Abstract
Introduction:
Hepatitis E virus (HEV), with heightened virulence in immunocompromised individuals and pregnant women, is a pervasive threat in developing countries. A globaly available vaccine against HEV is currently lacking.
Methods:
We designed a multi-epitope vaccine based on protein ORF2 and ORF3 of HEV using immunoinformatics.
Results:
The vaccine comprised 23 nontoxic, nonallergenic, soluble peptides. The stability of the docked peptide vaccine-TLR3 complex was validated by molecular dynamic simulations. The induction of effective cellular and humoral immune responses by the multi-peptide vaccine was verified by simulated immunization.
Discussion:
These findings provide a foundation for future HEV vaccine studies.
1 Introduction
Hepatitis E virus (HEV) causes acute viral hepatitis and is spread mainly by fecal–oral transmission (; ). It is self-limiting or asymptomatic in healthy individuals, but causes high mortality in immunocompromised patients, such as pregnant women. The case fatality rate in pregnant women is up to 30% (). There are eight genotypes of Orthohepevirus A species in the Hepeviridae family, of which four genotypes infect humans (). Genotypes 1 and 2 exclusively infect humans, whereas genotypes 3 and 4 infect not only humans, but also animals, including swine. Therefore, they are considered zoonotic pathogens and have wide host tropism (; ).
Hepatitis E virus (HEV) is a 7.2-kb positive-strand RNA virus belonging to the family Hepeviridae, and has three open reading frames (ORFs): ORF1, ORF2, and ORF3 (). ORF1 encodes a large nonstructural polyprotein responsible for HEV replication and transcription. ORF2 is a capsid protein with approximately 660 amino acid residues, and most neutralizing sites are located on its surface. Generally, there are two forms of the ORF2 protein, namely intracellular ORF2 and secreted ORF2 (; ). HEV is a quasi-enveloped hepatovirus, with the membrane supplied by the host ESCRT system. The membrane protects the virus from the neutralizing antibodies of its host (). ORF3 conducts an ion channel function with a hydrophobic sequence, which is considered a viroporin. ORF3 encodes a protein containing 112 amino acids that is presented on the surface of enveloped HEV (). The phosphorylated form of the ORF3 protein interacts with the non-glycosylated form of ORF2 (). The a motif containing amino acid proline, serine, alanine, proline (PSAP) motif of ORF3 is necessary for the release of the virions from infected cells (; ; ). Previous studies have demonstrated that ORF3 not only enhances the production of interferon (IFN), but is also involved in the downregulation of the Toll-like receptor 3 (TLR3) and TLR7 downstream signaling pathways (; ). ORF4, which was discovered in genotype 1, is responsible for the enhancement of viral replication of genotype 1 under endoplasmic reticulum (ER) stress, and this was verified by exogenous introduction of ORF4 into genotype 3 virus (; ).
Two existing hepatitis E vaccines have been evaluated in clinical trials. The Hecolin® vaccine antigen contains amino acids 368–606 of the ORF protein (pORF2) of HEV genotype 1, expressed in Escherichia coli. It can provide protection against HEV for approximately 4.5 years (; ). The recombinant HEV vaccine (rHEV) produced by GlaxoSmithKline (GSK) contains amino acids 112–607 of the ORF2 protein of HEV genotype 1, expressed in baculovirus ().
Because the virus is quasi-enveloped, an antibody targeting ORF2 will not fully detect the enveloped virus in cell culture or serum, unless the virus is treated with sufficient detergent and protease (). It has been reported that an ORF3 antibody can neutralize this enveloped virus to some extent, but not the virus in feces (). A bacterially expressed ORF3 peptide effectively reduced the viral titer, reduced the duration of viremia and fecal shedding, and even partly prevented experimental hepatitis induced with two HEV genotypes: genotype 1 and 4 (). Upon immunization with the bacterially expressed ORF3 protein of strains VaHEV from laying hens and YT-aHEV from broilers, the nucleic acid of avian HEV detected in cloacal swabs vanished within 7 days of infection. This suggests that the immunized antibodies inhibit the proliferation of the virus and provide protection against infection (). HEV ORF3 equipped with the myotropic adeno-associated virus vector (AAVMYO3) induced dose-dependent ORF3 antibodies in mice and the serum immunized by ORF3 inhibited infection by enveloped HEV in vivo by 50% compared with that of the control (). Humans infected with HEV via blood transfusion have been reported in many countries ().
In regard to the protective roles of ORF3 for enveloped HEV, we first introduce ORF3 as a candidate for multi-epitopic vaccine design.
Immunoinformatic methods have been successfully applied to multiple types of vaccines targeting different pathogens, including HPV, PEDV, Mycobacterium tuberculosis, SARS-CoV-2, and HEV (; ; ; ; ; ). Multi-epitope vaccines designed with this method will stimulate the CD4+, CD8+ T-cell response and the B-cell response.
In this study, we screened peptides from the ORF2 and ORF3 proteins that stimulated T- and B-cell responses. We also assessed various aspects of the polypeptide vaccine, including its immunogenicity, allergenicity, and physiochemical properties. This study should provide a universal vaccine targeting ORF2 and ORF3 that will eliminate both enveloped and non-enveloped HEV.
2 Materials and methods
The flowchart for the design of the multi-epitope vaccine is shown in Figure 1.
FIGURE 1
2.1 HEV protein sequences
The amino acid sequences of different HEV proteins, including 961 ORF2 sequences and 746 ORF3 sequences of genotypes 1, 3, and 4, were retrieved from the National Center of Biotechnology Information protein database.
2.2 T-cell epitope prediction, including cytotoxic T-lymphocyte (CTL) epitopes and helper T-lymphocyte (HTL) epitopes
The Immune Epitope Database and Analysis Resource (IEDB)1 was used to predict the CD8 T-cell epitopes of the ORF2 and ORF3 proteins. NetMHCPan v4.1 was the prediction method used. Human was selected as the source species. A percentile rank of < 0.5 was considered the threshold ().
Immune Epitope Database (IEDB) was also used to predict the MHC-II-binding (HTL) epitopes (15-mer) of the ORF2 and ORF3 proteins against human Human leukocyte Antigens (HLAs), such as HLA-DRB1*01:01, HLA-DRB1*03:01, HLA-DRB1*04:01, HLA-DRB1*04:05, HLA-DRB1*07:01, HLA-DRB1*08:02, HLA-DRB1*09:01, HLA-DRB1*11:01, HLA-DRB1*12:01, HLA-DRB1*13:02, and HLA-DRB1*15:01, with NN-align, SMM-align, CombLib, and Sturniolo. A percentile rank of < 2 was determined as the threshold.
2.3 B-cell epitope prediction
Three different methods were used to predict B-cell epitopes: the Emini surface accessibility scale, the antigenicity scale, and BepiPred v2.0 (; ; ). Duplicates in the epitopes predicted with the three methods were removed, and the remaining epitopes were used as candidate B-cell epitopes.
2.4 Assessment of screened epitopes for antigenicity, allergenicity, and toxicity
The antigenic potential of the T- and B-cell epitopes was predicted with VaxiJen v2.0, applying a threshold value of 0.5 (). The predicted T- and B-cell epitopes were then further evaluated in terms of their toxicity and allergenicity using the ToxinPred () and AllergenFP v2.0 () servers, respectively.
2.5 Construction of the polypeptide vaccine
Any multi-epitope vaccine constructed must be neither allergenic nor toxic. Good solubility of the vaccine when expressed at high levels must also be taken into account. Appropriate linkers, such as common rigid linker (EAAAK), fexible connecting peptide (GPGPG), The KK linker is a target sequence of the lysosomal protease histone B, which is one of the important proteases used for antigen processing in the context of MHC-II antigen presentation (KK), and AAY linkers act as cleavage sites for proteasomes in mammalian cells, contributing to the formation of natural epitopes and preventing the formation of “ligand epitopes”, thereby increasing the immunogenicity of epitope-based vaccines (AAY), were added to link the screened CTL, HTL and linear B-lymphocyte (LBL) epitopes. Human β-defensin 3 and LL37 were also added to the N-terminus of the vaccine sequence with the EAAAK linker, to increase the immunogenic capacity of the multi-epitope vaccine (; ).
2.6 Immunogenic, allergenic, and physiochemical properties of the multi-peptide vaccine
The antigenicity of the multi-epitope vaccine polypeptide was predicted with the VaxiJen v2.0 tool, with a threshold value of 0.456. The allergenicity of the vaccine was analyzed with AllerTOP v.2.0 (). The ProtParam server was used to assess the physical and chemical properties of the construct (), including the amino acid composition, molecular weight, theoretical isoelectric point (pI), grand average of hydropathicity (GRAVY), aliphatic and instability index, and in vitro and in vivo half-lives.
2.7 Vaccine structure modeling, refinement, and validation
The SOPMA server was used to predict the secondary structure of the polypeptide vaccine (). AlphaFold2 was used to model the tertiary structure of the vaccine. The structure was refined with the Galaxy server and validated with methods such as Ramachandran plots, and ProSA-web (; ; ).
2.8 Molecular docking and molecular dynamic (MD) simulation
The docking of the vaccine structure to TLR3 (PDB: 1ZIW) was performed by the HADDOCK server (; ). Molecular simulation was performed with GROMACS (version 2018.6) at 30 ns for 150,000 steps. Spc216.gro water was used as the solvent in which to simulate the proteins (). The addition of Na+ and Cl– ions with the GROMACS tool Genion was used to neutralize the overall charge (). The energy of the protein structure was minimized in 50,000 steps and the protein was equilibrated with NVT isothermal–isochoric and NPT ensembles in 50,000 steps. MD simulation at 1500,000 steps was used.
2.9 Trial immune simulation in silico
Immune simulation was performed with the C-ImmSim server, which simulates the immune response with both systems’ biology techniques and information supported by data-driven predictive methods (). The simulation was performed in 105 steps, and the default option was used for all HLA types of the host. Three different sets of injections were designed: virus alone, vaccine alone, and vaccine followed by virus. The shared sequence of the ORF2 and ORF3, respectively, was used as a substitute for the viral antigen sequence.
3 Results
3.1 T-cell and B-cell epitopes of HEV
The final screened CTL antigenic (MHC-I) epitopes, HTL (MHC-II) epitopes, and LBL epitopes in the ORF2 and ORF3 proteins of HEV are listed in Tables 1, 2. After they were checked with a series of server tools, the antigenic, nontoxic, and nonallergenic T-cell and B-cell epitopes that induce the cytokines interferon-gamma (IFN-γ), interleukin 4 (IL4), and IL10 were selected for the construction of the multi-epitope vaccine.
TABLE 1
| Protein | T-cell epitopes | Peptide | Allele | Antigenicity |
| ORF3 | MHC-I | 53AVPAVVSGV61 | HLA-A*68:02/A*02:06/A*02:03/A*02:01 | 0.5575 |
| ORF2 | MHC-I | 277RLHYRNQGW285 | HLA-A*32:01 | 2.0994 |
| ORF2 | MHC-I | 204TEASNYAQY212 | HLA-B*44:02/B*44:03 | 0.6432 |
| ORF2 | MHC-I | 203ATEASNYAQY212 | HLA-A*01:01/B*44:03/B*44:02 | 0.6685 |
| ORF2 | MHC-I | 201IMATEASNY209 | HLA-B*15:01/A*30:02 | 0.7715 |
| ORF2 | MHC-I | 318TPYTGALGL326 | HLA-B*07:02 | 0.8121 |
| ORF2 | MHC-I | 220RYRPLVPNA228 | HLA-A*30:01 | 0.7326 |
| ORF2 | MHC-I | 325GLLDFALEL333 | HLA-A*02:03 | 1.2732 |
| ORF2 | MHC-I | 214VVRATIRYR222 | HLA-A*31:01 | 1.2896 |
| ORF2 | MHC-II | 155RGAILRRQYNLSTSPL170 | HLA-DRB4*01:01 | 0.7185 |
| ORF2 | MHC-II | 217ATIRYRPLVPNAV229 | HLA-DRB1*09:01 | 1.09 |
| ORF2 | MHC-II | 323ALGLLDFALELE334 | HLA-DQA1*01:01/DQB1*05:01 | 1.6727 |
| ORF2 | MHC-II | 157AILRRQYNLSTSPLT171 | HLA-DRB1*04:01 | 0.7947 |
| ORF2 | MHC-II | 217ATIRYRPLVPNAVG230 | HLA-DRB1*09:01 | 1.1523 |
| ORF2 | MHC-II | 159LRRQYNLSTSPLTS172 | HLA-DRB1*09:01 | 0.7698 |
| ORF2 | MHC-II | 218TIRYRPLVPNAVGGY232 | HLA-DRB1*01:01 | 0.9212 |
| ORF2 | MHC-II | 212YRVVRATIRYRPL224 | HLA-DRB5*01:01/DPA1*02:01/DPB1*14:01 | 0.9773 |
Cytotoxic T-lymphocyte (CTL) epitopes and helper T-lymphocyte (HTL) epitopes in the ORF2 and ORF3 proteins selected for the polypeptide vaccine.
The core peptides of the HTL epitopes are shown in bold. HLA naming principles, genetic loci * allele. *to separate genetic loci and allele.
TABLE 2
| Protein | B-cell epitopes | Peptide | Antigenicity |
| ORF3 | B | 69PSPSPI74 | 0.983 |
| ORF2 | B | 469DYDNQHEQDRPTPSPAPSRPF489 | 0.7828 |
| ORF2 | B | 323ALGLLDFALEL333 | 1.0275 |
| ORF2 | B | 160RRQYNLS166 | 0.9911 |
| ORF2 | B | 444ENAQQD449 | 1.1613 |
| ORF2 | B | 469DYDNQHEQDRPTPSPAPSR487 | 0.9301 |
Linear B-lymphocyte (LBL) epitopes in the ORF2 and ORF3 proteins selected for the polypeptide vaccine.
3.2 Construction of the multi-epitope vaccine polypeptide
In total, nine CTL, eight HTL, and six LBL epitopic peptides were fused together with the GPGPG, KK, and AAY linkers, respectively, to create the multi-epitope vaccine construct. To boost the immunogenicity of the construct, human β-defensin 3 (GII NTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK) and LL37 ([LL-37, 37 aa]) were added as adjuvants to the amino terminus of the polypeptide, joined to the first CTL epitope with the EAAAK linker. An additional start codon was added at the start of the sequence. The primary structure of the multi-epitope subunit vaccine construct included a total of 433 amino acids. The sequence is as follows: MGIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCR RKKEAAAKLLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTE SEAAAKAVPAVVSGVGPGPGRLHYRNQGWGPGPGTEASNYA QYGPGPGATEASNYAQYGPGPGIMATEASNYGPGPGTPYTG ALGLGPGPGRYRPLVPNAGPGPGGLLDFALELGPGPGVVRATI RYRGPGPGRGAILRRQYNLSTSPLKKATIRYRPLVPNAVKKAL GLLDFALELEKKAILRRQYNLSTSPLTKKATIRYRPLVPNAVGK KLRRQYNLSTSPLTSKKTIRYRPLVPNAVGGYKKYRVVRATIRY RPLKKPSPSPIAAYDYDNQHEQDRPTPSPAPSRPFAAYALGLLD FALELAAYRRQYNLSAAYENAQQDAAYDYDNQHEQDRPTPS PAPSR.
3.3 Immunogenicity, allergenicity, and physiochemical properties of the vaccine candidate
The assessment of the immunogenic, allergenic and solubility characteristics of the construct suggested that the multi-epitope vaccine designed here was a priority (Table 3). The calculated molecular weight was 47.4 kDa and the pI 10.20, indicating the basic nature of the vaccine. The instability index, 42.80, indicated its good stability. The GRAVY value was −0.636, indicating its hydrophilic characteristics, which allows it to connect with other proteins. The aliphatic index of the peptide was 71.76, indicating the high thermostability of the vaccine. The estimated half-life was 30 h in mammalian reticulocytes in vitro, and > 20 h in yeast in vivo, and > 10 h in E. coli in vivo.
TABLE 3
| Features | Assessment |
| Number of amino acids | 433 |
| Molecular weight | 47.4 kDa |
| Isoelectric point | 10.20 |
| Instability index | 42.80 |
| Aliphatic index | 71.76 |
| Grand average of hydropathicity (GRAVY) | −0.636 |
Immunogenicity, allergenicity, and physiochemical properties of the vaccine.
3.4 Secondary structure and three-dimensional (3D) structure of multi-epitope vaccine
The secondary structure of the construct showed that the polypeptide contained 49.65% coil, 31.18% helix, 16.40% strand, and 2.77% beta turn (Figure 2). The sequence of the multi-epitope vaccine was submitted to AlphaFold2. AlphaFold2 uses the predicted local distance difference test loss (pLDDT) to directly derive the per-position confidence of predicted models (Figures 3A, B). The pLDDT score of this model was 75.45. The 3D structure was confirmed with Pro-SA with a Z-score of −4.39, indicating the good quality of the vaccine. On Ramachandran plots, the percentage of residues in the most-favored regions was 93.2%, and only 1.2% residues were in the region that was not allowed. Taken together, these parameters indicate the high quality of the multi-peptide vaccine (Figures 3C, D).
FIGURE 2
FIGURE 3
3.5 Docking the vaccine structure to TLR3 and molecular dynamic (MD) simulation
HADDOCK clustered 160 structures in 11 clusters, which represented 80% of the water-refined models generated by HADDOCK. The best structure of the top 10 clusters was selected according to its HADDOCK score of −60.97 and Z-score of −2.4 (Figure 3B). The more negative the Z-score, the more optimal the structure.
Molecular dynamic (MD) simulation of the complex formed between the polypeptide vaccine and TLR3 was performed. The stability of the docked complex was reflected in the root mean square deviation (RMSD), which had an average value 1.3 nm (Figure 4A). The root mean square fluctuation (RMSF) was between 0.2 and 2.0 nm, with a mean value 0.6 nm (Figure 4B), reflecting the good stability of the whole complex. The high-fluctuation residues (including R666, G730, G807, R931, D995, and Q1051) were distributed in the flexible loop area.
FIGURE 4
3.6 Simulated immunization with C-ImmSim
The assessment of antibody levels provides crucial insights into the efficacy of vaccines and the immune response to pathogens. The role of vaccines in influencing the immune response to infection can be clarified by examining the dynamics of CTL and HTL populations. Our results showed increased immunoglobulin M (IgM) and IgG after 20 days of stimulation with antigen, whereas increases of IgG2 were less obvious (Figure 5A). B memory (y2) and B-isotype IgM levels were elevated (Figure 5B). In general, the levels of TH memory (y2), TC, and TH cells were also increased (Figures 5C, D). The IFN-γ level peaked after 10 days of stimulation (Figure 5E).
FIGURE 5
4 Discussion
Hepatitis E virus (HEV) is a zoonotic virus that is transmitted through fecal and oral transmission. There is currently no universal vaccine available for HEV (; ). Traditional vaccines targeting ORF2 have been developed for many years (; ). Multi-epitope vaccines are an emerging area of research interest. An advantage of multi-epitope vaccines is that they reduce adverse reactions (i.e., allergy) and the antigenic load, eliciting a more specific immune response to conserved epitopes (). A combination of the dominant epitopes of different antigens is superior to a single antigen epitope at inducing an immune response (). Multi-epitope vaccines have been used to inhibit a variety of pathogens. For example, multi-epitope vaccines targeting Epstein–Barr virus (EBV) and influenza virus successfully elicit robust neutralizing antibodies and T-cell responses. The EBV polyepitope vaccine, which includes 20 CD8+ T-cell epitopes, induces high frequencies of CD4+ T cells and CD8+ T cells, which are maintained for more than 7 months (). It has been reported that the norovirus (NoV) P particle, a 24-self-assembly of the protruding domain, displays H16, M2e, and NP9 on its surface, which elicit long-lasting hemagglutinin (HA)-specific neutralizing antibodies, M2e-CD4+ and CD8+ T-cell responses, and a nucleoprotein-specific CTL response, respectively ().
The HEV exists in two states, quasi-enveloped virions, which have a surface membrane and non-enveloped naked virions. The ORF3 and ORF2 antigens are located on the surface of these two types of virions, respectively (). Considering the reduction in antibody-mediated neutralization of HEV resulting in antibody evasion by the secreted form of ORF2 () and the partly protective ORF3 presented on the surface of quasi-enveloped HEV (), we first induced ORF3 as an epitopic candidate combined with ORF2 as a multi-peptide vaccine. As previous studies have demonstrated, ORF3 can partially neutralize quasi-enveloped HEV (; ; ). The designed vaccine will therefore potentially possess efficacy against both non-enveloped and quasi-enveloped HEV.
In this study, we constructed peptide epitopic vaccines targeting HEV protein ORF2 and ORF3 through computational biology. We screened 9 CTL antigenic (MHC-I) epitopes, 8 HTL (MHC-II) epitopes, and 6 LBL epitopes that covered a wide population of up to 90.60%. On evaluation, these antigens showed good immunogenicity, low allergenicity and non-toxicity. The multi-epitope vaccine is connected through GPGPG, KK, AAY, and EAAAK connectors, and human β-defensin 3 and LL37 are used as adjuvants to enhance the immune response. As the 3D structure validated by Ramachandran plots, the percentage of residues in the most-favored regions was up to 93.2%, and only 1.2% of residues were disallowed. This is in accordance with the good quality model for Ramachandran plots, which is over 90% in the most favored regions (). Our multi-epitopic vaccine has potential efficacy and low allergenicity against HEV. The Z-score of the 3D structure docked with TLR3 was −2.4 by HADDOCK. The more negative the Z-score, the better the docked structure. This score suggests that the docked structure is of good quality. It has been reported that abundant TLR3 and IFNγ levels were helpful to inhibit HEV and promote recovery (; ), it appears likely that our design will lead to a promising result. Under simulated immunization with the peptide vaccine, both IgM and IgG levels were significantly elevated, as were the abundance of B cells, T cells, and IFN-γ. It suggests the multi-peptide vaccine will induce robust cellular and humoral immune responses effectively. These epitopes may provide a reference for the design of other ORF2 and ORF3 vaccines in the future.
The epitopes that cause excellent immune responses are mainly concentrated on ORF2 and ORF3 (; ; ; ; ; ) and the existing HEV epitopic vaccines mainly target ORF2. In these studies, the parameter settings like the selected HLA range and the server threshold settings determine the final peptide selection. The selected peptides all differ between vaccine studies but effective immunoreactions have been induced using these different strategies (; ; ). The findings of our study are novel in that ORF3 was included as an additional target along with ORF2.
5 Conclusion
Hepatitis E is a self-limiting disease, but presents a serious threat to pregnant women and immunocompromised individuals (). There is no global vaccine currently available against HEV. Using an immunoinformatic approach, we designed a polypeptide vaccine against the ORF2 and ORF3 proteins of HEV, which was capable of inducing strong T- and B-cell responses by simulated immunization. This is the first study to consider ORF3 as a multi-epitope candidate to combat HEV. Our design provides potential efficacy against both non-enveloped and quasi-enveloped HEV, however, the efficacy of this vaccine requires experimental validation.
Statements
Data availability statement
The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.
Author contributions
QL: Data curation, Formal analysis, Methodology, Software, Writing – original draft, Writing – review & editing. HW: Data curation, Methodology, Software, Writing – review & editing. JM: Formal analysis, Writing – review & editing. JWa: Formal analysis, Methodology, Software, Writing – original draft. JWu: Formal analysis, Writing – review & editing. SL: Formal analysis, Writing – review & editing. JT: Formal analysis, Writing – review & editing. JN: Project administration, Writing – review & editing. WH: Project administration, Writing – review & editing.
Funding
The authors declare that financial support was received for the research, authorship, and/or publication of this article. This research was funded by the National Key Research and Development Program of China (2023YFC2307900).
Conflict of interest
HW was employed by Wuhan Institute of Biological Products Co., Ltd. JWu was employed by Beijing Yunling Biotechnology Co., Ltd. The remaining authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Footnotes
References
1
AbrahamM. J.MurtolaT.SchulzR.PállS.SmithJ. C.HessB.et al (2015). GROMACS: High performance molecular simulations through multi-level parallelism from laptops to supercomputers.SoftwareX219–25. 10.1016/j.softx.2015.06.001
2
AhmadI.HollaR. P.JameelS. (2011). Molecular virology of hepatitis E virus.Virus Res.16147–58. 10.1016/j.virusres.2011.02.011
3
AnwarT.IsmailS.ParvaizF.AbbasiS. W.Al-AbbasiF.AlghamdiA.et al (2023). Computational design of experimentally validated multi-epitopes vaccine against hepatitis E virus: An immunological approach.PLoS One18:e0294663. 10.1371/journal.pone.0294663
4
AregaA. M.DhalA. K.PattanaikK. P.NayakS.MahapatraR. K. (2023). An immunoinformatics-based study of Mycobacterium tuberculosis region of difference-2 uncharacterized protein (Rv1987) as a potential subunit vaccine candidate for preliminary ex vivo analysis.Appl. Biochem. Biotechnol.10.1007/s12010-023-04658-9[Epub ahead of print].
5
BehmardE.SoleymaniB.NajafiA.BarzegariE. (2020). Immunoinformatic design of a COVID-19 subunit vaccine using entire structural immunogenic epitopes of SARS-CoV-2.Sci. Rep.10:20864. 10.1038/s41598-020-77547-4
6
ClosterJ. M.BjoernP.MortenN.PaoloM. (2017). BepiPred-2.0: Improving sequence-based B-cell epitope prediction using conformational epitopes.Nucleic Acids Res.45W24–W29. 10.1093/nar/gkx346
7
CoursagetP.BuissonY.DeprilN.CannP.ChabaudM.MoliniC.et al (2010). Mapping of linear B cell epitopes on open reading frames 2- and 3-encoded proteins of hepatitis E virus using synthetic peptides.FEMS Microbiol. Lett.109251–255. 10.1111/j.1574-6968.1993.tb06176.x
8
DaltonH. R.BendallR.IjazS.BanksM. (2008). Hepatitis E: An emerging infection in developed countries.Lancet Infect. Dis.8698–709. 10.1016/S1473-3099(08)70255-X
9
DasariV.McNeilL. K.BeckettK.SolomonM.AmbalathingalG.ThuyT. L.et al (2023). Lymph node targeted multi-epitope subunit vaccine promotes effective immunity to EBV in HLA-expressing mice.Nat. Commun.14:4371. 10.1038/s41467-023-39770-1
10
DawsonG.ChauK.CabalC.YarboughP.ReyesG.MushahwarI. (1992). Solid-phase enzyme-linked immunosorbent assay for hepatitis E virus IgG and IgM antibodies utilizing recombinant antigens and synthetic peptides.J. Virol. Methods38175–186. 10.1016/0166-0934(92)90180-l
11
DimitrovI.BangovI.FlowerD. R.DoytchinovaI. (2014). AllerTOP v.2–a server for in silico prediction of allergens.J. Mol. Model.20:2278. 10.1007/s00894-014-2278-5
12
DingQ.HellerB.CapuccinoJ. M.SongB.NimgaonkarI.HrebikovaG.et al (2017). Hepatitis E virus ORF3 is a functional ion channel required for release of infectious particles.Proc. Natl. Acad. Sci. U.S.A.1141147–1152. 10.1073/pnas.1614955114
13
DoytchinovaI.FlowerD. (2007). VaxiJen: A server for prediction of protective antigens, tumour antigens and subunit vaccines.BMC Bioinformatics8:4. 10.1186/1471-2105-8-4
14
EminiE. A.HughesJ. V.PerlowD. S.BogerJ. (1985). Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide.J. Virol.55836–839. 10.1128/JVI.55.3.836-839.1985
15
FavorovM. O.FieldsH. A.PurdyM. A.YashinaT. L.MargolisH. S. (2010). Serologic identification of hepatitis E virus infections in epidemic and endemic settings.J. Med. Virol.36246–250.
16
FengZ.Hirai-YukiA.McKnightK. L.LemonS. M. (2014). Naked viruses that aren’t always naked: Quasi-enveloped agents of acute hepatitis.Annu. Rev. Virol.1539–560. 10.1146/annurev-virology-031413-085359
17
GeourjonC.DeléageG. (1995). SOPMA: Significant improvements in protein secondary structure prediction by consensus prediction from multiple alignments.Comput. Appl. Biosci.11681–684. 10.1093/bioinformatics/11.6.681
18
GuptaS.KapoorP.ChaudharyK.GautamA.KumarR.RaghavaG. P. (2013). In silico approach for predicting toxicity of peptides and proteins.PLoS One8:e73957. 10.1371/journal.pone.0073957
19
HeM.WangM.HuangY.PengW.ZhengZ.XiaN.et al (2016). The ORF3 protein of genotype 1 hepatitis E virus suppresses TLR3-induced NF-κB signaling via TRADD and RIP1.Sci. Rep.6:27597. 10.1038/srep27597
20
HonoratoR. V.KoukosP. I.Jiménez-GarcíaB.TsaregorodtsevA.VerlatoM.GiachettiA.et al (2021). Structural biology in the clouds: The WeNMR-EOSC ecosystem.Front. Mol. Biosci.8:729513. 10.3389/fmolb.2021.729513
21
HooftR. W.SanderC.VriendG. (1997). Objectively judging the quality of a protein structure from a Ramachandran plot.Comput. Appl. Biosci.13425–430. 10.1093/bioinformatics/13.4.425
22
HouW.WuH.WangS.WangW.WangB.WangH. (2023). Designing a multi-epitope vaccine to control porcine epidemic diarrhea virus infection using immunoinformatics approaches.Front. Microbiol.14:1264612. 10.3389/fmicb.2023.1264612
23
IkramA.AlzahraniB.ZaheerT.SattarS.RasheedS.AurangzebM.et al (2023). An in silico deep learning approach to multi-epitope vaccine design: A hepatitis e virus case study.Vaccines (Basel)11:710. 10.3390/vaccines11030710
24
IvanD.LyudmilaN.IriniD.IvanB. (2014). AllergenFP: Allergenicity prediction by descriptor fingerprints.Bioinformatics6846–851. 10.1093/bioinformatics/btt619
25
JunsuK.HahnbeomP.LimH.ChaokS. (2012). GalaxyWEB server for protein structure prediction and refinement.Nucleic Acids Res.40:W294.
26
KhudyakovY. E.KhudyakovaN. S.FieldsH. A.JueD.StarlingC.FavorovM. O.et al (1993). Epitope mapping in proteins of hepatitis E virus.Virology19489–96.
27
KolaskarA. S.TongaonkarP. C. (1990). A semi-empirical method for prediction of antigenic determinants on protein antigens.FEBS Lett.276172–174.
28
LandeR.PietraforteI.MennellaA.PalazzoR.FrascaL. (2021). Complementary effects of carbamylated and citrullinated LL37 in autoimmunity and inflammation in systemic lupus erythematosus.Int. J. Mol. Sci.22:1650. 10.3390/ijms22041650
29
LeiQ.LiL.ZhangS.LiT.ZhangX.DingX.et al (2018). HEV ORF3 downregulates TLR7 to inhibit the generation of type I interferon via impairment of multiple signaling pathways.Sci. Rep.8:8585. 10.1038/s41598-018-26975-4
30
LiS. W.ZhaoQ.WuT.ChenS.ZhangJ.XiaN. S. (2015). The development of a recombinant hepatitis E vaccine HEV 239.Hum. Vaccin. Immunother.11908–914. 10.1080/21645515.2015.1008870
31
LiY.QuC.YuP.OuX.PanQ.WangW. (2019). The interplay between host innate immunity and hepatitis E virus.Viruses11:541.
32
MaH.SongX.HarrisonT. J.LiR.HuangG.ZhangH.et al (2009). Immunogenicity and efficacy of a bacterially expressed HEV ORF3 peptide, assessed by experimental infection of primates.Arch. Virol.1541641–1648. 10.1007/s00705-009-0496-4
33
MajidM.AndleebS. (2019). Designing a multi-epitopic vaccine against the enterotoxigenic Bacteroides fragilis based on immunoinformatics approach.Sci. Rep.9:19780. 10.1038/s41598-019-55613-w
34
MajumdarM.RathoR. K.ChawlaY.SinghM. P. (2015). Role of TLR gene expression and cytokine profiling in the immunopathogenesis of viral hepatitis E.J. Clin. Virol.738–13. 10.1016/j.jcv.2015.09.011
35
MarionO.LhommeS.NayracM.DuboisM.PucelleM.RequenaM.et al (2020). Hepatitis E virus replication in human intestinal cells.Gut69901–910. 10.1136/gutjnl-2019-319004
36
MaurerL.El AndariJ.RaptiK.SpreyerL.SteinmannE.GrimmD.et al (2022). Induction of hepatitis E virus anti-ORF3 antibodies from systemic administration of a muscle-specific adeno-associated virus (AAV) vector.Viruses14:266. 10.3390/v14020266
37
MontpellierC.WychowskiC.SayedI. M.MeunierJ. C.SaliouJ. M.AnkavayM.et al (2018). Hepatitis E virus lifecycle and identification of 3 forms of the ORF2 capsid protein.Gastroenterology154:211-223.e218. 10.1053/j.gastro.2017.09.020
38
NagashimaS.TakahashiM.KobayashiT.NishizawaT.NishiyamaT.OkamotoH.et al (2017). Characterization of the quasi-enveloped hepatitis E virus particles released by the cellular exosomal pathway.J. Virol.91:e00822-17. 10.1128/JVI.00822-17
39
NairV. P.AnangS.SubramaniC.MadhviA.BakshiK.SrivastavaA.et al (2016). Endoplasmic reticulum stress induced synthesis of a novel viral factor mediates efficient replication of genotype-1 hepatitis E virus.PLoS Pathog.12:e1005521. 10.1371/journal.ppat.1005521
40
NanY.ZhangY. J. (2016). Molecular biology and infection of hepatitis E virus.Front. Microbiol.7:1419. 10.3389/fmicb.2016.01419
41
NicolasR.OleL.MassimoB.FilippoC.VladimirB. (2010). Computational immunology meets bioinformatics: The use of prediction tools for molecular binding in the simulation of the immune system.PLoS One5:e9862. 10.1371/journal.pone.0009862
42
NieJ.WangQ.JinS.YaoX.XuL.ChangY.et al (2023). Self-assembled multiepitope nanovaccine based on NoV P particles induces effective and lasting protection against H3N2 influenza virus.Nano Res.167337–7346. 10.1007/s12274-023-5395-6
43
OliA. N.ObialorW. O.IfeanyichukwuM. O.OdimegwuD. C.OkoyehJ. N.EmechebeG. O.et al (2020). Immunoinformatics and vaccine development: An overview.Immunotargets Ther.913–30.
44
QiY.ZhangF.ZhangL.HarrisonT. J.HuangW.ZhaoC.et al (2015). Hepatitis E virus produced from cell culture has a lipid envelope.PLoS One10:e0132503. 10.1371/journal.pone.0132503
45
QianZ.CongC.LiY.BiY.HeQ.LiT.et al (2023). Quantification of host proteomic responses to genotype 4 hepatitis E virus replication facilitated by pregnancy serum.Virol. J.20:111. 10.1186/s12985-023-02080-5
46
ReynissonB.BarraC.KaabinejadianS.HildebrandW. H.PetersB.NielsenM. (2020). Improved prediction of MHC II antigen presentation through integration and motif deconvolution of mass spectrometry MHC eluted ligand data.J. Proteome Res.192304–2315. 10.1021/acs.jproteome.9b00874
47
RiddellM. A.LiF.AndersonD. A. (2000). Identification of immunodominant and conformational epitopes in the capsid protein of hepatitis e virus by using monoclonal antibodies.J. Virol.74:8011. 10.1128/jvi.74.17.8011-8017.2000
48
SamadA.AhammadF.NainZ.AlamR.ImonR. R.HasanM.et al (2022). Designing a multi-epitope vaccine against SARS-CoV-2: An immunoinformatics approach.J. Biomol. Struct. Dyn.4014–30. 10.1080/07391102.2020.1792347
49
SamaviaN.FahedP.YasirW.TasneemA.SyedaN. (2022). Prediction of promiscuous epitopes in ORF2 of hepatitis E virus: An in-silico approach.Afr. Health Sci.22626–639. 10.4314/ahs.v22i3.67
50
SmithD. B.SimmondsP.et alMembers, Of The, International Committee, On The (2014). Consensus proposals for classification of the family Hepeviridae.J. Gen. Virol.952223–2232.
51
SongtaninB.MolehinA. J.BrittanK.ManatsathitW.NugentK. (2023). Hepatitis E virus infections: Epidemiology, genetic diversity, and clinical considerations.Viruses15:1389.
52
SrivastavaR.AggarwalR.JameelS.PuriP.NaikS. (2007). Cellular immune responses in acute hepatitis E virus infection to the viral open reading frame 2 protein.Viral Immunol.2056–65. 10.1089/vim.2006.0053
53
SyedS. F.SunY.DuT.ChenY.LiuB.WangX.et al (2017). Evaluation of recombinant Chinese avian hepatitis E virus (CaHEV) ORF2 and ORF3 proteins for protection of chickens against CaHEV infection.Vaccine353482–3489. 10.1016/j.vaccine.2017.05.030
54
TakahashiM.TanakaT.TakahashiH.HoshinoY.NagashimaS.Jirintaiet al (2010). Hepatitis E Virus (HEV) strains in serum samples can replicate efficiently in cultured cells despite the coexistence of HEV antibodies: Characterization of HEV virions in blood circulation.J. Clin. Microbiol.481112–1125. 10.1128/jcm.02002-09
55
TakahashiM.YamadaK.HoshinoY.TakahashiH.IchiyamaK.TanakaT.et al (2008). Monoclonal antibodies raised against the ORF3 protein of hepatitis E virus (HEV) can capture HEV particles in culture supernatant and serum but not those in feces.Arch. Virol.1531703–1713. 10.1007/s00705-008-0179-6
56
TîrziuA.AvramS.MadăL.Crişan-VidaM.PopoviciC.PopoviciD.et al (2023). Design of a synthetic long peptide vaccine targeting HPV-16 and -18 using immunoinformatic methods.Pharmaceutics15:1798. 10.3390/pharmaceutics15071798
57
TyagiS.KorkayaH.ZafrullahM.JameelS.LalS. K. (2002). The phosphorylated form of the ORF3 protein of hepatitis E virus interacts with its non-glycosylated form of the major capsid protein, ORF2.J. Biol. Chem.27722759–22767. 10.1074/jbc.M200185200
58
van ZundertG.RodriguesJ.TrelletM.SchmitzC.KastritisP.KaracaE.et al (2016). The HADDOCK2.2 web server: User-friendly integrative modeling of biomolecular complexes.J. Mol. Biol.428720–725. 10.1016/j.jmb.2015.09.014
59
WangW.XiaM.ChenJ.DengF.YuanR.ZhangX.et al (2016). Data set for phylogenetic tree and RAMPAGE Ramachandran plot analysis of SODs in Gossypium raimondii and G. arboreum.Data Brief9345–348. 10.1016/j.dib.2016.05.025
60
WiedersteinM.SipplM. J. (2007). ProSA-web: Interactive web service for the recognition of errors in three-dimensional structures of proteins.Nucleic Acids Res.35W407–W410. 10.1093/nar/gkm290
61
YadavK. K.BoleyP. A.FrittsZ.KenneyS. P. (2021). Ectopic expression of genotype 1 hepatitis E virus ORF4 increases genotype 3 HEV viral replication in cell culture.Viruses13:75. 10.3390/v13010075
62
YamadaK.TakahashiM.HoshinoY.TakahashiH.IchiyamaK.NagashimaS.et al (2009). ORF3 protein of hepatitis E virus is essential for virion release from infected cells.J. Gen. Virol.901880–1891. 10.1099/vir.0.010561-0
63
YinX.YingD.LhommeS.TangZ.WalkerC. M.XiaN.et al (2018). Origin, antigenicity, and function of a secreted form of ORF2 in hepatitis E virus infection.Proc. Natl. Acad. Sci. U.S.A.1154773–4778. 10.1073/pnas.1721345115
64
ZhangZ. J.ZhangZ. X.HuangH. S.WuT.HuH. Y.WangW. Z.et al (2015). Long-term efficacy of a hepatitis E vaccine.N. Engl. J. Med.372914–922.
65
ZhuF.-C.ZhangJ.ZhangX.-F.ZhouC.WangZ.-Z.HuangS.-J.et al (2010). Efficacy and safety of a recombinant hepatitis E vaccine in healthy adults: A large-scale, randomised, double-blind placebo-controlled, phase 3 trial.Lancet376895–902. 10.1016/S0140-6736(10)61030-6
Summary
Keywords
multi-epitope, vaccine, HEV, ORF2, ORF3
Citation
Lu Q, Wu H, Meng J, Wang J, Wu J, Liu S, Tong J, Nie J and Huang W (2024) Multi-epitope vaccine design for hepatitis E virus based on protein ORF2 and ORF3. Front. Microbiol. 15:1372069. doi: 10.3389/fmicb.2024.1372069
Received
17 January 2024
Accepted
07 March 2024
Published
21 March 2024
Volume
15 - 2024
Edited by
Alexandro Guterres, Oswaldo Cruz Foundation (Fiocruz), Brazil
Reviewed by
Kush Kumar Yadav, The Ohio State University, United States
Zoya Shafat, Institute of Management Technology-Dubai, United Arab Emirates
Updates
Copyright
© 2024 Lu, Wu, Meng, Wang, Wu, Liu, Tong, Nie and Huang.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Jianhui Nie, niejianhui@nifdc.org.cnWeijin Huang, huangweijin@nifdc.org.cn
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.