Abstract
Lactoferrin is a multifunctional iron-binding glycoprotein belonging to the transferrin family. It is found abundantly in milk and is present as a major protein in human exocrine secretions where it plays a role in the innate immune response. Various antifungal functions of lactoferrin have been reported including a wide spectrum of activity across yeasts and molds and synergy with other antifungal drugs in combination therapy, and various modes of action have been proposed. Bioactive peptides derived from lactoferrin can also exhibit strong antifungal activity, with some surpassing the potency of the whole protein. This paper reviews current knowledge of the spectrum of activity, proposed mechanisms of action, and capacity for synergy of lactoferrin and its peptides, including the three most studied derivatives: lactoferricin, lactoferrampin, and Lf(1–11), as well as some lactoferrin-derived variants and modified peptides.
Introduction
The rising incidence of severe fungal infections, due largely to increased numbers of immunocompromised patients, has made the discovery of new compounds that have effective antifungal activity or that support the activity of currently used antifungal agents more important than ever. Natural products are a significant source of novel antimicrobial compounds, and an increasing number are being identified from mammalian sources including milk proteins. One example is the multifunctional iron-binding glycoprotein, lactoferrin (Lf), and its various derived peptides. This article will focus on the spectrum of antifungal activity shown by Lf when used alone and in combination with other antifungal drugs, and will review currently proposed mechanisms of antifungal action for Lf and its derived peptides.
First identified almost 80 years ago in bovine milk (Sorensen and Sorensen, 1939) and later isolated and purified from humans and cows in 1960 (Groves, ), Lf is produced by various mammals including pigs, goats, dogs, mice, and horses (Lönnerdal and Iyer, 1995; Garcia-Montoya et al., ). In humans, it is a major protein secreted by the epithelial cells into exocrine fluids such as tears, saliva, vaginal fluids, gastrointestinal fluids, bile, urine, and sweat (Masson et al., 1968; van der Strate et al., 2001; González-Chávez et al., ; Park et al., 2011) but is present at the highest concentrations in human colostrum and breast milk (Lönnerdal and Iyer, 1995). Lf is involved in various physiological functions including iron regulation and the innate immune response, and has been demonstrated to have anti-inflammatory, anti-oxidant, anti-allergic, and anti-cancer properties (Conneely, ; Kruzel et al., 2006; Actor et al., ; Iigo et al., ; Burrow et al., ; Ogasawara et al., 2014) in addition to antimicrobial activity against a wide range of fungal, bacterial, viral, and parasitic pathogens (Jenssen and Hancock, 2009; Leboffe et al., 2009; Berlutti et al., ; Giansanti et al., ). The ability to bind and sequester iron is an important component of the antimicrobial activity of Lf (Jenssen and Hancock, 2009).
In addition to being an active intact protein, Lf is a rich source of antimicrobial peptides that are cleaved from the polypeptide chain by various proteolytic enzymes. As many of these enzymes are present in various body sites in humans, it is expected that a number of the cleaved peptides contribute to the normal functions of Lf in the body (Sinha et al., 2013). An increasing number of Lf-derived peptides are also being generated and modified by chemical synthesis (van der Kraan et al., 2005a). Many Lf peptides exhibit a broad spectrum of antimicrobial activity, have various different structural elements and modes of action, and appear to perform numerous functions including modulation of the inflammatory response, and stimulation of apoptosis (Farnaud et al., ; Sánchez-Gómez et al., 2008; van der Does et al., 2012).
Structure and antifungal activity of whole lactoferrin
The structure of Lf consists of a single polypeptide chain containing ~700 amino acids folded into two globular lobes. These lobes are highly homologous to each other and are connected by an α-helical residue providing flexibility to the Lf molecule. Each lobe consists of two domains forming a single iron binding site, allowing each Lf molecule to strongly bind two ferric ions (Anderson et al., ). The open, iron-free form of Lf is known as apo-Lf while the closed, iron-rich form is holo-Lf, which differs in tertiary structure and is more resistant to proteolysis than apo-Lf (Jameson et al., 1998). In addition to binding Fe3+, Lf has also been observed to bind a range of other compounds including lipopolysaccharides, heparin, DNA, and metal ions including Cu2+, Zn2+, and Mn2+ (Baker, ).
Lf is most commonly purified from human (hLf) or bovine (bLf) milk but it has also been obtained from the milk and colostrum of several other mammals. Recombinant Lf (rLf) is increasingly being generated from microbial expression systems and through transgenic plants and animals (Lönnerdal and Iyer, 1995). Lf molecules from across species are highly homologous but have varying antifungal activity owing to small differences in structure. Furthermore, the level of activity of Lf with similar purities can vary substantially between different producers, ranging from reasonably active to inactive in the same test organism. bLf in particular has well-documented activity against a range of human and plant fungal pathogens including yeasts and molds (Table 1). Most widely studied is its activity on members of the Candida species, with Candida tropicalis, Candida krusei, and Candida albicans exhibiting the highest level of susceptibility while Candida glabrata has the lowest (Nikawa et al., 1993; Xu et al., 1998).
Table 1
| Position in Lf | Peptide | Source | Test organism | Inhibitory conc.‡ | References |
|---|---|---|---|---|---|
| Whole protein | Lactoferrin | Bovine | Aspergillus niger | IC50 = 578 μg/mL | Nikawa et al., 1993; Wakabayashi et al., 1998; Xu et al., 1998; Kuipers et al., 1999; Lahoz et al., 2008; Lai et al., 2016 |
| Candida albicans* | MIC = 200–>6400 μg/mL | ||||
| Candida glabrata* | MIC = >6000 μg/mL | ||||
| Candida guilliermondii* | MIC not determined | ||||
| Candida krusei* | IC50 = 20 μg/mL | ||||
| Candida parapsilosis* | MIC not determined | ||||
| Candida tropicalis* | MIC not determined | ||||
| Cryptococcus gattii* | MIC = 64 μg/mL | ||||
| Cryptococcus neoformans* | MIC = 64 μg/mL | ||||
| Phoma exigua | IC50 = 821 μg/mL | ||||
| Rhizoctonia solani | IC50 = 121 μg/mL | ||||
| Saccharomyces cerevisiae | MIC = 16 μg/mL | ||||
| Sclerotium rolfsii | IC50 = 231 μg/mL | ||||
| Sclerotinia sclerotiorum | IC50 = 31 μg/mL | ||||
| Trichoderma viride | IC50 = 952 μg/mL | ||||
| 1–11 | Lf(1–11) | Human | Candida albicans | MIC not determined | Lupetti et al., 2000, 2008 |
| Aspergillus fumigatus | MIC = 4.3 μM | ||||
| 16–40 | HLBD1 | Human | Candida albicans | MMC = 6.2 μg/ml | Kondori et al., 2011 |
| 17–26 | Peptide 2 | Bovine | Candida albicans* | MIC = 17.3–17.5 μM | Ueta et al., 2001 |
| 17–30 | bLf 17–30 | Bovine | Candida albicans* | MIC = 5–10 μM | van der Kraan et al., 2004 |
| 17–31 | Lfcin B 17–31 | Bovine | Alternatria sp. | MIC = 16 μM | Muñoz and Marcos, 2006; Enrique et al., |
| Aspergillus nidulans | MIC = 4 μM | ||||
| Botrytis cinerea | MIC = 16 μM | ||||
| Dekkera bruxellensis* | MIC = 3.75–20 μM | ||||
| Fusarium oxysporum | MIC = 8 μM | ||||
| Penicillium digitatum | MIC = 4 μM | ||||
| Penicillium expansum | MIC = 8 μM | ||||
| Penicillium italicum | MIC = 4 μM | ||||
| Pichia membranifaciens | MIC not determined | ||||
| Saccharomyces cerevisiae | MIC = 32 μM | ||||
| Zygosaccharomyces bailii | MIC = 8 μM | ||||
| Zygosaccharomyces bisprous | MIC = 12 μM | ||||
| 17–31 | Lfcin H 17–31 | Human | Candida albicans | MIC = 10 μg/ml | Håversen et al., |
| 17–41 | Lactoferricin | Bovine | Absidia corymbifera* | MIC = 40 μg/ml | Bellamy et al., , ; Wakabayashi et al., 1996, 1998, 1999 |
| Aspergillus versicolor | MIC = 10 μg/ml | ||||
| Candida albicans* | MIC = 0.8–400 μg/ml | ||||
| Candida glabrtata* | MIC = 80–120 μg/ml | ||||
| Candida guilliermondii* | MIC = 5–40 μg/ml | ||||
| Candida kefyr* | MIC = 2.5–10 μg/ml | ||||
| Candida krusei* | MIC = 10–20 μg/ml | ||||
| Candida parapsilosis* | MIC = 7.8–80 μg/ml | ||||
| Candida tropicalis* | MIC = 0.31–1.25 μg/ml | ||||
| Cladosporium trichoides* | MIC = 5 μg/ml | ||||
| Cryptococcus albidus | MIC = 24 μg/ml | ||||
| Cryptococcus curvatus | MIC = 9 μg/ml | ||||
| Cryptococcus neoformans* | MIC = 0.63 μg/ml | ||||
| Cryptococcus uniguttulatus | MIC = 6 μg/ml | ||||
| Epidermophyton floccosum | MIC = 0.31–2.5 μg/ml | ||||
| Exophiala dermatitidis* | MIC = 2 μg/ml | ||||
| Fonsecaea pedrosoi | MIC = 5 μg/ml | ||||
| Fusarium moniliforme* | MIC = 2.5–5 μg/ml | ||||
| Microsporum canis | MIC = 40 μg/ml | ||||
| Microsporum gypseum | MIC = 20–40 μg/ml | ||||
| Nannizia gypsea | MIC = 30 μg/ml | ||||
| Nannizzia incurvata | MIC = 18 μg/ml | ||||
| Nannizzia otae | MIC = 60 μg/ml | ||||
| Paracoccidioides brasiliensis* | MIC = 0.63–1.25 μg/ml | ||||
| Penicillium pinophilum | MIC = 45 μg/ml | ||||
| Penicillium vermiculatum | MIC = 45 μg/ml | ||||
| Phialophora verrucosa* | MIC = 5–10 μg/ml | ||||
| Saccharomyces cerevisiae | MIC = 0.63 μg/ml | ||||
| Sporothrix schenckii | MIC = 2–10 μg/ml | ||||
| Trichophyton mentagrophytes* | MIC = 6.3–45 μg/ml | ||||
| Trichophyton rubrum* | MIC = 13–60 μg/ml | ||||
| Trichophyton tonsurans* | MIC = 5–40 μg/ml | ||||
| Trichophyton violaceum* | MIC = 40 μg/ml | ||||
| Trichosporon cutaneum* | MIC = 1.25–18 μg/ml | ||||
| 18–31 | Lfcin 18–31 | Human | Candida albicans | MIC = 10 μg/ml | Håversen et al., |
| 18–37 | Lfcin B-20 | Bovine | Candida albicans | MIC = 8 μg/ml | Chen et al., |
| 18–37 | Lfcin P-20 | Porcine | Candida albicans | MIC = 32 μg/ml | Chen et al., |
| 18–40 | Lfpep | Human | Candida albicans | MIC = 18.7 μM | Viejo-Diaz et al., 2005 |
| Candida glabrata | MIC = 9.3 μM | ||||
| Candida guilliermondii | MIC = 9.3 μM | ||||
| Candida krusei | MIC = 4.7 μM | ||||
| Candida parapsilosis | MIC = 9.3 μM | ||||
| Candida tropicalis | MIC = 9.3 μM | ||||
| 18–42 | Lfcin B 18–42 | Bovine | Candida albicans | MIC = 100 μg/ml | Wakabayashi et al., 1999 |
| Trichophyton mentagrophytes | MIC = 12 μg/ml | ||||
| 19–31 | Lfcin 19–31 | Human | Candida albicans | MMC = 200 μg/ml | Håversen et al., |
| 19–38 | Lfcin H-20 | Human | Candida albicans | MIC = 256 μg/ml | Chen et al., |
| 20–25 | Lfcin B 20–25 | Bovine | Saccharomyces cerevisiae | MIC = >48 μM | Muñoz and Marcos, 2006; Enrique et al., |
| Dekkera bruxellensis | MIC not determined | ||||
| Pichia membranifaciens | MIC not determined | ||||
| Zygosaccharomyces bailii | MIC not determined | ||||
| Zygosaccharomyces bisporus | MIC not determined | ||||
| Cryptococcus albidus | MIC not determined | ||||
| Penicillium digitatum | MIC = 8 μM | ||||
| Penicillium italicum | MIC = 8 μM | ||||
| Penicillium expansum | MIC = 16 μM | ||||
| Penicillium sp. | MIC = 32 μM | ||||
| Aspergillus nidulans | MIC = 8 μM | ||||
| Botrytis cinerea | MIC = 16 μM | ||||
| Fusarium oxysporum | MIC = 16 μM | ||||
| 20–28 | Lfcin B-9 | Bovine | Candida albicans* | MIC = 25–32 μg/ul | Wakabayashi et al., 1999; Chen et al., |
| Trichophyton mentagrophytes | MIC = 6 μg/ul | ||||
| 20–28 | Lfcin P-9 | Porcine | Candida albicans | MIC = 512 μg/ml | Chen et al., |
| 20–31 | HL10 | Human | Candida albicans* | MMC = 100–200 μg/ml | Håversen et al., ; Kondori et al., 2011 |
| Candida parapsilosis* | MMC = 100–200 μg/ml | ||||
| Candida kefyr | MMC = 100 μg/ml | ||||
| Candida krusei | MMC = 100 μg/ml | ||||
| Candida neoformans* | MMC = 50 μg/ml | ||||
| 21–26 | Peptide 5 | Bovine | Candida albicans* | MIC = 500 μM | Ueta et al., 2001 |
| 21–29 | Lfcin H-9 | Human | Candida albicans | MIC = 256 μg/ml | Chen et al., |
| 30–41 | Peptide3 | Bovine | Candida albicans* | MIC = 635 μM | Ueta et al., 2001 |
| 152–182 | Kaliocin-1 | Human | Candida albicans | MIC = 150 μM | Viejo-Diaz et al., 2005 |
| Candida glabrata | MIC = 150 μM | ||||
| Candida guilliermondii | MIC = 150 μM | ||||
| Candida krusei | MIC = 150 μM | ||||
| Candida parapsilosis | MIC = 150 μM | ||||
| Candida tropicalis | MIC = 150 μM | ||||
| 259–284 | Lfampin 259–284 | Bovine | Candida albicans | LC50 = 2.3 μM | Bolscher et al., |
| 261–284 | Lfampin 261–284 | Bovine | Candida albicans | LC50 = 1.8 μM | van der Kraan et al., 2005a |
| 263–284 | Lfampin 263–284 | Bovine | Candida albicans | LC50 = 0.7 μM | van der Kraan et al., 2005a |
| 264–284 | Lfampin 264–284 | Bovine | Candida albicans | LC50 = 1.8 μM | van der Kraan et al., 2005a |
| 265–278 | Lfampin 265–278 | Bovine | Candida albicans | LC50 = >100 μM | van der Kraan et al., 2005a |
| 265–280 | Lfampin 265–280 | Bovine | Candida albicans | LC50 = 39 μM | van der Kraan et al., 2005a |
| 265–282 | Lfampin 265–282 | Bovine | Candida albicans | LC50 = 5.2 μM | van der Kraan et al., 2005a |
| 265–284 | Lfampin 265–284 | Bovine | Candida albicans | LC50 = 0.7 μM | Bolscher et al., |
| 265–296 | Lfampin 265–296 | Bovine | Candida albicans | LC50 = 0.5 μM | Bolscher et al., |
| 266–284 | Lfampin 266–284 | Bovine | Candida albicans | LC50 = 1.4 μM | van der Kraan et al., 2005a |
| 266–286 | Cap-LFampinH-K | Human | Candida albicans | MIC not determined | Haney et al., |
| 268–284 | Lactoferrampin | Bovine | Candida albicans | MIC = 4.3 μg/ml | van der Kraan et al., 2005a |
| 269–286 | LFampinH-K | Human | Candida albicans | MIC not determined | Haney et al., |
| 270–284 | Lfampin 270–284 | Bovine | Candida albicans | LC50 = 26 μM | van der Kraan et al., 2005a |
| Unknown | Hydrolysate | Human | Penicillium sp. | MIC = 60–300 μg/mL | Liceaga-Gesualdo et al., 2001 |
Antifungal spectrum of activity of Lf and derived peptides.
Indicates multiple strains were tested within species.
IC50, Inhibitory Concentration (50% Inhibition); LC50, Lethal Concentration (50% Mortality); MIC, Minimum Inhibitory Concentration; MMC, Minimum Microbiocidal Concentration. As different studies have used varying methods and sources of lactoferrin to determine inhibitory concentrations, these values may not be comparable between studies.
Early studies with Candida species attributed the antifungal effect of Lf to its ability to sequester iron resulting in a fungistatic effect (Kirkpatrick et al., 1971), and inhibition of growth of Candida and Cryptococcus can be rescued by the addition of iron (Al-Sheikh, ; Lai et al., 2016). In Aspergillus fumigatus, the sequestration of Fe3+ by apo-Lf was shown to be important for host defense (Zarember et al., 2007) indicating that iron sequestration can play a role in the antifungal action of Lf in vivo. More recent studies now suggest that the main antifungal mechanism of Lf is iron-independent and occurs through a direct interaction of Lf with the fungal cell surface, leading to cell membrane damage and leakage. Supernatant protein assays and propidium iodide staining have shown that Lf alters cell surface permeability in C. albicans, C. krusei, and Cryptococcus neoformans, leading to cell death (Nikawa et al., 1993; Wakabayashi et al., 1996; Kondori et al., 2011). Alterations to the cell surface itself including protein leakage, the formation of surface blebs, swelling, and cell collapse have been seen in Candida isolates through scanning electron microscopy (Nikawa et al., 1993; Wakabayashi et al., 1996; Xu et al., 1998; van der Kraan et al., 2005b).
The cellular release of potassium ions, cytosolic acidification, changes in membrane potential, intracellular ROS accumulation, and chromatin condensation have all been detected in C. albicans following treatment with Lf indicating the induction of an apoptotic phenotype (Viejo-DÃaz et al., 2004; Andres et al., ). The details by which Lf induces apoptosis-like processes in fungi remain largely unclear, however, recent studies have examined this mechanism in significant yeast species. In Saccharomyces cerevisiae, it was shown that hLf induces cell death in a mitochondrial and caspase-dependent way that is characterized by caspase activation, ROS accumulation and cytochrome c release (Acosta-Zaldivar et al., ). Work by the same group in C. albicans indicated that the proton-translocating ATPase Pma1p, which is a primary contributor to pH regulation in yeasts, was the target of hLf, inducing lethal mitochondrial dysfunction (Andres et al., ).
The combined use of Lf with other antifungal drugs has been increasingly studied in recent years. When combined with fluconazole, various sources of Lf have been observed to significantly enhance inhibitory activity and decrease the minimum inhibitory concentration (MIC) for several Candida species, including wild type and clinical strains, and ergosterol biosynthesis and azole-resistant mutants (Wakabayashi et al., 1998; Kuipers et al., 1999; Naidu et al., 2004; Venkatesh and Rong, 2008; Kobayashi et al., 2011). The mechanism of synergy between Lf and fluconazole is not yet well-understood and does not appear to result from an increased intracellular uptake of fluconazole, as the intracellular concentration of radiolabelled fluconazole was not affected by the addition of bLf (Kobayashi et al., 2011).
Several other azole drugs, including itraconazole, clotrimazole, and ketoconazole, as well as 5-fluorocytosine have been demonstrated to function synergistically with Lf in C. albicans (Wakabayashi et al., 1996; Kuipers et al., 1999). The polyene drugs amphotericin B and nystatin exhibited no interactions with bLf when tested in Candida species (Wakabayashi et al., 1996) although amphotericin B and bLf have been found to act synergistically in Cryptococcus neoformans, Cryptococcus gattii, and S. cerevisiae. The addition of exogenous iron did not rescue growth of Cryptococcus treated with amphotericin B and bLf, indicating that the mechanism of synergy is not solely due to iron chelation (Lai et al., 2016).
Structure and antifungal activity of lactoferricin—the major peptide derived from lactoferrin
Lactoferricin (Lfcin) is found in the human gut as a natural breakdown product and was first generated by Bellamy et al. () through pepsin hydrolysis of intact Lf. Bovine lactoferricin (bLfcin), comprising residues 17–41 from the N-terminal region of Lf, is simpler in structure but much more potent than human lactoferricin (hLfcin), which comprises residues 1–47. Both Lfcins possess an 18-residue loop region with a disulphide bridge and many positively charged and hydrophobic residues (Gifford et al., ).
The three dimensional structures of hLfcin and bLfcin differ from each other and from the homologous regions of the intact Lf protein, and it is thought these differences determine their different antifungal efficacies. While bLfcin forms a β-sheet confirmation in solution that contains a group of aligned hydrophobic residues well-suited to interactions with biological membranes, hLfcin forms a coiled structure in solution lacking the aligned residues and thus having weaker interactions with the target cell (Farnaud et al., ; Hunter et al., ; Alexander et al., ). Lfcin shows strongly enhanced antimicrobial activity compared to Lf and the antifungal efficacy of bLfcin, in particular, has been observed across a large range of various types of fungi (Table 1).
The primary antifungal mechanism of action of Lfcin appears to be through direct interaction with the fungal surface and disruption of the fungal membrane (Bellamy et al., ). Using confocal scanning laser microscopy, it was observed that bLfcin molecules were internalized by C. albicans cells within minutes (van der Kraan et al., 2005b) and that treatment with Lfcin resulted in dissipation of the proton gradient across the cell membrane (Gifford et al., ). In C. albicans and in the dermatophyte Trichophyton mentagrophytes, changes in ultrastructural features and an aggregation of cytoplasmic materials observed following treatment with Lfcin were traced to stimulation of ATP synthesis and extracellular secretion, resulting in pore formation in the plasma membrane (Bellamy et al., ; Ueta et al., 2001). Lfcin has also been shown to upregulate host defense via the induction of reactive oxygen species that stimulate the fungicidal activities of polymorphonuclear leukocytes (Kullberg et al., 1999). This ability to mount a combined assault on microbial pathogens is a common feature of natural host-derived products, most likely resulting from evolutionary pressures to maintain efficacy and prevent pathogens from developing resistance (Xu et al., 2009; Carter et al., ).
Synergy between bLfcin and azole antifungal drugs has been observed in C. albicans. In azole-resistant strains, the addition of low levels of bLfcin greatly increased inhibition by fluconazole and itraconazole and was seen to inhibit the growth of fungal hyphae (Wakabayashi et al., 1998). bLfcin has also been observed to function synergistically with clotrimazole and ketoconazole and it significantly reduced the formation of biofilms when used in combination with voriconazole and amphotericin B (Wakabayashi et al., 1996). The mechanistic basis of these synergistic actions remains unknown.
Antifungal activity of other lactoferrin-derived peptides
Lactoferrampin
Lactoferrampin (Lfampin), comprising residues 268–284 in the N1 domain of Lf, is located in close proximity to Lfcin in the tertiary structure of Lf. Identified as a molecule of interest due to its net positive charge and possession of a hydrophobic domain, Lfampin is thought to play a role in membrane-mediated activities of Lf (van der Kraan et al., 2004). Lfampin has demonstrated antifungal efficacy against C. albicans and is known to be more potent than Lf but has not yet been tested with a wide range of fungal organisms (Table 1). Similarly, whether Lfampin acts synergistically with antifungal drugs has not yet been determined.
Like Lfcin, the mechanism of action of Lfampin is by binding to and disrupting the cell membrane, and it was similarly observed to be internalized within a few minutes by C. albicans, resulting in membrane permeabilisation and the formation of vesicle-like structures (van der Kraan et al., 2005b). However, Lfampin differs greatly from Lfcin in amino acid composition, structure and orientation. In solution, the first 11 residues of bovine lactoferrampin (bLfampin) form an α-helical structure (Haney et al., ). A tryptophan residue in the N-terminal region has been shown to interact with model membranes and is contained in all varieties of Lfampin from different sources involved in membrane insertion indicating that it is responsible for this function (Haney et al., ; Sinha et al., 2013).
Lf(1–11)
The Lf(1–11) peptide comprises the first 11 amino acid residues of the N-terminal region of Lf and exhibits antifungal activity against C. albicans and A. fumigatus (Table 1; Lupetti et al., 2000). The mechanism of action of Lf(1–11) also appears to rely on interactions with the fungal membrane, with important structural features including its highly cationic nature and the presence of hydrophobic valine (V6) and tryptophan (W8) residues (Bruni et al., ). Lupetti et al. (2000) demonstrated through residue substitution that the first two arginines at the N-terminus (R2, R3) are also necessary for the antifungal action of hLf(1–11) in C. albicans. hLf(1–11) appears to have immunomodulatory properties during C. albicans infection where it directs the differentiation of monocytes into dendritic cells that enhance the polarization of a Th17 response, which is an important component of the host defense against fungi (van der Does et al., 2012).
When combined with fluconazole, a synergistic antifungal effect has been seen across various Candida species including C. glabrata, C. krusei, C. parapsilosis, C. tropicalis, and fluconazole-resistant strains of C. albicans. At sub-inhibitory concentrations, these yeasts were seen to be killed when preincubated with hLf(1–11) before introducing fluconazole but not when fluconazole was introduced first, indicating that hLf(1–11) is responsible for initiating candidacidal activity while fluconazole acts synergistically during a later stage (Lupetti et al., 2003).
Synthetic peptides based on lactoferrin
A wide variety of other derivatives of varying size and location have been generated from the whole Lf protein (Table 1). A number of these peptides were created in an attempt to facilitate the discovery of other antimicrobial sequences composed of short core residues within Lf. As an example of this, Chen et al. () created and tested a range of short synthetic derivatives of human, bovine, and porcine Lfcins in an attempt to discover other antimicrobial sequences comprising core residues within Lf. This enabled them to find the antimicrobial domain in Lfcin of porcine origin, and to compare its potency to Lfcins of human and bovine origin.
Lf derivatives have also been designed to help clarify the relationship between structure and function of particular Lf-derived peptides. In one study, by testing a collection of peptides obtained by extending and/or truncating the C- or N- terminal ends of Lfampin, it was demonstrated that the highest level of antimicrobial activity corresponded with strongest membrane interactions and greatest ability to form an α-helix (Adão et al., ). In another study, a significant increase in candidacidal activity was seen in an extended form of Lfampin due to an increased positive charge near the C-terminal end (Haney et al., ). These studies demonstrate that there is capacity to optimize the activity of Lf-derived molecules by careful consideration of their sequence and structural properties.
Modified and lactoferrin-like peptides
In recent years, an increasing number of studies have taken the path of modifying the original amino acid sequence of Lf peptides in order to develop more potent antifungal activity than in the parent peptides (Table 2). Various strategies designed to alter properties related to antifungal activity have been employed in the construction of these novel peptides such as modifying the length, net charge, and hydrophobicity of the peptide.
Table 2
| Peptide | Source | Modification | Amino acid sequence | Test organism | Inhibitory conc.‡ | References |
|---|---|---|---|---|---|---|
| HLR1r | Human | Derived from hLfcin; Arg-rich motif added to the C-terminal end to facilitate membrane interaction; N- and C-terminals capped. | Ac-FQWQRNMRKVRGSRRRRG-NH2 | Candida albicans | MMC = 3 μg/mL | Björn et al., |
| LBLP | S. s. mutilans | bLfcin-like peptide from the whole bodies of centipedes; found by BLASTx search (34.4% similarity). | RMKKLGNHKVSCERNTKRCRKAI | Candida albicans | MIC = 10 μM | Choi et al., |
| Candida parapsilosis | MIC = 10 μM | |||||
| Malassezia furfur | MIC = 10–20 μM | |||||
| Trichosporon beigelii | MIC = 20 μM | |||||
| L10 | Bovine | Derived from bLf; residues 1–8 modified by selective homologous substitution of amino acids on the basis of hydrophobicity. | WFRKQLKW | Candida albicans* | MIC = 12.5–100 μg/mL | Mishra et al., 2013 |
| Candia tropicalis* | MIC = 12.5–100 μg/mL | |||||
| Candia krusei | MIC = 25 μg/mL | |||||
| Candida glabrata | MIC = 25 μg/mL | |||||
| Candida parapsilosis | MIC = 6.25 μg/mL | |||||
| Lfchimera | Synthetic | Derived from bLfcin (17–30) and Lfampin; fusion (265–284) peptide generated synthetically. | FKCRRWQWRMKKLG-K-DLIWKLLSKAQEKFGKNKSR | Candida albicans | MIC not determined | Silva et al., 2013 |
| LFT33 | E. coli | Derived from bLfcin; fusion protein with thanatin; expressed recombinantly in E. coli. | FKCRRWQWRWKKLGAKPVPIIYCNRRTGKCQRM | Candida albicans | IC50 = 64 μg/mL | Feng et al., |
| HLopt2 | Human | Derived from hLf residues 20–31; modified by substitution with charged and hydrophobic amino acids. | CFQWKRAMRKVR | Candida albicans* | MMC = 12–25 μg/mL | Kondori et al., 2011 |
| Candida glabrata* | MMC = >400 μg/mL | |||||
| Candida parapsilosis* | MMC = 12–25 μg/mL | |||||
| Candida krusei | MMC = 12 μg/mL | |||||
| Candida kefyr | MMC = 12 μg/mL | |||||
| Cryptococcus neoformans* | MMC = 12 μg/mL |
Antifungal spectrum of activity of modified Lf-derived or Lf-like peptides.
Indicates multiple strains were tested within species.
IC50, Inhibitory Concentration (50% Inhibition); MIC, Minimum Inhibitory Concentration; MMC, Minimum Microbiocidal Concentration.
By the selective substitution of amino acids based on hydrophobicity in groups of residues derived from the N-terminal end of hLf, Kondori et al. (2011) and Mishra et al. (2013) created HLopt2 and L10, respectively. Björn et al. () subsequently developed HLR1r from hLfcin by the addition of an Arg-rich motif designed to facilitate membrane interactions, together with capping of the N- and C- terminals to make them neutral. These three peptides demonstrated potent antifungal action against Candida species that was substantially greater than that of the corresponding residues from the native Lf peptide. Taking another approach, fusion peptides have been generated synthetically from the combination of multiple bioactive peptides: Lfchimera, a fusion of bLfcin and Lfampin, and LFT33, a fusion of bLfcin and the insect-derived antimicrobial peptide thanatin (Feng et al., ; Silva et al., 2013).
In addition to modifications of the natural peptide, the sequence of Lf has been used to search for other naturally occurring peptides with high homology in order to facilitate discovery of novel potential antifungals. The utility of this approach was demonstrated by the discovery of LBLP, a peptide with 34.4% similarity to bLfcin and produced from the bodies of centipedes, which was found to have strong antifungal activity against strains of Candida, Malassezia, and Trichosporon (Choi et al., ).
Summary and conclusions
Lf and its major naturally cleaved peptide, Lfcin, have proven broad-spectrum antifungal action, with Lfcin exhibiting greater potency than the intact protein. The less well-characterized peptides including Lfampin and Lf(1–11) have also been seen to possess increased antifungal potency in Candida species but have not been tested extensively beyond this. Lf and Lfcin function synergistically primarily with azole antifungal drugs, however, knowledge of the spectrum and mechanism of these synergistic interactions is lacking, and synergy is largely unexplored for the other Lf-derived peptides.
Mechanistically, Lf and its peptides have been shown to function primarily through membrane destabilization, with immunomodulation and iron sequestration playing secondary roles. Although many aspects of Lf-derived peptides are quite conserved, differences in amino acid composition and tertiary structure contribute to their different functional properties. Novel alternative peptides that have been generated or modified from the original sequence of Lf provide insight into the relationship between structure and function. Lf and its derived peptides have great potential as leads for future antifungal drug development, however, considerable research is still required to understand the antifungal actions of these molecules as well as their potential to support current antifungals.
Funding
Work on Lf in the Carter Lab has been supported by the Australian National Health and Medical Research Council (Grant Number APP1021267). KF is financially supported by an Australian Postgraduate Award.
Conflict of interest statement
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Statements
Author contributions
This article was written by KF and was reviewed and edited by DC.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
Acosta-ZaldivarM.AndresM. T.RegoA.PereiraC. S.FierroJ. F.Corte-RealM. (2016). Human lactoferrin triggers a mitochondrial- and caspase-dependent regulated cell death in Saccharomyces cerevisiae. Apoptosis21, 163–173. 10.1007/s10495-015-1199-9
2
ActorJ. K.HwangS. A.KruzelM. L. (2009). Lactoferrin as a natural immune modulator. Curr. Pharm. Des.15, 1956–1973. 10.2174/138161209788453202
3
AdãoR.NazmiK.BolscherJ. G.BastosM. (2011). C- and N-truncated antimicrobial peptides from LFampin 265-284: biophysical versus microbiology results. J. Pharm. Bioallied Sci.3, 60–69. 10.4103/0975-7406.76467
4
AlexanderD. B.IigoM.YamauchiK.SuzuiM.TsudaH. (2012). Lactoferrin: an alternative view of its role in human biological fluids. Biochem. Cell Biol.90, 279–306. 10.1139/o2012-013
5
Al-SheikhH. (2009). Effect of lactoferrin and iron on the growth of human pathogenic Candida species. Pak. J. Biol. Sci.12, 91–94. 10.3923/pjbs.2009.91.94
6
AndersonB. F.BakerH. M.NorrisG. E.RiceD. W.BakerE. N. (1989). Structure of human lactoferrin: crystallographic structure analysis and refinement at 2.8 A resolution. J. Mol. Biol.209, 711–734. 10.1016/0022-2836(89)90602-5
7
AndresM. T.Acosta-ZaldivarM.FierroJ. F. (2016). Antifungal mechanism of action of lactoferrin: identification of H+-ATPase (P3A-type) as a new apoptotic-cell membrane receptor. Antimicrob. Agents Chemother.60, 4206–4216. 10.1128/AAC.03130-15
8
AndresM. T.Viejo-DiazM.FierroJ. F. (2008). Human lactoferrin induces apoptosis-like cell death in Candida albicans: critical role of K+-channel-mediated K+ efflux. Antimicrob. Agents Chemother.52, 4081–4088. 10.1128/AAC.01597-07
9
BakerE. N. (1994). Structure and reactivity of transferrins. Adv. Inorg. Chem.41, 389–463. 10.1016/S0898-8838(08)60176-2
10
BellamyW.TakaseM.WakabayashiH.KawaseK.TomitaM. (1992). Antibacterial spectrum of lactoferricin B, a potent bactericidal peptide derived from the N-terminal region of bovine lactoferrin. J. Appl. Bacteriol.73, 472–479. 10.1111/j.1365-2672.1992.tb05007.x
11
BellamyW.WakabayashiH.TakaseM.KawaseK.ShimamuraS.TomitaM. (1993). Killing of Candida albicans by lactoferricin B, a potent antimicrobial peptide derived from the N-terminal region of bovine lactoferrin. Med. Microbiol. Immunol.182, 97–105. 10.1007/BF00189377
12
BellamyW.YamauchiK.WakabayashiH.TakaseM.TakakuraN.ShimamuraS.et al. (1994). Antifungal properties of lactoferricin B, a peptide derived from the N-terminal region of bovine lactoferrin. Lett. Appl. Microbiol.18, 230–233. 10.1111/j.1472-765X.1994.tb00854.x
13
BerluttiF.PantanellaF.NataliziT.FrioniA.PaesanoR.PolimeniA.et al. (2011). Antiviral properties of lactoferrin - a natural immunity molecule. Molecules16, 6992–7018. 10.3390/molecules16086992
14
BjörnC.MahlapuuM.Mattsby-BaltzerI.HåkanssonJ. (2016). Anti-infective efficacy of the lactoferrin-derived antimicrobial peptide HLR1r. Peptides81, 21–28. 10.1016/j.peptides.2016.04.005
15
BolscherJ. G.van der KraanM. I.NazmiK.KalayH.GrunC. H.Van't HofW.et al. (2006). A one-enzyme strategy to release an antimicrobial peptide from the LFampin-domain of bovine lactoferrin. Peptides27, 1–9. 10.1016/j.peptides.2005.06.012
16
BruniN.CapucchioM. T.BiasibettiE.PessioneE.CirrincioneS.GiraudoL.et al. (2016). Antimicrobial activity of lactoferrin-related peptides and applications in human and veterinary medicine. Molecules21, 752. 10.3390/molecules21060752
17
BurrowH.KanwarR. K.KanwarJ. R. (2011). Antioxidant enzyme activites of iron-saturated bovine lactoferrin (Fe-blf) in human gut epithelial cells under oxidative stress. Med. Chem.7, 224–230. 10.2174/157340611795564286
18
CarterD. A.BlairS. E.CokcetinN. N.BouzoD.BrooksP.SchothauerR.et al. (2016). Therapeutic manuka honey: no longer so alternative. Front. Microbiol.7:569. 10.3389/fmicb.2016.00569
19
ChenH. L.YenC. C.LuC. Y.YuC. H.ChenC. M. (2006). Synthetic porcine lactoferricin with a 20-residue peptide exhibits antimicrobial activity against Escherichia coli, Staphylococcus aureus and Candida albicans. J. Agric. Food Chem.54, 3277–3282. 10.1021/jf053031s
20
ChoiH.HwangJ. S.LeeD. G. (2013). Antifungal effect and pore-forming action of lactoferricin B like peptide derived from centipede Scolopendra subspinipes mutilans. Biochim. Biophys. Acta1828, 2745–2750. 10.1016/j.bbamem.2013.07.021
21
ConneelyO. M. (2001). Anti-inflammatory activites of lactoferrin. J. Am. Coll. Nutr.20, 389s. 10.1080/07315724.2001.10719173
22
EnriqueM.MarcosJ. F.YusteM.MartinezM.VallesS.ManzanaresP. (2007). Antimicrobial action of synthetic peptides towards wine spoilage yeasts. Int. J. Food Microbiol.118, 318–325. 10.1016/j.ijfoodmicro.2007.07.049
23
FarnaudS.SpillerC.MoriartyL. C.PatelA.GantV.OdellE. W.et al. (2004). Interactions of lactoferricin-derived peptides with LPS and antimicrobial activity. FEMS Microbiol. Lett.233, 193–199. 10.1111/j.1574-6968.2004.tb09482.x
24
FengX.LiuC.GuoJ.SongX.LiJ.XuW.et al. (2012). Recombinant expression, purification, and antimicrobial activity of a novel hybrid antimicrobial peptide LFT33. Appl. Microbiol. Biotechnol.95, 1191–1198. 10.1007/s00253-011-3816-z
25
Garcia-MontoyaI. A.CendonT. S.Arevalo-GallegosS.Rascon-CruzQ. (2012). Lactoferrin a multiple bioactive protein: an overview. BIochi. Biophys. Acta1820, 226–236. 10.1016/j.bbagen.2011.06.018
26
GiansantiF.LeboffeL.D'EliaI.AntoniniG. (2013). An update on the antifungal activities of lactoferrin: new promising applications in diagnostic, therapeutics and biotechnology. Anti Infect. Agents11, 155–158. 10.2174/2211352511311020009
27
GiffordJ. L.HunterH. N.VogelH. J. (2005). Lactoferricin: a lactoferrin-derived peptide with antimicrobial, antiviral, antitumour, and immunological properties. Cell. Mol. Life Sci.62, 2588–2598. 10.1007/s00018-005-5373-z
28
González-ChávezS. A.Arevalo-GallegosS.Rascon-CruzQ. (2009). Lactoferrin: structure, function and applications. Int. J. Antimicrob. Agents33, 301e301–301e308. 10.1016/j.ijantimicag.2008.07.020
29
GrovesM. L. (1960). The isolation of a red protein from milk. J. Am. Chem. Soc.82, 3345–3350. 10.1021/ja01498a029
30
HaneyE. F.LauF.VogelH. J. (2007). Solution structures and model membrane interactions of lactoferrampin, an antimicrobial peptide derived from bovine lactoferrin. BIochi. Biophys. Acta1768, 2355–2364. 10.1016/j.bbamem.2007.04.018
31
HaneyE. F.NazmiK.LauF.BolscherJ. G.VogelH. J. (2009). Novel lactoferrampin antimicrobial peptides derived from human lactoferrin. Biochimie91, 141–154. 10.1016/j.biochi.2008.04.013
32
HåversenL.KondoriN.BaltzerL.HansonL. A.DolphinG. T.DunerK.et al. (2010). Structure-microbicidal activity relationship of synthetic fragments derived from the antibacterial alpha-helix of human lactoferrin. Antimicrob. Agents Chemother.54, 418–425. 10.1128/AAC.00908-09
33
HunterH. N.DemcoeA. R.JenssenH.GuttebergT. J.VogelH. J. (2005). Human lactoferricin is partially folded in aqueous solution and is better stabilized in a membrane mimetic solvent. Antimicrob. Agents Chemother.49, 3387–3395. 10.1128/AAC.49.8.3387-3395.2005
34
IigoM.AlexanderD. B.LongN.XuJ.FukamachiK.FutakuchiM.et al. (2009). Anticarginogenesis pathways activated by bovine lactoferrin in the murine small intestine. Biochimie91, 86–101. 10.1016/j.biochi.2008.06.012
35
JamesonG. B.AndersonB. F.NorrisG. E.ThomasD. H.BakerE. N. (1998). Structure of human apolactoferrin at 2.0 A resolution. Refinement and analysis of ligand-induced conformational change. Acta Crystallogr. D Biol. Crystallogr.54, 1319–1335. 10.1107/S0907444998004417
36
JenssenH.HancockR. E. (2009). Antimicrobial properties of lactoferrin. Biochimie91, 19–29. 10.1016/j.biochi.2008.05.015
37
KullbergB. J.NeteaM. G.VonkA. G.Van der MeerJ. W. (1999). Modulation of neutrophil function in host defense against disseminated Candida albicans infection in mice. FEMS Immunol. Med. Microbiol.26, 299–307. 10.1111/j.1574-695X.1999.tb01402.x
38
KirkpatrickC. H.GreenI.RichR. R.SchadeA. L. (1971). Inhibition of growth of Candida albicans by iron-unsaturated lactoferrin: relation to host-defence mechanisms in chronic mucocutaneous candidiasis. J. Infect. Dis.125, 539–544. 10.1093/infdis/124.6.539
39
KobayashiT.KakeyaH.MiyazakiT.IzumikawaK.YanagiharaK.OhnoH.et al. (2011). Synergistic antifungal effect of lactoferrin with azole antifungals against Candida albicans and a proposal for a new treatment method for invasive candidiasis. Jpn. J. Infect. Dis.64, 292–296.
40
KondoriN.BaltzerL.DolphinG. T.Mattsby-BaltzerI. (2011). Fungicidal activity of human lactoferrin-derived peptides based on the antimicrobial alphabeta region. Int. J. Antimicrob. Agents37, 51–57. 10.1016/j.ijantimicag.2010.08.020
41
KruzelM. L.BacsiA.ChoudhuryB.SurS.BoldoghI. (2006). Lactoferrin decreases pollen antigen-induced allergic airway inflammation in a murine model of asthma. Immunology119, 159–166. 10.1111/j.1365-2567.2006.02417.x
42
KuipersM. E.de VriesH. G.EikelboomM. C.MeijerD. K.SwartP. J. (1999). Synergistic fungistatic effects of lactoferrin in combination with antifungal drugs against clinical Candida isolates. Antimicrob. Agents Chemother.43, 2635–2641.
43
LahozE.PisacaneA.IannacconeM.PalumboD.CapparelliR. (2008). Fungistatic activity of iron-free bovin lactoferrin against several fungal plant pathogens and antagonists. Nat. Prod. Res.22, 955–961. 10.1080/14786410701650253
44
LaiY. W.CampbellL. T.WilkinsM. R.PangC. N.ChenS.CarterD. A. (2016). Synergy and antagonism between iron chelators and antifungal drugs in Cryptococcus. Int. J. Antimicrob. Agents48, 388–394. 10.1016/j.ijantimicag.2016.06.012
45
LeboffeL.GiansantiF.AntoniniG. (2009). Antifungal and antiparasitic activites of lactoferrin. Antiinfect. Agents Med. Chem.8, 114–127. 10.2174/187152109787846105
46
Liceaga-GesualdoA.Li-ChanE. C.SkuraB. J. (2001). Antimicrobial effect of lactoferrin digest on spores of a Penicillium sp. isolated from bottled water. Food Res. Int.34, 501–506. 10.1016/S0963-9969(00)00180-0
47
LönnerdalB.IyerS. (1995). Lactoferrin: molecular structure and biological function. Annu. Rev. Nutr.44, 3257–3263. 10.1146/annurev.nu.15.070195.000521
48
LupettiA.Paulusma-AnnemaA.WellingM. M.Dogterom-BalleringH.BrouwerC. P.SenesiS.et al. (2003). Synergistic activity of the N-terminal peptide of human lactoferrin and fluconazole against Candida species. Antimicrob. Agents Chemother.47, 262–267. 10.1128/AAC.47.1.262-267.2003
49
LupettiA.Paulusma-AnnemaA.WellingM. M.SenesiS.van DisselJ. T.NibberingP. H. (2000). Candidacidal activities of human lactoferrin peptides derived from the N terminus. Antimicrob. Agents Chemother.44, 3257–3263. 10.1128/AAC.44.12.3257-3263.2000
50
LupettiA.van DisselJ. T.BrouwerC. P.NibberingP. H. (2008). Human antimicrobial peptides' antifungal activity against Aspergillus fumigatus. Eur. J. Clin. Microbiol. Infect. Dis.27, 1125–1129. 10.1007/s10096-008-0553-z
51
MassonP. L.HeremansJ. F.FerinJ. (1968). Presence of an iron-binding protein (lactoferrin) in the genital tract of the human female. I. Its immunohistochemical localization in the endometrium. Fertil. Steril.19, 679–689. 10.1016/S0015-0282(16)36781-4
52
MishraB.LeishangthemG. D.GillK.SinghA. K.DasS.SinghK.et al. (2013). A novel antimicrobial peptide derived from modified N-terminal domain of bovine lactoferrin: design, synthesis, activity against multidrug-resistant bacteria and Candida. Biochim. Biophys. Acta1828, 677–686. 10.1016/j.bbamem.2012.09.021
53
MuñozA.MarcosJ. F. (2006). Activity and mode of action against fungal phytopathogens of bovine lactoferricin-derived peptides. J. Appl. Microbiol.101, 1199–1207. 10.1111/j.1365-2672.2006.03089.x
54
NaiduA. S.FowlerR. S.MartinezC.ChenJ.TulpinskiJ. (2004). Activated lactoferrin and fluconazole synergism against Candida albcians and Candida glabrata vaginal isolates. J. Reprod. Med.49, 800–807.
55
NikawaH.SamaranayakeL. P.TenovuoJ.PangK. M.HamadaT. (1993). The fungicidal effect of human lactoferrin on Candida albicans and Candida krusei. Arch. Oral Biol.38, 1057–1063. 10.1016/0003-9969(93)90167-K
56
OgasawaraY.ImaseM.OdaH.WakabayashiH.IshiiK. (2014). Lactoferrin directly scavenges hydroxyl radicals and undergoes oxidative self-degradation: a possible role in protection against oxidative DNA damage. Int. J. Mol. Sci.15, 1003–1013. 10.3390/ijms15011003
57
ParkJ. H.ParkG. T.ChoI. H.SimS. M.YangJ. M.LeeD. Y. (2011). An antimicrobial protein, lactoferrin exists in the sweat: proteomic analysis of sweat. Exp. Dermatol.20, 369–371. 10.1111/j.1600-0625.2010.01218.x
58
Sánchez-GómezS.LamataM.LeivaJ.BlondelleS. E.JeralaR.AndraJ.et al. (2008). Comparative analysis of selected methods for the assessment of antimicrobial and membrane-permeabilizing activity: a case study for lactoferricin derived peptides. BMC Microbiol.8:196. 10.1186/1471-2180-8-196
59
SilvaT.AdaoR.NazmiK.BolscherJ. G.FunariS. S.UhrikovaD.et al. (2013). Structural diversity and mode of action on lipid membranes of three lactoferrin candidacidal peptides. Biochim. Biophys. Acta1828, 1329–1339. 10.1016/j.bbamem.2013.01.022
60
SinhaM.KaushikS.KaurP.SharmaS.SinghT. P. (2013). Antimicrobial lactoferrin peptides: the hidden players in the protective function of a multifunctional protein. Int. J. Pept.2013:390230. 10.1155/2013/390230
61
SorensenM.SorensenS. P. L. (1939). The proteins of whey. Compt. Rend. Trav. Lab. Carlsberg Ser. Chim. 23, 35–99.
62
UetaE.TanidaT.OsakiT. (2001). A novel bovine lactoferrin peptide, FKCRRWQWRM, suppresses Candida cell growth and activates neutrophils. J. Pept. Res.57, 240–249. 10.1111/j.1399-3011.2001.00821.x
63
van der DoesA. M.JoostenS. A.VroomansE.BogaardsS. J.van MeijgaardenK. E.OttenhoffT. H.et al. (2012). The antimicrobial peptide hLF1-11 drives monocyte-dendritic cell differentiation toward dendritic cells that promote antifungal responses and enhance Th17 polarization. J. Innate Immun.4, 284–292. 10.1159/000332941
64
van der KraanM. I.GroeninkJ.NazmiK.VeermanE. C.BolscherJ. G.Nieuw AmerongenA. V. (2004). Lactoferrampin: a novel antimicrobial peptide in the N1-domain of bovine lactoferrin. Peptides25, 177–183. 10.1016/j.peptides.2003.12.006
65
van der KraanM. I.Van der MadeC.NazmiK.Van't HofW.GroeninkJ.VeermanE. C.et al. (2005a). Effect of amino acid substitutions on the candidacidal activity of LFampin 265-284. Peptides26, 2093–2097. 10.1016/j.peptides.2005.03.056
66
van der KraanM. I.Van MarleJ.NazmiK.GroeninkJ.Van 't HofW.VeermanE. C.et al. (2005b). Ultrastructural effects of antimicrobial peptides from bovine lactoferrin on the membranes of Candida albicans and Escherichia coli. Peptides26, 1537–1542. 10.1016/j.peptides.2005.02.011
67
van der StrateB. W.BelijaarsL.MolemaG.HarmsenM. C.MeijerD. K. (2001). Antiviral activites of lactoferrin. Antiviral Res.52, 225–239. 10.1016/S0166-3542(01)00195-4
68
VenkateshM. P.RongL. (2008). Human recombinant lactoferrin acts synergistically with antimicrobials commonly used in neonatal practice against coagulase-negative staphylococci and Candida albicans causing neonatal sepsis. J. Med. Microbiol.57, 1113–1121. 10.1099/jmm.0.2008/001263-0
69
Viejo-DÃazM.AndresM. T.FierroJ. F. (2004). Modulation of in vitro fungicidal activity of human lactoferrin against Candida albicans by extracellular cation concentration and target cell metabolic activity. Antimicrob. Agents Chemother.48, 1242–1248. 10.1128/AAC.48.4.1242-1248.2004
70
Viejo-DiazM.AndresM. T.FierroJ. F. (2005). Different anti-Candida activities of two human lactoferrin-derived peptides, Lfpep and Kaliocin-1. Antimicrob. Agents Chemother.49, 2583–2588. 10.1128/AAC.49.7.2583-2588.2005
71
WakabayashiH.AbeS.OkutomiT.TanshoS.KawaseK.YamaguchiH. (1996). Cooperative anti-Candida effects of lactoferrin or its peptides in combination with azole antifungal agents. Microbiol. Immunol.40, 821–825. 10.1111/j.1348-0421.1996.tb01147.x
72
WakabayashiH.AbeS.TeraguchiS.HayasawaH.YamaguchiH. (1998). Inhibition of hyphal growth of azole-resistant strains of Candida albicans by triazole antifungal agents in the presence of lactoferrin-related compounds. Antimicrob. Agents Chemother.42, 1587–1591.
73
WakabayashiH.MatsumotoH.HashimotoK.TeraguchiS.TakaseM.HayasawaH. (1999). N-acylated and D enantiomer derivatives of a nonamer core peptide of lactoferricin B showing improved antimicrobial activity. Antimicrob. Agents Chemother.43, 1267–1269.
74
XuY.WangY.YanL.LiangR. M.DaiB. D.TangR. J.et al. (2009). Proteomic analysis reveals a synergistic mechanism of fluconazole and berberine against fluconazole-resistant Candida albicans: endogenous ROS augmentation. J. Proteome Res.8, 5296–5304. 10.1021/pr9005074
75
XuY. Y.SamaranayakeY. H.SamaranayakeL. P.NikawaH. (1998). In vitro susceptibility of Candida species to lactoferrin. Med. Mycol.37, 35–41. 10.1080/02681219980000051
76
ZaremberK. A.SuguiJ. A.ChangY. C.Kwon-ChungK. J.GallinJ. I. (2007). Human polymorphonuclear leukocytes inhibit Aspergillus fumigatus conidial growth by lactoferrin-mediated iron depletion. J. Immunol.178, 6367–6373. 10.4049/jimmunol.178.10.6367
Summary
Keywords
lactoferrin, lactoferricin, lactoferrampin, Lf(1–11), antimicrobial peptides, natural products, fungi, synergy
Citation
Fernandes KE and Carter DA (2017) The Antifungal Activity of Lactoferrin and Its Derived Peptides: Mechanisms of Action and Synergy with Drugs against Fungal Pathogens. Front. Microbiol. 8:2. doi: 10.3389/fmicb.2017.00002
Received
27 October 2016
Accepted
03 January 2017
Published
18 January 2017
Volume
8 - 2017
Edited by
Luis Cláudio Nascimento Da Silva, CEUMA University, Brazil
Reviewed by
Osmar Nascimento Silva, Universidade Católica Dom Bosco, Brazil; Adrian Canizalez-Roman, Autonomous University of Sinaloa, Mexico; José Fernando Fierro, University of Oviedo, Spain
Updates
Copyright
© 2017 Fernandes and Carter.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Dee A. Carter dee.carter@sydney.edu.au
This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.