was calculated by the sample's OD490 × 100 in 7 M urea divided by the OD490 in PBS.
Virus Neutralization Assay and Competition Assays
Viral neutralization was assessed via a flow cytometry based assay adapted from (). VERO cells (1 × 105 cells/well) were cultured in flat-bottomed 96-well plates (Costar) overnight at 37°C and 5% CO2. Sera from immunized mice were heat inactivated at 56°C for 30 min. Two-fold serially diluted sera were incubated with virus particles of the DENV2 NGC strain (MOI of 0.1) for 30 min at 37°C and 5% CO2. The sera/virus mixtures were then incubated with the cells for 1 h at 37°C and 5% CO2. Next, the sera/virus mixtures were removed and DMEM containing 5% fetal bovine serum (FBS) was added to the cells that were then incubated for 24 h at 37°C and 5% CO2. Trypsin was used to detach the cells that were resuspended in DMEM 5% FBS and transferred to V-bottomed 96-well plates. Cells were fixed and stained as described previously () using 4G2 (10 μg/mL; mouse anti-flavivirus envelope antibody) as a primary antibody and anti-mouse IgG-Alexa488 (1:2,000; Life technologies) as a secondary antibody. The cells were resuspended in FACS buffer and 20,000 events were acquired in the BD FACSCalibur™ flow cytometer (BD biosciences). The sera effect on virus neutralization was determined in comparison to a control infection with sera derived from mice injected with saline only.
For the competition assay, adapted from (), a fixed dilution of the sera from the groups (1:20) was incubated with different molar concentrations of the recombinant EDIII protein for 30 min. The sera/protein mixture was then incubated with the DENV2 NGC strain for 30 min and the experiment continued as described above. Neutralization of infection was determined in comparison to a control infection with DENV2 incubated with recombinant EDIII plus sera from saline injected mice.
Imunofluorescence
VERO cells (25 × 103 cells/well) were cultured on glass coverslips inside 24-well plates (Costar) overnight at 37°C and 5% CO2. Infections were performed with MOI of 0.1 with the DENV2 NGC strain for 1 h. After this period, supernatants containing the virus were discarded and the cells were incubated for 24 h in DMEM 5% FBS. Cells were fixed with ice-cold methanol for 5 min and the coverslips were blocked in PBS containing 1% BSA for 1 h at rt. Next, cells were incubated with pooled sera from the different mouse groups, or with the 4G2 mAb (as a positive control), during 1 h at rt, followed by another incubation with anti-mouse IgG-Alexa488 (1:2,000; Life technologies) in the same conditions. Nuclei were labeled with DAPI (1 μg/mL) and the images were acquired in a fluorescence microscope (Leica DMI6000B/AF6000, Buffalo Grove, IL, USA) coupled to a digital camera system (DFC 365 FX, Leica) and processed by the Leica Application Suite X (LAS X).
Splenocyte Isolation
Two weeks after the last vaccine dose, spleens were removed aseptically and processed exactly as previously described (). Pools (n = 4; two pools per group) of bulk splenocytes were resuspended in R10 [RPMI supplemented with 10% of FBS (GIBCO), 2 mM L-glutamine (GIBCO), 10 mM Hepes (GIBCO), 1 mM sodium pyruvate (GIBCO), 1% vol/vol non-essential aminoacid solution (GIBCO), 1% vol/vol vitamin solution (GIBCO), 20 μg/mL of ciprobacter (Isofarma, Brazil) and 5 × 10−5 M 2-mercaptoetanol (GIBCO)]. Cell viability and concentration were estimated using the Countess™ Automated Cell Counter (Invitrogen).
Peptide Library
A peptide library comprising the DENV 2 E protein (HQ026763, lineage DENV-2/BR0690/RJ/2008) amino acids 161–404 was synthesized by GenScript USA Inc. This library contained 29 overlapping 20-mer peptides that were synthesized with more than 75% purity. Peptides were resuspended in water (10 mg/mL) and stored at −20°C. For in vitro stimulation experiments, peptides were divided into 3 pools as depicted in Table 1.
Table 1
| Peptide position | Peptide sequence* | Domain | Pool number |
|---|---|---|---|
| 161–180 | EIKITPQSSTTEAELTGYGT | EDI + EDII | 1 |
| 169–188 | STTEAELTGYGTVTMECSPR | EDI + EDII | 1 |
| 177–196 | GYGTVTMECSPRTGLDFNEM | EDI + EDII | 1 |
| 185–204 | CSPRTGLDFNEMVLLQMEDK | EDI + EDII | 1 |
| 193–212 | FNEMVLLQMEDKAWLVHRQW | EDI + EDII | 1 |
| 201–220 | MEDKAWLVHRQWFLDLPLPW | EDI + EDII | 1 |
| 209–228 | HRQWFLDLPLPWLPGADTQG | EDI + EDII | 1 |
| 217–236 | PLPWLPGADTQGSNWIQKET | EDI + EDII | 1 |
| 225–244 | DTQGSNWIQKETLVTFKNPH | EDI + EDII | 1 |
| 233–252 | QKETLVTFKNPHAKKQDVVV | EDI + EDII | 1 |
| 241–260 | KNPHAKKQDVVVLGSQEGAM | EDI + EDII | 2 |
| 249–268 | DVVVLGSQEGAMHTALTGAT | EDI + EDII | 2 |
| 257–276 | EGAMHTALTGATEIQMSSGN | EDI + EDII | 2 |
| 265–284 | TGATEIQMSSGNLLFTGHLK | EDI + EDII | 2 |
| 273–292 | SSGNLLFTGHLKCRLRMDKL | EDI + EDII | 2 |
| 281–300 | GHLKCRLRMDKLQLKGMSYS | EDI + EDII + EDIII | 2 |
| 289–308 | MDKLQLKGMSYSMCTGKFKI | EDIII | 2 |
| 297–316 | MSYSMCTGKFKIVKEIAETQ | EDIII | 2 |
| 305–324 | KFKIVKEIAETQHGTIVIRV | EDIII | 2 |
| 313–332 | AETQHGTIVIRVQYEGDGSP | EDIII | 2 |
| 321–340 | VIRVQYEGDGSPCKIPFEIT | EDIII | 3 |
| 329–348 | DGSPCKIPFEITDLEKRHVL | EDIII | 3 |
| 337–356 | FEITDLEKRHVLGRLITVNP | EDIII | 3 |
| 345–364 | RHVLGRLITVNPIVTEKDSP | EDIII | 3 |
| 353–372 | TVNPIVTEKDSPVNIEAEPP | EDIII | 3 |
| 361–380 | KDSPVNIEAEPPFGDSYIIV | EDIII | 3 |
| 369–388 | AEPPFGDSYIIVGVEPGQLK | EDIII | 3 |
| 377–396 | YIIVGVEPGQLKLNWFKKGS | EDIII | 3 |
| 385–404 | GQLKLNWFKKGSSIGQMF | EDIII | 3 |
List of peptides derived from the E protein.
Bold shows the EDIII amino acid sequence.
ELISpot
We used the mouse IFN gamma ELISPOT Ready-SET-Go!®; (eBioscience) to detect IFN-γ producing splenocytes. The procedure was performed according to the manufacturer‘s instructions. Briefly, ELISpot plates (MAIPS4510; Millipore) were coated with the capture antibody and incubated overnight at 4°C. The plates were washed twice with PBS and blocked for 1 h with R10 at rt. Splenocytes were incubated in the presence of 2 μg/mL pooled EDIII or EDI/II (negative control) peptides for 20 h at 37°C with 5% CO2. Unpulsed cells were used as controls for each group. After incubation, the plates were washed three times with PBS-T 0.05% and incubated for 2 h at rt with the biotinylated anti-IFN-γ antibody. Following another round of washes, the plates were incubated with avidin-HRP for 45 min at rt. Plates were washed three times with PBS-T 0.05% and the spots were developed with the “AEC substrate set” kit (BD biosciences). We used an automated stereomicroscope (KS ELISPOT, Zeiss, Oberkochem, Germany) to count the number of spots. The formula (# of spots in the pulsed well – # of spots in the unpulsed well) was used to calculate the number of IFN-γ producing cells/106 cells.
Proliferation and Intracellular Staining (ICS)
To analyze T cell proliferation, splenocytes from mice were labeled with carboxyfluoresceinsuccinimidyl ester (CFSE). Briefly, 50 × 106 splenocytes were resuspended in pre-heated PBS and labeled with 1.25 μM of CFSE for 10 min at 37°C. Cells were then washed, resuspended in R10 and 3 × 105 cells/well were incubated at 37°C and 5% CO2 in 96-well round-bottomed plates with 2 μg/mL of pooled EDIII or EDI/II (negative control) peptides. Unpulsed cells were used as controls for each group. After 3 days in culture, cells were restimulated with the same peptide pools plus 2 μg/mL of αCD28. After 1 h incubation at 37°C and 5% CO2, 0.5 μg of Golgi Plug (Brefeldin A, BD Pharmingen) was added per well, and the plate was incubated for 12 h at 37°C and 5% CO2. After the incubation period, the cells were washed with FACS buffer and transferred to V-bottomed 96-well plates. Cells were stained with LIVE/DEAD® dye (Life Technologies) and αCD4-PerCP (clone RM4-5) for 40 min on ice and in the dark. After 4 washes with FACS Buffer, the cells were fixed and permeabilized using the Cytofix/Cytoperm kit (BD Pharmingen) according to the manufacturer's instructions. The cells were then washed three times with PermWash buffer (BD Pharmingen). The intracellular staining was performed using αCD3-APC/Cy7 (clone 145-2C11), αIFNγ-APC (clone XMG1.2), αIL2-PE (clone JES6-5H4), and αTNFα-PE/Cy7 (clone MP6-XT22) for 40 min on ice and in the dark. The cells were washed twice and resuspended in FACS Buffer. All antibodies were purchased from BD Pharmingen. Flow cytometer readings were carried out with 200,000 events acquired in the BD LSRFortessa flow cytometer (BD Biosciences) and analyzed using FlowJo software (version 9.3, Tree Star, San Carlo, CA). The analysis of proliferating (CFSElow) cells producing different combinations of cytokines (IFNγ, IL-2, and TNFα) was performed with the Boolean gating platform (FlowJo Software). The percentages of proliferating or/and cytokine-producing cells were calculated by subtracting the values obtained with unpulsed cells.
Data Analysis
We used the Prism 7 software (GraphPad Software Inc, LA Jolla, CA) for all tests. Statistical differences were considered significant when p ≤ 0.05. One-way ANOVA followed by Tukey's honestly significantly different (HSD) were used for the ELISA data and Two-way ANOVA followed by Bonferroni correction was used for the ELISpot, CFSE and ICS data. The NT50 values for the neutralization assays were determined with the non-linear regression (curve fit) analysis.
Results
Production of the Recombinant scFvs
The DENV2 EDIII nucleotide sequence (encoding amino acids 297–394) was cloned in frame into plasmids encoding the variable regions of the heavy and light chains of the anti-DEC205 (clone NLDC145) and the isotype control (clone III/10) as previously described (). Figure 1A shows a schematic representation of pscDEC-EDIII and pscISO-EDIII that were then used to transfect HEK293T cells. Western blot analyses of concentrated cell culture supernatants confirmed secretion of scDEC-EDIII and scISO-EDIII by transfected cells (~46 kDa, Figure 1B). To demonstrate that scDEC-EDIII retained the capacity to bind to the DEC205 receptor, CHO cells stably expressing the murine DEC205 receptor were incubated with different concentrations of either scDEC-EDIII or scISO-EDIII. Figure 1C shows that only the scDEC-EDIII bound to DEC205 receptor in a concentration dependent manner. Taken together, these results indicate that both scFvs were successfully secreted from transiently transfected cells, and that the scDEC-EDIII preserved its binding capacity to the DEC205 receptor.
Figure 1
In vivo EDIII Targeting to DCs Improves Antibody Responses
Next, we assessed if immunization with pscDEC-EDIII could improve the anti-EDIII antibody response. For that purpose, mice received three doses of each plasmid administered i.m. followed by electroporation (Figure 2A). Twelve days after the administration of the first and second doses, and 14 days after the third dose, mice were bled and the sera were tested individually for reactivity against the recombinant EDIII produced in bacteria. Supplementary Figure 1 shows an increase in anti-EDIII antibody titers in mice immunized with both plasmids, especially after the administration of the third dose. Moreover, the anti-EDIII antibody titers observed in the animals immunized the pscDEC-EDIII were higher than those observed in mice immunized with pscISO-EDIII (Figure 2B). When IgG subclasses present in the sera of immunized mice were analyzed, IgG1, IgG2a, and IgG2b but not IgG3 were detected (Figure 2C). Notably, the IgG1/IgG2a ratio detected in mice immunized with pscDEC-EDIII was approximately 10 × higher (6.62) than the one obtained in mice immunized with pscISO-EDIII (0.60). When antibody avidity was measured, we noticed that it was higher in sera from mice immunized with pscDEC-EDIII than in mice immunized with pscISO-EDIII (Figure 2D). Anti-EDIII antibodies were also tested for binding to the viral E protein by immunofluorescence and, as expected, sera collected from mice immunized with pscDEC-EDIII or pscISO-EDIII reacted with VERO cells previously infected with DENV2 (Figure 2E). The labeling patterns were similar to those observed in infected cells stained with 4G2 mAb that recognizes the E protein of Flaviviruses. These results indicate that there are differences in the magnitude, and in the quality of anti-EDIII antibodies raised after immunization with pscDEC-EDIII or pscISO-EDIII.
Figure 2
Anti-EDIII Antibodies Raised in Immunized Mice Inhibit DENV2 Infection
Anti-EDIII antibodies were shown to be effective to block virus entry into eukaryotic cells (–, , ). We then analyzed if anti-EDIII antibodies present in the sera of immunized mice were able to block DENV2 infection. Figure 3A shows that antibodies raised in mice immunized with both scFvs plasmids inhibited virus entry with the same efficiency and in a dilution dependent manner. The 50% neutralization titers (NT50) were also similar for sera derived from pscDEC-EDIII (1.66) or from pscISO-EDIII (1.69) immunized mice. To verify if the anti-EDIII antibodies were able to block DENV2 infectivity by binding to EDIII, we performed a competition assay using different concentrations of recombinant EDIII and a fixed serum dilution. Sera derived from mice immunized with pscDEC-EDIII, or pscISO-EDIII were then incubated with increasing amounts of EDIII. We observed a reduction in the sera capacity to inhibit DENV infection as the amount of EDIII was increased (Figure 3B). Of note, although we noticed a difference in the slope of the curves between the two groups, no statistical significance was observed, indicating that the anti-EDIII antibodies induced in both groups bound equally well to recombinant EDIII.
Figure 3
These results indicate that immunization with a DC targeted DNA vaccine was able to elicit higher anti-EDIII antibody titers with higher avidity. However, their blocking capacity did not differ from the blocking capacity of anti-EDIII antibodies induced by the vaccine that did not target DCs.
DC-Targeted DNA Vaccine Elicits Specific IFNγ Production and CD4+ T Cell Proliferation
We also investigated if EDIII targeting to DCs would impact cellular immune responses, particularly CD4+ T cells. Splenocytes harvested 14 days after the administration of the last immunization dose were incubated with three peptide pools containing peptides derived from a library comprising EDI/II and EDIII 20-mer overlapping peptides (Table 1). Pool 1 contained 10 peptides restricted to EDI/II domains (not present in the EDIII sequence encoded by the DNA vaccine plasmids), pool 2 contained five peptides derived from EDI/II and five peptides derived from EDIII sequence, and pool 3 contained nine peptides derived from EDIII amino acid sequence. All three pools were used to stimulate splenocytes from mice immunized with pscDEC-EDIII, pscISO-EDIII or saline. ELISpot assays showed that the number of IFNγ-producing splenocytes derived from mice immunized with pscDEC-EDIII was higher than that observed in mice immunized with the isotype control DNA vaccine or saline (Figure 4A). In addition, the response was mainly directed to a peptide(s) contained in pool 3 (Figure 4A). There was also a statistically significant difference in the number of IFNγ-expressing cells derived from mice immunized with pscDEC-EDIII after stimulation with peptide pool 2. This result suggests that pools 2 and 3 contain peptides able to bind to the BALB/c H-2Kd haplotype. When CD4+ T cell proliferation (representative gating strategy shown in Supplementary Figure 2, CFSElow panel) was analyzed, we also detected a higher frequency of CD3+CD4+CFSElow cells in the DC-targeted DNA vaccine group when compared to the groups immunized with the isotype control plasmid or saline (Figure 4B). Similarly to the previous experiment, the highest frequency of proliferation was directed against pool 3. As expected, pool 1 (comprising unrelated peptides derived from EDI/II domain) elicited a lower response in mice immunized with scFv plasmids that was not different from the response induced in animals that received saline.
Figure 4
DC-Targeted DNA Vaccine Induces CD4+ T Cells That Proliferate and Produce Pro-Inflammatory Cytokines at the Same Time
We next assessed if CD4+ T cells that proliferated in response to pools 2 and 3 were also able to produce the pro-inflammatory cytokines IFNγ, IL-2, and TNFα (representative gating strategy shown in Supplementary Figure 3). As shown in Figure 5A, the frequency of CD4+ T cells that proliferated and produced IFNγ was higher in animals immunized with pscDEC-EDIII pulsed with pools 2 and 3 when compared to animals that received saline. For pool 3, as observed in the ELISpot assay, the frequency of CD4+CFSElow that produced IFNγ was also higher in mice immunized with pscDEC-EDIII than in the group immunized with pscISO-EDIII. We did not observe significant differences among the groups when we compared the frequency of CD4+CFSElow cells that produced IL-2 (Figure 5B). TNFα production by proliferating CD4+ T cells was also higher in cells derived from pscDEC-EDIII immunized mice, especially when they were incubated with pool 3. A higher response against pool 2 was also observed, but it did not reach statistical significance when compared to the other two groups (Figure 5C).
The results in Figure 5 showed that immunization with pscDEC-EDIII induced CD4+ T cells that proliferated and produced three pro-inflammatory cytokines mainly to peptides contained in pools 2 and 3. To explore this response in more detail, we performed a Boolean analysis of the data (representative gating strategy shown in Supplementary Figure 2, CFSElow and cytokine+ panels), and showed that the CD4+CFSElow cells were polyfunctional and able to produce combinations of the tested cytokines. For example, proliferating CD4+ T cells from mice immunized with pscDEC-EDIII produced all three cytokines simultaneously when pulsed with pool 2 (Figure 6A). Despite not statistically significant, we also observed an increase in the frequencies of CD4+ T cells that proliferated and produced IL-2/TNFα, or only IL-2 or TNFα in pscDEC-EDIII immunized animals. The only exception was due to the IFNγ/TNFα double positive cells whose frequency was higher in pscISO-EDIII immunized animals. Similar results were observed in assays using pool 3 (Figure 6B). Mice immunized with pscDEC-EDIII showed a statistically significant increase in the frequency of triple positive CD4+ T cells when compared to the group that received saline. Moreover, the percentage of CD3+CD4+ cells that proliferated and produced only TNFα was statistically higher in mice immunized with pscDEC-EDIII than in those that received pscISO-EDIII or saline. Despite not significant, we observed that animals immunized with pscDEC-EDIII presented a higher frequency of cells positive for IFNγ/TNFα, only IFNγ, or only IL-2 when compared with the other two groups. Taken together, these results indicate that EDIII targeting to DCs using a DNA vaccine was able to elicit a polyfunctional CD4+ T cell response.
Figure 5
Figure 6
Identification of EDIII-Specific Epitopes Recognized by CD4+ T Cells Elicited in Mice Immunized With pscDEC-EDIII
In order to identify the peptide(s) present in the pools able to specifically activate CD4+ T cell responses in mice immunized with pscDEC-EDIII, we performed an ELISpot assay using individual peptides comprising the complete EDIII sequence plus two control peptides derived from EDI/EDII (EIKITPQSSTTEAELTGYGT and STTEAELTGYGTVTMECSPR). Splenocytes from mice immunized with pscDEC-EDIII were pulsed with each individual peptide and the number of IFNγ producing splenocytes/106 total cells was recorded. Figure 7 indicates that the response was mainly directed to two peptides: MDKLQLKGMSYSMCTGKFKI present in pool 2, and RHVLGRLITVNPIVTEKDSP in pool 3. In addition, we observed that peptide RHVLGRLITVNPIVTEKDSP represented the immunodominant epitope since the response directed to it was almost three times higher than that detected after stimulation with peptide MDKLQLKGMSYSMCTGKFKI.
Figure 7
Discussion
Dengue infection has become a major public health concern as the disease outbreaks and complications have increased substantially in the last five decades (). Since then, the development of a vaccine has become a global health priority. The challenge is enormous as dengue is caused by four different serotypes and a previous immune response against one particular serotype can exacerbate the disease caused by another (). Different approaches are being evaluated and two vaccines based on live attenuated viruses have reached phase III trials: the CYD-TDV by Sanofi Pasteur and the TV003/TV005 by US National Institutes of Health (). However, results of the CYD-TDV vaccine indicating that the risk of severe disease could increase in seronegative individuals led WHO to recommend that the vaccine would only be administered in populations with dengue serological prevalence rates above 80% (). In this way, other approaches are currently being developed.
Antigen targeting to DCs through the use of chimeric mAbs has been a promising strategy to induce either humoral or cellular immune responses against different antigens such as: ovalbumin (–), Plasmodium yoelii circumsporozoite protein (), Yersinia pestis LcrV (), DENV2 non-structural protein 1 (), Trypanosoma cruzi amastigote surface protein 2 (), Plasmodium vivax merozoite surface protein 1 (, ), and HIV gag (, ), among others.
However, the production of such mAbs is time consuming and expensive. DNA vaccines, on the other hand, are cheap, safe and easier to produce and purify, but in general are less immunogenic (). Different approaches have been developed to increase the immunogenicity of DNA vaccines. Among them are the use of electroporation (, ) and the use of plasmids encoding scFv specific for the DEC205 receptor coupled to the antigen of interest.
Although EDIII has been recently used in a DNA immunization strategy (), in this work we sought to produce a DNA vaccine able to target EDIII from DENV2 to the DEC205+ DCs in vivo. This was accomplished when we fused the sequence of anti-DEC205 scFv to the EDIII, generating the DNA plasmid named pscDEC-EDIII. As a negative control, we also fused the scFv of a control mAb that was not able to bind to DCs (pscISO-EDIII). Interestingly, a similar construct was engineered by Coconi-Linares et al. that expressed a scFvDEC-EDIII in the plant Nicotiana benthamiana (55). In this case, the authors purified the recombinant scFvDEC205-EDIII protein and immunized BALB/c mice in the presence of anti-CD40 and poly (I:C). Their results showed that the scFvDEC205-EDIII was immunogenic, inducing antibodies with neutralization capacity and proliferating T cells. Nonetheless, a more detailed evaluation of the antibody and T cell responses was not performed.
We decided to use the pscDEC-EDIII as a DNA vaccine for its simplicity and potential to induce strong immune responses when administered together with electroporation. Initially we showed that both plasmids (pscDEC-EDIII or its isotype control) were able to drive the production of chimeric scFvs when transfected in HEK293T cells. More importantly, the scFvs were successfully secreted from the cells, indicating availability in the extracellular medium and possible targeting to the DEC205+ DCs. Indeed, scDEC-EDIII showed a concentration dependent binding to the DEC205 receptor. Similar results were obtained with other antigens coupled to the same scFvs (, 56).
Once production and DEC205 receptor specific binding were confirmed for scDEC-EDIII, we used scFv plasmids to immunize mice. We showed that the anti-E antibody titers after the administration of three doses were higher in the group immunized with pscDEC-EDIII when compared to the non-targeted control. Others obtained similar results using different antigens like ovalbumin, HIV gag p41 (), HER2/neu (), hepatitis B virus (57), human respiratory syncytial virus (), and botulinum neurotoxin (). Although the number of doses varied as well as the amount of plasmid DNA, all these studies used electroporation following intramuscular injection. Interestingly, when we analyzed the IgG isotypes elicited by immunization with the scFvs, we noticed that there was a difference in the IgG1/IgG2a ratio in the sera of mice immunized with pscDEC-EDIII or pscISO-EDIII. Although some groups, using different antigens, also obtained similar results (, 58), others showed differences when both groups were compared (). Despite the differences from one study to another, it has become clear that antigen targeting to the DEC205+ DCs modulates the humoral immune response differently than the non-targeted antigen. We also noticed a significant increase in the avidity of the anti-E antibodies raised in mice immunized with pscDEC-EDIII, while antibodies derived from both immunized groups recognized infected cells. A similar recognition pattern was also obtained after intradermal immunization with a DNA plasmid encoding EDIII (). This result indicated that the EDIII recognized by the mice sera presented a similar conformation when compared to the EDIII present in the viral particle.
EDIII has been previously described as a target for neutralizing antibodies (, , 59, 60). We then decided to analyze if sera from scFv immunized animals were able to block virus invasion in vitro. The results showed that sera from mice immunized with pscDEC-EDIII or with pscISO-EDIII blocked DENV2 infection in a dilution dependent manner. This result contrasted with our previous results showing higher titers and avidity in the sera of mice immunized with pscDEC-EDIII. A positive correlation between neutralization capacity and higher avidity to the viral particle was observed previously on dengue-infected patients (61). In contrast, other results using HIV envelope proteins showed that higher avidity not always correlates with neutralization capacity (62). More importantly, when sera from these mice were previously incubated with different amounts of recombinant EDIII, we observed a reversion in the sera capacity to block infection. This result more clearly demonstrated that the antibodies directed to EDIII mediate DENV infection inhibition in this model. Similar results were also obtained when an EDIII recombinant protein was administered in the presence of the heat-labile toxin (LT) or its non-toxic B subunit (), or when a chimeric protein containing EDIII was administered to monkeys (63).
Our group and others described that antigen targeting to the DEC205+ DCs is a very efficient way of elicit CD4+ T cell responses (, –, , 64, 65). We then sought to analyze the CD4+ T cell response induced after immunization with plasmids encoding scFvs genetically fused to EDIII. We took advantage of a peptide library comprising overlapping peptides derived from the E protein amino acids 161 to 404. Our data showed that the pscDEC-EDIII immunization induced CD4+ T cells that proliferated when pulsed with peptide pools comprising the EDIII portion of the molecule. An analysis of pro-inflammatory cytokines produced by the animals immunized with pscDEC-EDIII showed a higher frequency of IFNγ and TNFα producing CD4+ T cells when compared to the animals immunized with the isotype control, although IL-2 levels were comparable. Interestingly, there was a difference in the magnitude of the response when splenocytes were pulsed with pools 2 or 3. The frequency of CD4+ T cells that proliferated and produced IFNγ or TNFα was higher after pulse with pool 3, indicating the presence of an immunodominant epitope(s) capable of binding the BALB/c haplotype (H-2Kd). A more detailed analysis showed that pscDEC-EDIII immunization elicited polyfunctional CD4+ T cells producing one, two, or three pro-inflammatory cytokines, even though statistical significance in comparison to the isotype control group was only reached when single TNFα producers were compared. CD4+ T cells producing the same combination of pro-inflammatory cytokines were also observed in animals immunized with scDEC-HIV p41 () or with scDEC-HER2 (). The presence of polyfunctional CD4+ T cells with protective capacity was first described in a mouse model testing a vaccine against Leishmania major (66). After that, many groups set out to investigate if polyfunctional CD4+ T cells could be related with protection in other models. Studies with HIV-1 infected individuals showed that those displaying polyfunctional CD4+ T cells were able to better control disease (67, 68). In dengue infection, one study showed that CD4+ T cells that produced either IFNγ or IL-2 correlated with protection from secondary virus infection in children (69). Polyfunctional CD4+ T cells were also identified in individuals submitted to a DENV-1 vaccine candidate, although protection against infection was not investigated in this particular study (70).
Worth mentioning is the fact that, in some cases, DNA vaccination with a scFv encoding the scDEC205 fused with an antigen elicited weaker immune responses when compared to the non-targeted controls (56, 58, 71). The reason for these results is still unclear. In fact, DEC205 targeting using chimeric anti-DEC205 mAbs has been known to induce tolerance if the antigen is delivered in the absence of a DC maturation stimulus (72). However, electroporation facilitates DNA uptake and makes more DNA available for detection by intracellular DNA sensors, thereby activating the production of cytokines as an innate reaction (73). In addition, the plasmid backbone should also be considered. As a mechanistic explanation is still elusive, additional studies are necessary.
Finally, we attempted to map the epitopes responsible for the CD4+ T cell proliferation and cytokine production. When splenocytes from mice immunized with pscDEC-EDIII were pulsed with each individual peptide, we identified two peptides that were probably responsible for the response observed against pools 2 and 3: MDKLQLKGMSYSMCTGKFKI and RHVLGRLITVNPIVTEKDSP, respectively. Peptide RHVLGRLITVNPIVTEKDSP comprises the sequence of peptide RHVLGRLITVNPIVT that was shown to induce IFNγ production when this peptide was used to immunize C57BL/6J mice (74). In addition, the same peptide was also shown to bind to HLA-DRB1*08:02 in patients from Nicaragua (75) and Sri Lanka (76). This result indicates that our immunization strategy may have the potential to induce CD4+ T cells in humans. Peptide MDKLQLKGMSYSMCTGKFKI is contained in the sequence of peptide SGNLLFTGHLKCRLRMDKLQLKGMSYSMCTG, which was previously used to immunize BALB/c mice. Proliferation and release of IL-2 were detected in this case (77). As DEC205 targeting greatly improves CD4+ T cell responses, it is relatively easy to map antigenic peptides. CD4+ T cell epitopes derived from different proteins have been more easily mapped in samples derived from animals submitted to antigen targeting to DCs. CD4+ T cells epitopes were detected in the Plasmodium yoelii circunsporozoite protein (), in the HIV p24 gag (), in the Leishmania major LACK antigen (64), in the Yersinia pestis LcrV antigen (65) and in the Trypanosoma cruzi ASP-2 protein ().
The role of CD4+ T cells in dengue infection is still not very well defined. CD4+ T cells from infected patients were found to have ex vivo specific cytolytic activity against DENV (). Individuals vaccinated with an experimental live attenuated DENV1 vaccine exhibited CD4+ T cells with cytotoxic and proliferative capacities in vitro (78, 79). In mouse models, a DNA vaccine encoding the NS1 protein induced protection via CD4+ T cells and antibodies (80). Immunization with a chimeric αDEC205 mAb fused to NS1 was also able to induce CD4+ T cells that contributed for protection (). Yauch et al. showed that vaccination with CD4+ peptides in an IFN-α/βR−/− mouse model reduced viral loads. Interestingly, CD4+ T cells did not seem to have an impact on antibody neutralization of the virus measured by infection of C6/36 cells (81). Further studies will be needed to address the role of CD4+ T cells in our model.
Although in the literature CD8α+ DCs are described as playing an important role in the uptake of apoptotic cells and in antigen cross-presentation in the context of MHC Class I (82, 83), we did not detect a robust CD8+ T cell response induced by our scFv DNA vaccines (data not shown). One reason for that might be related to the choice of the EDIII as an antigen, as most CD8+ T cell epitopes are localized on the non-structural proteins, especially NS3 and NS5 (84). Our group has previously demonstrated that NS1 targeting to DCs via DEC205 induced protection partially mediated by CD8+ T cells (). In addition, studies mapping CD8+ T cell epitopes usually use peptides of no more than 12-15 amino acids. Our peptide library consisted of 20-mers, which might have restricted the identification of CD8+ T cell responses.
Taken together, our results show that antigen targeting to CD8α+ DCs using DNA vaccines is a promising strategy to induce cellular and humoral responses and may be used in the development of more efficient dengue vaccines.
Statements
Author contributions
AZ and SB designed the experiments. AZ, FS, BA, HS, NF, NS, and MY conducted most of the experiments. AZ and SB analyzed the data. AZ and SB prepared the figures and wrote the manuscript. LF, DM, and DR contributed reagents. DR, LF, FS, NS, and MY revised the manuscript. All authors read and approved the final version of the manuscript.
Funding
The São Paulo Research Foundation (FAPESP, grant numbers 2013/11442-4, 2014/50631-0, 2014/17595-0, and 2014/15061-8), the Brazilian National Research Council (CNPq, grant number 472509/2011-0) and the Coordenação de Aperfeiçoamento de Pessoal de Nível Superior—Brasil (CAPES, Finance Code 001) funded this research. AZ, FS, and BS received fellowships from FAPESP (2016/04477-4, 2015/18874-2, and 2015/16565-2, respectively). SB, DR, and LF are recipients of CNPq fellowships.
Acknowledgments
The authors would like to thank Danielle Chagas, Anderson Domingos Silva and Doroty Nunes da Silva for assistance in the animal facility, and Dr. Mauro Javier Cortéz Veliz for the use of the immunofluorescence microscope.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2019.00059/full#supplementary-material
References
1.
BhattSGethingPWBradyOJMessinaJPFarlowAWMoyesCLet al. The global distribution and burden of dengue. Nature (2013) 496:504–7. 10.1038/nature12060nature12060
2.
WhiteheadSSBlaneyJEDurbinAPMurphyBR. Prospects for a dengue virus vaccine. Nat Rev Microbiol. (2007) 5:518–28. 10.1038/nrmicro1690
3.
LindenbachBDRiceCM. Flaviviridae: the viruses and their replication, In: KnipeDMHowleyPM, editors. Fields Virology.4th ed. Philadelphia, PA: Lippincott Williams & Wilkins (2001). p. 991–1042.
4.
KuraneI. Dengue hemorrhagic fever with special emphasis on immunopathogenesis. Comp Immunol Microbiol Infect Dis. (2007) 30:329–40. 10.1016/j.cimid.2007.05.010
5.
ZhangZSYanYSWengYWHuangHLLiSQHeSet al. High-level expression of recombinant dengue virus type 2 envelope domain III protein and induction of neutralizing antibodies in BALB/C mice. J Virol Methods (2007) 143:125–31. 10.1016/j.jviromet.2007.02.012
6.
BlockOKRodrigoWWQuinnMJinXRoseRCSchlesingerJJ. A tetravalent recombinant dengue domain III protein vaccine stimulates neutralizing and enhancing antibodies in mice. Vaccine (2010) 28:8085–94. 10.1016/j.vaccine.2010.10.004
7.
CrillWDRoehrigJT. Monoclonal antibodies that bind to domain III of dengue virus E glycoprotein are the most efficient blockers of virus adsorption to Vero cells. J Virol. (2001) 75:7769–73. 10.1128/JVI.75.16.7769-7773.2001
8.
WahalaWMSilvaAM. The human antibody response to dengue virus infection. Viruses (2011) 3:2374–95. 10.3390/v3122374
9.
PoggianellaMSlonCampos JLChanKRTanHCBestagnoMOoiEEet al. Dengue E protein domain III-based DNA immunisation induces strong antibody responses to all four viral serotypes. PLoS Negl Trop Dis. (2015) 9:e0003947. 10.1371/journal.pntd.0003947
10.
BukowskiJFKuraneILaiCJBrayMFalgoutBEnnisFA. Dengue virus-specific cross-reactive CD8+ human cytotoxic T lymphocytes. J Virol. (1989) 63:5086–91.
11.
KuraneIMeagerAEnnisFA. Dengue virus-specific human T cell clones. Serotype crossreactive proliferation, interferon gamma production, and cytotoxic activity. J Exp Med. (1989) 170:763–75.
12.
RothmanAL. Dengue: defining protective versus pathologic immunity. J Clin Invest. (2004) 113:946–51. 10.1172/JCI21512
13.
WeiskopfDBangsDJSidneyJKollaRVDeSilva ADdeSilva AMet al. Dengue virus infection elicits highly polarized CX3CR1+ cytotoxic CD4+ T cells associated with protective immunity. Proc Natl Acad Sci USA. (2015) 112:E4256–63. 10.1073/pnas.1505956112
14.
BanchereauJSteinmanRM. Dendritic cells and the control of immunity. Nature (1998) 392 245–52. 10.1038/32588
15.
DelamarreLHolcombeHMellmanI. Presentation of exogenous antigens on major histocompatibility complex (MHC) class I and MHC class II molecules is differentially regulated during dendritic cell maturation. J Exp Med. (2003) 198:111–22. 10.1084/jem.20021542
16.
MeradMSathePHelftJMillerJMorthaA. The dendritic cell lineage: ontogeny and function of dendritic cells and their subsets in the steady state and the inflamed setting. Annu Rev Immunol. (2013) 31:563–604. 10.1146/annurev-immunol-020711-074950
17.
InabaKSwiggardWJInabaMMeltzerJMirzaASasagawaTet al. Tissue distribution of the DEC-205 protein that is detected by the monoclonal antibody NLDC-145. I Expression on dendritic cells and other subsets of mouse leukocytes. Cell Immunol. (1995) 163:148–56.
18.
Witmer-PackMDSwiggardWJMirzaAInabaKSteinmanRM. Tissue distribution of the DEC-205 protein that is detected by the monoclonal antibody NLDC-145. II Expression in situ in lymphoid and nonlymphoid tissuesCell Immunol. (1995) 163:157–62.
19.
GuoMGongSMaricSMisulovinZPackMMahnkeKet al. A monoclonal antibody to the DEC-205 endocytosis receptor on human dendritic cells. Hum Immunol. (2000) 61:729–38. 10.1016/S0198-8859(00)00144-0
20.
EbnerSEhammerZHolzmannSSchwingshacklPForstnerMStoitznerPet al. Expression of C-type lectin receptors by subsets of dendritic cells in human skin. Int Immunol (2004) 16:877–87. 10.1093/intimm/dxh088
21.
MahnkeKGuoMLeeSSepulvedaHSwainSLNussenzweigMet al. The dendritic cell receptor for endocytosis, DEC-205, can recycle and enhance antigen presentation via major histocompatibility complex class II-positive lysosomal compartments. J Cell Biol (2000) 151:673–84. 10.1083/jcb.151.3.673
22.
VremecDPooleyJHochreinHWuLShortmanK. CD4 and CD8 expression by dendritic cell subtypes in mouse thymus and spleen. J Immunol. (2000) 164:2978–86. 10.4049/jimmunol.164.6.2978
23.
denHaan JMLeharSMBevanMJ. CD8+ but not CD8− dendritic cells cross-prime cytotoxic T cells in vivo. J Exp Med. (2000) 192:1685–96. 10.1084/jem.192.12.1685
24.
IyodaTShimoyamaSLiuKOmatsuYAkiyamaYMaedaYet al. The CD8+ dendritic cell subset selectively endocytoses dying cells in culture and in vivo. J Exp Med. (2002) 195:1289–302. 10.1084/jem.20020161
25.
AllanRSSmithCMBelzGTvanLint ALWakimLMHeathWRet al. Epidermal viral immunity induced by CD8alpha+ dendritic cells but not by Langerhans cells. Science (2003) 301:1925–8. 10.1126/science.1087576
26.
BonifazLCBonnyayDPCharalambousADargusteDIFujiiSSoaresHet al. In vivo targeting of antigens to maturing dendritic cells via the DEC-205 receptor improves T cell vaccination. J Exp Med. (2004) 199:815–24. 10.1084/jem.20032220
27.
BoscardinSBHafallaJCMasilamaniRFKamphorstAOZebroskiHARaiUet al. Antigen targeting to dendritic cells elicits long-lived T cell help for antibody responses. J Exp Med. (2006) 203:599–606. 10.1084/jem.20051639
28.
DudziakDKamphorstAOHeidkampGFBuchholzVRTrumpfhellerCYamazakiSet al. Differential antigen processing by dendritic cell subsets in vivo. Science (2007) 315:107–11. 10.1126/science.1136080
29.
DoYKohHParkCGDudziakDSeoPMehandruSet al. Targeting of LcrV virulence protein from Yersinia pestis to dendritic cells protects mice against pneumonic plague. Eur J Immunol. (2010) 40:2791–6. 10.1002/eji.201040511
30.
HenriquesHRRampazoEVGoncalvesAJVicentinECAmorimJHPanatieriRHet al. Targeting the non-structural protein 1 from dengue virus to a dendritic cell population confers protective immunity to lethal virus challenge. PLoS Negl Trop Dis. (2013) 7:e2330. 10.1371/journal.pntd.0002330
31.
RampazoEVAmorimKNYamamotoMMPanatieriRHRodriguesMMBoscardinSB. Antigen targeting to dendritic cells allows the identification of a CD4 T-cell epitope within an immunodominant trypanosoma cruzi antigen. PLoS ONE (2015) 10:e0117778. 10.1371/journal.pone.0117778
32.
AmorimKNRampazoEVAntonialliRYamamotoMMRodriguesMMSoaresISet al. The presence of T cell epitopes is important for induction of antibody responses against antigens directed to DEC205+ dendritic cells. Sci Rep. (2016) 6:39250. 10.1038/srep39250
33.
AntonialliRSulczewskiFBAmorimKAlmeidaBDSFerreiraNSYamamotoMMet al. CpG Oligodeoxinucleotides and flagellin modulate the immune response to antigens targeted to CD8alpha(+) and CD8alpha(−) conventional dendritic cell subsets. Front Immunol. (2017) 8:1727. 10.3389/fimmu.2017.01727
34.
ApostolicoJSLunardelliVAYamamotoMMSouzaHFCunha-NetoEBoscardinSBet al. Dendritic cell targeting effectively boosts T cell responses elicited by an HIV multiepitope DNA vaccine. Front Immunol. (2017) 8:101. 10.3389/fimmu.2017.00101
35.
RosaDSApostólicoJSBoscardinSB. DNA vaccines: how much have we accomplished in the last 25 years?J Vaccines Vaccin. (2015) 6:283. 10.4172/2157-7560.1000283
36.
DemangelCZhouJChooABShoebridgeGHallidayGMBrittonWJ. Single chain antibody fragments for the selective targeting of antigens to dendritic cells. Mol Immunol. (2005) 42:979–85. 10.1016/j.molimm.2004.09.034
37.
NchindaGKuroiwaJOksMTrumpfhellerCParkCGHuangYet al. The efficacy of DNA vaccination is enhanced in mice by targeting the encoded protein to dendritic cells. J Clin Invest. (2008) 118:1427–36. 10.1172/JCI34224
38.
CaoJJinYLiWZhangBHeYLiuHet al. DNA vaccines targeting the encoded antigens to dendritic cells induce potent antitumor immunity in mice. BMC Immunol. (2013) 14:39. 10.1186/1471-2172-14-39
39.
ChenBYZhouGLiQLLuJSShiDYPangXBet al. Enhanced effects of DNA vaccine against botulinum neurotoxin serotype A by targeting antigen to dendritic cells. Immunol Lett. (2017) 190:118–24. 10.1016/j.imlet.2017.08.004
40.
HuaYJiaoYYMaYPengXLFuYHZhangXJet al. Enhanced humoral and CD8+ T cell immunity in mice vaccinated by DNA vaccine against human respiratory syncytial virus through targeting the encoded F protein to dendritic cells. Int Immunopharmacol. (2017) 46:62–9. 10.1016/j.intimp.2017.02.023
41.
NguLNNjiNNAmbadaGNgohAANjambePriso GDTchadjiJCet al. Dendritic cell targeted HIV-1 gag protein vaccine provides help to a recombinant Newcastle disease virus vectored vaccine including mobilization of protective CD8+ T cells. Immun Inflamm Dis. (2018) 6:163–75. 10.1002/iid3.209
42.
RingSMaasMNettelbeckDMEnkAHMahnkeK. Targeting of autoantigens to DEC205(+) dendritic cells in vivo suppresses experimental allergic encephalomyelitis in mice. J Immunol. (2013) 191:2938–47. 10.4049/jimmunol.1202592
43.
MaedaDBatistaMTPereiraLRdeJesus Cintra MAmorimJHMathias-SantosCet al. Adjuvant-mediated epitope specificity and enhanced neutralizing activity of antibodies targeting dengue virus envelope protein. Front Immunol. (2017) 8:1175. 10.3389/fimmu.2017.01175
44.
LambethCRWhiteLJJohnstonREdeSilva AM. Flow cytometry-based assay for titrating dengue virus. J Clin Microbiol. (2005) 43:3267–72. 10.1128/JCM.43.7.3267-3272.2005
45.
MedinaFMedinaJFColonCVergneESantiagoGAMunoz-JordanJL. Dengue virus: isolation, propagation, quantification, and storage. Curr Protoc Microbiol (2012). Chapter 15, Unit 15D.12. 10.1002/9780471729259.mc15d02s27
46.
BeltramelloMWilliamsKLSimmonsCPMacagnoASimonelliLQuyenNTet al. The human immune response to dengue virus is dominated by highly cross-reactive antibodies endowed with neutralizing and enhancing activity. Cell Host Microbe. (2010) 8:271–83. 10.1016/j.chom.2010.08.007
47.
ShresthaBBrienJDSukupolvi-PettySAustinSKEdelingMAKimTet al. The development of therapeutic antibodies that neutralize homologous and heterologous genotypes of dengue virus type 1. PLoS Pathog. (2010) 6:e1000823. 10.1371/journal.ppat.1000823
48.
WHO (Ed.). Global Strategy for Dengue Prevention and Control 2012-2020. France: WHO Library Cataloguing-in-Publication Data (2012).
49.
VanniceKSDurbinAHombachJ. Status of vaccine research and development of vaccines for dengue. Vaccine (2016) 34:2934–8. 10.1016/j.vaccine.2015.12.073
50.
Wilder-SmithAHombachJFergusonNSelgelidMO'BrienKVanniceKet al. Deliberations of the strategic advisory group of experts on immunization on the use of CYD-TDV dengue vaccine. Lancet Infect Dis. (2018) 19:e31–8. 10.1016/S1473-3099(18)30494-8
51.
TrumpfhellerCFinkeJSLopezCBMoranTMMoltedoBSoaresHet al. Intensified and protective CD4+ T cell immunity in mice with anti-dendritic cell HIV gag fusion antibody vaccine. J Exp Med. (2006) 203:607–17. 10.1084/jem.20052005
52.
TrumpfhellerCCaskeyMNchindaGLonghiMPMizeninaOHuangYet al. The microbial mimic poly IC induces durable and protective CD4+ T cell immunity together with a dendritic cell targeted vaccine. Proc Natl Acad Sci USA (2008) 105:2574–9. 10.1073/pnas.0711976105
53.
SardesaiNYWeinerDB. Electroporation delivery of DNA vaccines: prospects for success. Curr Opin Immunol. (2011) 23:421–9. 10.1016/j.coi.2011.03.008
54.
SalesNSSilvaJRApsLSilvaMOPorchiaBFerreiraLCSet al. In vivo electroporation enhances vaccine-mediated therapeutic control of human papilloma virus-associated tumors by the activation of multifunctional and effector memory CD8(+) T cells. Vaccine (2017) 35:7240–9. 10.1016/j.vaccine.2017.11.011
55.
Coconi-LinaresNOrtega-DavilaELopez-GonzalezMGarcia-MachorroJGarcia-CorderoJSteinmanRMet al. Targeting of envelope domain III protein of DENV type 2 to DEC-205 receptor elicits neutralizing antibodies in mice. Vaccine (2013) 31:2366–71. 10.1016/j.vaccine.2013.03.009
56.
TenbuschMIgnatiusRNchindaGTrumpfhellerCSalazarAMTopferKet al. Immunogenicity of DNA vaccines encoding simian immunodeficiency virus antigen targeted to dendritic cells in rhesus macaques. PLoS ONE (2012) 7:e39038. 10.1371/journal.pone.0039038
57.
YuDLiuHShiSDongLWangHWuNet al. A novel dendritic-cell-targeting DNA vaccine for hepatitis B induces T cell and humoral immune responses and potentiates the antivirus activity in HBV transgenic mice. Immunol Lett. (2015) 168:293–9. 10.1016/j.imlet.2015.10.007
58.
NiezoldTStorcksdieckGenannt Bonsmann MMaaskeATemchuraVHeineckeVHannamanDet al. DNA vaccines encoding DEC205-targeted antigens: immunity or tolerance?Immunology (2015) 145:519–33. 10.1111/imm.12467
59.
Sukupolvi-PettySAustinSKPurthaWEOliphantTNybakkenGESchlesingerJJet al. Type- and subcomplex-specific neutralizing antibodies against domain III of dengue virus type 2 envelope protein recognize adjacent epitopes. J Virol (2007) 81:12816–26. 10.1128/JVI.00432-07
60.
Sukupolvi-PettySAustinSKEngleMBrienJDDowdKAWilliamsKLet al. Structure and function analysis of therapeutic monoclonal antibodies against dengue virus type 2. J Virol. (2010) 84:9227–39. 10.1128/JVI.01087-10
61.
PuschnikALauLCromwellEABalmasedaAZompiSHarrisE. Correlation between dengue-specific neutralizing antibodies and serum avidity in primary and secondary dengue virus 3 natural infections in humans. PLoS Negl Trop Dis. (2013) 7:e2274. 10.1371/journal.pntd.0002274
62.
AlexanderMRRingeRSandersRWVossJEMooreJPKlassePJ. What do chaotrope-based avidity assays for antibodies to HIV-1 envelope glycoproteins measure?J Virol. (2015) 89:5981–95. 10.1128/JVI.00320-15
63.
ValdesIGilLRomeroYCastroJPuentePLazoLet al. The chimeric protein domain III-capsid of dengue virus serotype 2 (DEN-2) successfully boosts neutralizing antibodies generated in monkeys upon infection with DEN-2. Clin Vaccine Immunol. (2011) 18:455–9. 10.1128/CVI.00382-10
64.
SoaresHWaechterHGlaichenhausNMougneauEYagitaHMizeninaOet al. A subset of dendritic cells induces CD4+ T cells to produce IFN-gamma by an IL-12-independent but CD70− dependent mechanism in vivo. J Exp Med. (2007) 204:1095–106. 10.1084/jem.20070176
65.
DoYParkCGKangYSParkSHLynchRMLeeHet al. Broad T cell immunity to the LcrV virulence protein is induced by targeted delivery to DEC-205/CD205-positive mouse dendritic cells. Eur J Immunol. (2008) 38:20–9. 10.1002/eji.200737799
66.
DarrahPAPatelDTDeLuca PMLindsayRWDaveyDFFlynnBJet al. Multifunctional TH1 cells define a correlate of vaccine-mediated protection against Leishmania major. Nat Med. (2007) 13:843–50. 10.1038/nm1592
67.
EmuBSinclairEFavreDMorettoWJHsuePHohRet al. Phenotypic, functional, and kinetic parameters associated with apparent T-cell control of human immunodeficiency virus replication in individuals with and without antiretroviral treatment. J Virol. (2005) 79:14169–78. 10.1128/JVI.79.22.14169-14178.2005
68.
OwenREHeitmanJWHirschkornDFLanteriMCBiswasHHMartinJNet al. HIV+ elite controllers have low HIV-specific T-cell activation yet maintain strong, polyfunctional T-cell responses. AIDS (2010) 24:1095–105. 10.1097/QAD.0b013e3283377a1e
69.
HatchSEndyTPThomasSMathewAPottsJPazolesPet al. Intracellular cytokine production by dengue virus-specific T cells correlates with subclinical secondary infection. J Infect Dis. (2011) 203:1282–91. 10.1093/infdis/jir012jir012
70.
LindowJCBorochoff-PorteNDurbinAPWhiteheadSSFimlaidKABunnJYet al. Primary vaccination with low dose live dengue 1 virus generates a proinflammatory, multifunctional T cell response in humans. PLoS Negl Trop Dis. (2012) 6:e1742. 10.1371/journal.pntd.0001742
71.
TenbuschMNchindaGStorcksdieckgenannt Bonsmann MTemchuraVUberlaK. Targeting the antigen encoded by adenoviral vectors to the DEC205 receptor modulates the cellular and humoral immune response. Int Immunol. (2013) 25:247–58. 10.1093/intimm/dxs112dxs112
72.
HawigerDInabaKDorsettYGuoMMahnkeKRiveraMet al. Dendritic cells induce peripheral T cell unresponsiveness under steady state conditions in vivo. J Exp Med. (2001) 194:769–79. 10.1084/jem.194.6.769
73.
TakaokaAWangZChoiMKYanaiHNegishiHBanTet al. DAI (DLM-1/ZBP1) is a cytosolic DNA sensor and an activator of innate immune response. Nature (2007) 448:501–5. 10.1038/nature06013
74.
LiSPengLZhaoWZhongHZhangFYanZet al. Synthetic peptides containing B- and T-cell epitope of dengue virus-2 E domain III provoked B- and T-cell responses. Vaccine (2011) 29:3695–702. 10.1016/j.vaccine.2011.03.002
75.
GrifoniAAngeloMALopezBO'RourkePHSidneyJCerpasCet al. Global Assessment of Dengue Virus-Specific CD4(+) T cell responses in dengue-endemic areas. Front Immunol. (2017) 8:1309. 10.3389/fimmu.2017.01309
76.
WeiskopfDAngeloMAGrifoniAO'RourkePHSidneyJPaulSet al. HLA-DRB1 alleles are associated with different magnitudes of dengue virus-specific CD4+ T-Cell responses. J Infect Dis. (2016) 214:1117–24. 10.1093/infdis/jiw309
77.
RoehrigJTRisiPABrubakerJRHuntARBeatyBJTrentDWet al. T-helper cell epitopes on the E-glycoprotein of dengue 2 Jamaica virus. Virology (1994) 198:31–8. 10.1006/viro.1994.1005
78.
KuraneIInnisBLNisalakAHokeCNimmannityaSMeagerAet al. Human T cell responses to dengue virus antigens. Proliferative responses and interferon gamma production. J Clin Invest. (1989) 83:506–13. 10.1172/JCI113911
79.
GreenSKuraneIEdelmanRTacketCOEckelsKHVaughnDWet al. Dengue virus-specific human CD4+ T-lymphocyte responses in a recipient of an experimental live-attenuated dengue virus type 1 vaccine: bulk culture proliferation, clonal analysis, and precursor frequency determination. J Virol. (1993) 67:5962–7.
80.
GoncalvesAJOliveiraERCostaSMPaesMVSilvaJFAzevedoASet al. Cooperation between CD4+ T Cells and humoral immunity is critical for protection against dengue using a DNA vaccine based on the NS1 antigen. PLoS Negl Trop Dis. (2015) 9:e0004277. 10.1371/journal.pntd.0004277
81.
YauchLEPrestwoodTRMayMMMorarMMZellwegerRMPetersBet al. CD4+ T cells are not required for the induction of dengue virus-specific CD8+ T cell or antibody responses but contribute to protection after vaccination. J Immunol. (2010) 185:5405–16. 10.4049/jimmunol.1001709
82.
PooleyJLHeathWRShortmanK. Cutting edge: intravenous soluble antigen is presented to CD4 T cells by CD8− dendritic cells, but cross-presented to CD8 T cells by CD8+ dendritic cells. J Immunol. (2001) 166:5327–30. 10.4049/jimmunol.166.9.5327
83.
denHaan JMBevanMJ. Constitutive versus activation-dependent cross-presentation of immune complexes by CD8+ and CD8− dendritic cells in vivo. J Exp Med. (2002) 196:817–27. 10.1084/jem.20020295
84.
RivinoLKumaranEAJovanovicVNaduaKTeoEWPangSWet al. Differential targeting of viral components by CD4+ versus CD8+ T lymphocytes in dengue virus infection. J Virol. (2013) 87:2693–706. 10.1128/JVI.02675-12
Summary
Keywords
dengue fever, dendritic cells, envelope protein domain III, single-chain Fv antibody, DNA vaccine
Citation
Zaneti AB, Yamamoto MM, Sulczewski FB, Almeida BS, Souza HFS, Ferreira NS, Maeda DLNF, Sales NS, Rosa DS, Ferreira LCS and Boscardin SB (2019) Dendritic Cell Targeting Using a DNA Vaccine Induces Specific Antibodies and CD4+ T Cells to the Dengue Virus Envelope Protein Domain III. Front. Immunol. 10:59. doi: 10.3389/fimmu.2019.00059
Received
05 October 2018
Accepted
10 January 2019
Published
29 January 2019
Volume
10 - 2019
Edited by
Urszula Krzych, Walter Reed Army Institute of Research, United States
Reviewed by
Tejram Sahu, Johns Hopkins University, United States; Sri H. Ramarathinam, Monash University, Australia
Updates
Copyright
© 2019 Zaneti, Yamamoto, Sulczewski, Almeida, Souza, Ferreira, Maeda, Sales, Rosa, Ferreira and Boscardin.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Silvia Beatriz Boscardin sbboscardin@usp.br
This article was submitted to Vaccines and Molecular Therapeutics, a section of the journal Frontiers in Immunology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.