Abstract
Repeated exposure to psychostimulants such as methamphetamine (METH) induces neuronal adaptations in the mesocorticolimbic dopamine system, including the ventral tegmental area (VTA). These changes lead to persistently enhanced neuronal activity causing increased dopamine release and addictive phenotypes. A factor contributing to increased dopaminergic activity in this system appears to be reduced GABAB receptor-mediated neuronal inhibition in the VTA. Dephosphorylation of serine 783 (Ser783) of the GABAB2 subunit by protein phosphatase 2A (PP2A) appears to trigger the downregulation GABAB receptors in psychostimulant-addicted rodents. Therefore, preventing the interaction of GABAB receptors with PP2A using an interfering peptide is a promising strategy to restore GABAB receptor-mediated neuronal inhibition. We have previously developed an interfering peptide (PP2A-Pep) that inhibits the GABAB receptors/PP2A interaction and thereby restores receptor expression under pathological conditions. Here, we tested the hypothesis that restoration of GABAB receptor expression in the VTA of METH addicted mice reduce addictive phenotypes. We found that the expression of GABAB receptors was significantly reduced in the VTA and nucleus accumbens but not in the hippocampus and somatosensory cortex of METH-addicted mice. Infusion of PP2A-Pep into the VTA of METH-addicted mice restored GABAB receptor expression in the VTA and inhibited METH-induced locomotor sensitization as assessed in the open field test. Moreover, administration of PP2A-Pep into the VTA also reduced drug seeking behavior in the conditioned place preference test. These observations underscore the importance of VTA GABAB receptors in controlling addictive phenotypes. Furthermore, this study illustrates the value of interfering peptides targeting diseases-related protein-protein interactions as an alternative approach for a potential development of selective therapeutic interventions.
Introduction
Drug addiction is a complex chronic disease with biological, behavioral, and social components. Psychostimulants such as cocaine, amphetamine, and methamphetamine (METH) are highly addictive drugs, whose abuse can lead to serious health problems and significant healthcare costs (; ). For instance, in 2018, 2.3 million employees receiving employer-sponsored insurance in the USA (representing 1.4% of the total population of employees receiving employer-sponsored insurance in the USA) were diagnosed with substance use disorders with total annual medical cost of $35.3 billion (). Currently, there is no effective pharmacological therapy available to cure patients from addiction.
Addiction to psychostimulants results from repeated and prolonged actions of the drug on the brain inducing long-lasting plastic neuronal adaptations (; ). The effects of psychostimulants are mediated via enhanced dopamine release in the mesocorticolimbic dopamine pathway. The mesocorticolimbic circuit is involved in many cognitive processes including reward, motivation, learning, and fear (; ). A key structure triggering addictive behavior is the ventral tegmental area (VTA) located in the midbrain. Acute effects of psychostimulants, such as feelings of euphoria, pleasure, and reward, are mediated via increased activity of VTA dopamine neurons projecting to the nucleus accumbens, amygdala, and medial prefrontal cortex (). Repeated and chronic consumption of psychostimulants induces plastic neuronal adaptations resulting in permanently increased dopamine release in the mesocorticolimbic dopamine pathway.
One important factor controlling neuronal excitability and neurotransmitter release is the GABAB receptor, which is expressed in most neurons at axon terminals, dendritic and somatic sites (). GABAB receptors are heterodimeric assemblies composed of GABAB1 and GABAB2 subunits and mediate their effects by activating Gi/o proteins (; ; ). Their most prominent actions in the brain are the activation of G protein-coupled inwardly rectifying potassium channels (GIRK or Kir3) at postsynaptic locations to reduce neuronal excitability (; ) and the inhibition of voltage-gated Ca2+ channels at presynaptic sites to reduce transmitter release (; ; ).
GABAB receptors are well expressed in the mesocorticolimbic dopamine system, where they control neuronal activity and the release of GABA, glutamate and dopamine (). Accordingly, pharmacological activation of GABAB receptors by the selective agonist baclofen reduced several addictive behaviors in preclinical studies such as the development and expression of psychostimulant-induced motor sensitization (, ; ), drug seeking (), drug self-administration (; ; ) and drug-induced cognitive impairment (; ). Early clinical studies reported some positive effects of baclofen in reducing psychostimulant consumption and drug craving (; ; ). There are clinical evidences for the benefit of baclofen for the treatment of alcohol use disorders (), but its use is controversial (; ). Currently, baclofen is approved for the treatment of alcohol addiction in France (; ). One problem of baclofen at high dosage are numerous side effects such as sedation, dizziness, fatigue, insomnia, headache, paresthesia, tinnitus, and restlessness (). The wide range of adverse side effects might reflect the fact that systemic application of baclofen activates all GABAB receptors in the body and not only in the neuronal pathways related to the addicted state. This might generally restrict the broad clinical application of baclofen and need for more specific interventions.
There is considerable evidence that GABAB receptor-mediated inhibition is reduced in brain structures of the mesocorticolimbic system after psychostimulant treatment, diminishing inhibitory control and enhancing neuronal excitability (; ; ; ; ). This has been attributed to downregulation of either GABAB receptors and GIRK channels or both (; ; ; ; ). Aberrant downregulation of GABAB receptors is a response to sustained activity of glutamate receptors, which dysregulates GABAB receptor trafficking from the constitutive recycling pathway to lysosomal degradation (; ; ). Key steps in this aberrant regulation are the phosphorylation of Ser867 in the GABAB1 subunit mediated by Ca2+-calmodulin dependent protein kinase IIβ (CaMKIIβ) (; ) and dephosphorylation of Ser783 in GABAB2 by protein phosphatase 2A (PP2A) (; ). Downregulation of cell surface and total GABAB receptors in the nucleus accumbens after repeated cocaine administration involved the activation of CaMKII (), whereas selective loss of cell surface receptors was observed in the mPFC and VTA after cocaine and methamphetamine exposure, respectively, due to PP2A-mediated dephosphorylation of Ser783 in GABAB2 (; ).
Recently, we developed an interfering peptide (PP2A-Pep) that inhibits the interaction of GABAB receptors with PP2A (). This peptide restored downregulated GABAB receptor expression after an ischemic insult, normalized neuronal overexcitation and inhibited progressive neuronal death. Since GABAB receptor expression and function appears to be reduced in the VTA after METH application, we tested in the present study the hypothesis whether restoring GABAB receptor expression in the VTA of METH-addicted mice, by blocking the interaction of GABAB receptors with PP2A, would reduce phenotypes associated with addiction. For this we infused PP2A-Pep into the VTA of METH-addicted mice and tested for GABAB receptor expression using immunohistochemistry, locomotor sensitization in the open field test (OFT) and drug seeking behavior in the conditioned place preference test (CPP).
Materials and methods
Animals
Experiments were performed using 8–10 weeks old adult male and female C57BL/6 mice. Mice were either purchased from Envigo (Netherlands) or bred at the Laboratory Animal Service Center of the University of Zurich (Switzerland). The mice were group-housed up to five in filter-top cages with a standard 12/12-h light/dark cycle and food and water available ad libitum. All experiments were approved by the veterinary office of the Canton of Zurich (license ZH164/2020).
Interfering peptide (PP2A-Pep)
The interfering peptide (PP2A-Pep, YTIWMPENPRPGTP CDIFTNSRGKRASNGGGGRRRRRRRRRFQFTQNQKKEDSKTS TSV) used in this study inhibits the interaction of PP2A with GABAB receptors (). It contains a sequence derived from the intracellularly located C-terminal domain of GABAB2 (red characters) and was rendered cell permeable by tagging it at the N-terminus with a peptide sequence derived from the Rabies virus glycoprotein followed by 9 arginine residues (gray characters). An inactive control peptide (Ctrl-Pep) contained the same amino acids but in a random sequence (except for the cell penetrating peptide sequence, YTIWMPENPRPGTPCDIFTNSRGKRASNGGGGRRRRRRRRRQ KFSVNTFQEKDTKSQTS). The peptides were additionally tagged with biotin to permit their detection by immunohistochemical staining using AlexaFluor 488-conjugated streptavidin. The peptides were custom-synthesized by Pepmic Co., Ltd., Suzhou, China.
Cannulation and peptide administration
Cannula implantations were conducted using a stereotaxic frame (David Kopf Instruments and NeuroStar) under general anesthesia using continuous isoflurane inhalation via a nose mask (induction: 5% at 1 l/min, surgery: 1.5% in a mixture of O2 and air at 0.4–0.6 l/min). The body temperature of the mice was kept at 36.5 ± 0.5°C using a feed-back controlled heating mat with a rectal temperature probe. Eyes were protected from drying using vitamin A ointment. For analgesia, mice received a subcutaneous injection of buprenorphine (0.1 mg/kg) 20–30 min before surgery and an additional subcutaneous injection of lidocaine (2 mg/kg)/bupivacaine (1 mg/kg) at the site of incision about 5 min before surgery. Before exposing the skull, the incision site was cleaned with 70% ethanol. A unilateral cannula implantation was performed using a 26G guide cannula (#C315GS-5/SPC, Bilaney Consultants, Germany). A hole was drilled through the skull above the VTA (anterior-posterior −3.3; medial-lateral −0.9, relative to bregma). The guide cannula was placed through the hole above the VTA with a 10° angle (dorsal-ventral −4.25). The cannula was held in place using dental cement. All mice received post-surgical analgesia for additional 2 days (10 mg/kg carprofen, s. c. twice per day).
Peptides (0.8 μl PP2A-Pep, 100 μg/ml or 0.8 μl Ctrl-Pep, 100 μg/ml) were administered into the VTA with a rate of 100 nl/min using an automatic pump (PHD ULTRA Nanomite, Harvard Apparatus) connected by PE tubing which was attached to an injection cannula (#C315DCS-4/SPC, Bilaney Consultants, Germany) with 0.25 mm projection from the tip of the guiding cannula. Following injections, the cannula was left in place for additional 5 min to allow peptide infusion.
Behavioral tests
Seven days prior to any experiment, the mice were habituated to the experimenter by gentle handling in the housing facility. At least 1 h prior to the experiment, mice were transferred to the experimental room (50 lux dim light). All tests were performed in the light cycle. The respective experimental apparatus was cleaned with 70% ethanol before testing a mouse to avoid any sensory stimulation related to the previous mouse tested. In this study we used non-contingent drug administration as it ensures the expression of robust addictive phenotypes.
Open field test (OFT)
The OFT was used to test for METH-induced locomotor sensitization (; ). The locomotor activity was monitored in the open-field test chamber (32 cm × 32 cm × 23 cm) with an infrared detection system under dim light conditions (50 lux). Mice were transferred from the housing facility to the experimental room 1 h prior to the experiment. All mice received i.p. injection (saline or METH) and immediately placed into the open field chamber (32 cm × 32 cm × 23 cm), where their activity was recorded for 30 min. Then the mice were returned to their home cages.
To induce methamphetamine (METH) addiction, mice were injected alternatively with either saline or methamphetamine (METH, 2 mg/kg, i. p., dissolved in saline) on every other day for 10 days (METH injections on day 1, 3, 5, 7 and 9; saline injections on day 2, 4, 6, 8, 10). Even a single METH injection has been shown to induce robust and long-lasting locomotor sensitization (). We verified the development of locomotor sensitization in a subgroup of mice by daily open field tests. The control group received solely saline injections for 10 days. One day after the last saline injection (day 11), mice were microinfused with the peptides dissolved in saline (0.8 μl PP2A-Pep, 100 μg/ml or 0.8 μl Ctrl-Pep, 100 μg/ml) via the implanted cannula and then placed back to their home cage. The next day (day 12), the mice were injected with a challenging dose of METH (1 mg/kg, i. p., dissolved in saline) and immediately placed into the open-field test chamber to allow free exploration for 30 min. The mice were monitored by a digital camera placed above the center of the arena. From each session, 10 min of the recordings were extracted for analysis with the EthoVision XT 15 software (Noldus, Wageningen, Netherlands).
Conditioned place preference (CPP)
CCP was used to test drug seeking behavior (). CPP was conducted in a two-compartment plexiglass apparatus (size of each compartment: 20 cm × 20 cm × 15 cm), in which the two conditioning compartments were connected through a short tunnel (10 cm) (Figure 5). The two conditioning chambers were visually and tactile distinct. Chamber 1 consisted of white walls with black strips and a plain white floor with gray cross lines. Chamber 2 consisted of black walls and a rough textured plexiglass floor. The behavior of the mice was recorded by a digital camera placed above the CCP device.
The CPP procedure consisted of three phases (Figure 5): habituation and baseline preference (day 1), conditioning phase (days 2–6) and preference tests (days 7 and day 8). In the habituation/preference evaluation (day 1), mice were placed in the tunnel connecting the two chambers and allowed to freely explore all compartments for 30 min. This allowed to assign a preferred compartment for each mouse to conduct a biased CPP experiment: the mice received saline injections in their initially preferred chamber (saline-paired chamber) and METH injections in the non-preferred compartment (METH-paired chamber).
During the conditioning phase (day 2–6), access was restricted to the saline-paired or METH-paired compartment. In the METH group, mice were injected with METH (2 mg/kg, i.p., dissolved in saline) and immediately placed into the METH-paired chamber for 30 min and then returned to the home cage. Six hours later, the mice were injected with saline and placed into the saline-paired chamber for 30 min. For the control saline group, the same procedure was conducted but mice were injected with two saline doses.
On the test day (day 7), the preference test was performed 24 h after the last conditioning trial by placing the mouse in the tunnel connecting the two compartments and allowing to freely explore all chambers for 10 min. One hour after the test, mice were microinfused with the peptides dissolved in saline via the implanted cannula (0.8 μl PP2A-Pep, 100 μg/ml or 0.8 μl Ctrl-Pep, 100 μg/ml) and then placed back into their home cage. The timeline for peptide treatment was selected according to , which predominantly affects memory reconsolidation.
On day 8, the preference test was conducted again for 10 min to test for the peptide effect. The recordings were analyzed with the EthoVision XT 15 software (Noldus, Wageningen, Netherlands) to extract the CPP data. The CPP preference score was calculated as a difference between the relative amount of time spent in the saline-paired chamber to the time spent in the METH-paired chamber.
Antibodies
Primary antibodies: rabbit anti-GABAB2N [1:250, custom-made by GeneScript, ()], rabbit anti-GFAP (1:500, Agilent Technologies # Z0334), guinea pig anti-NeuN (1:500, Synaptic systems # 266004), rabbit anti-Iba1 (1:500, WAKO Chemicals # 019-19741).
Secondary antibodies: donkey anti-rabbit AlexaFluor Plus 555 (1:2000, Thermo Fisher Scientific # A32794), goat anti-guinea pig AlexaFluor 647 (1:1000, Jackson ImmunoResearch # 706-605-148), and AlexaFluor 488-conjugated streptavidin (1:500, Jackson ImmunoResearch # 016-540-084).
Tissue preparation and immunohistochemistry
A loss of GABAB receptor immunofluorescence staining under ischemic conditions always correlated with a similar reduction of receptor protein signals in western blots and with diminished GABAB receptor mediated inhibition (see e.g., ; , ; ; ). Therefore, we assume that a reduction in GABAB receptor immunofluorescence staining in this study indicates diminished GABAB receptor mediated inhibition.
Immediately after the last behavioral test, mice were transcranially perfused with ice-cold oxygenated ACSF (125 mM NaCl, 2.5 mM KCl, 1.25 mM NaH2PO4, 25 mM NaHCO3, 1 mM MgCl2, 2 mM CaCl2, and 25 mM glucose, pH 7.4, pH 7.4), for 2 min. Brains were then immediately dissected and cut in the medial midline. One of the hemispheres were then fixed in 4% PFA overnight, followed by incubation in 30% sucrose/PBS for 24 h at 4°C for immunohistochemical staining.
For immunohistochemistry, free floating 40 μm thick coronal sections were prepared using a sliding microtome (HM400; Microm) and stored in antifreeze solution (50 mM Na-phosphate buffer, pH 7.4, 1.6 M Glucose, 20 mM ethylene glycol, 6 mM sodium azide) at −20°C for further analysis. After rinsing once in PBS, sections were incubated overnight at 4°C with primary antibody (or AlexaFluor 488-conjugated streptavidin for peptide detection) prepared in Tris-Triton solution [50 mM Tris pH 7.4, 150 mM NaCl containing 0.2% Triton X-100 and 5% normal donkey serum (NDS)]. After 3 washes for 10 min with Tris-Triton without NDS, sections were incubated with secondary antibody diluted in Tris-Triton containing 2% NDS for 1 h at room temperature. Following 3 washes for 10 min with Tris-Triton without NDS, brains were mounted onto glass slides (SuperFrost Plus, Thermo Fisher Scientific), dried and coversliped with DAKO fluorescence mounting medium supplemented with DAPI (Fluoroshield with DAPI, #F6057, Merk).
Images were acquired using a LSM 800 confocal microscope (Carl Zeiss). For imaging of the brain areas, a stacks of 10 optical sections at 1 μm z-spacing were taken using a plan-apochromat 10x/0.45 objective in sequential mode with a resolution of 1,024 × 1,024 pixels. The laser intensity and the detector gain were adjusted to values that avoid signal saturation and all images of one experiment was imaged with the same settings in one continuous session. For images on the cellular level, 5 optical sections with 0.7 μm z-spacing were taken using a 40x/1.4 plan-apochromat oil differential interference contrast objective with 0.5x digital zoom.
For quantification of GABAB receptor expression, all images belonging to an experiment were recorded with identical settings. Analysis was performed after merging the optical planes into a single image and an area of interest was defined. The mean fluorescence values were determined using ImageJ ().
The original images recorded were too dim to be shown directly. Therefore, we enhanced the brightness of the images to make the staining more easily visible to the reader.
Statistical analysis
The data is shown as means ± SD. Immunohistochemical data was analyzed by two-way analysis of variance with type III sum of square calculations for an unbalanced data design (ANOVA, Figures 2, 3) using GraphPad Prism 8.4.3, followed by Tukey’s multiple comparison test as indicated in the respective figure legends. Behavioral experiments were analyzed by two-way AVOVA with type III sum of square calculations for an unbalanced data design (Figures 4, 5D) and two-tailed unpaired t-test (Figure 5C). All data sets passed tests for normal distribution and homoscedasticity. Differences were considered statistically significant when p < 0.05.
Results
Neuron-specific uptake of PP2A-Pep
For testing the effect of PP2A-Pep on METH-addicted mice, the peptide was unilaterally infused into the VTA via an implanted canula (Figure 1A). Unilateral infusion had been shown to cover both sides of the VTA (). To largely restrict uptake of PP2A-Pep (as well as the control peptide Ctrl-Pep) into neurons, it contained at the N-terminus a cell-penetrating peptide sequence derived from the Rabies virus glycoprotein (). We previously showed that peptides containing this sequence are selectively taken up by neurons via a receptor-mediated mechanism (). PP2A-Pep was indeed taken up by neurons after infusion into the VTA as shown by co-immunofluorescence staining for the peptide, neurons (NeuN antibody) and nuclei (DAPI) (Figures 1B, C). The peptide was not taken up by glia cells as shown by co-staining for astrocytes with GFAP antibodies (Figure 1B) and microglia by co-staining with Iba1 antibodies (Figure 1C).
FIGURE 1
GABAB receptor expression was reduced in the VTA of METH-addicted mice but normalized after PP2A-Pep infusion
First, we analyzed whether GABAB receptor expression in the VTA was reduced in METH-addicted mice. For this, we performed immunofluorescence staining for GABAB receptors and the inactive control peptide (Ctrl-Pep) infused into the VTA of saline-injected control mice and METH-addicted mice. The area of the VTA containing neurons that displayed staining for the peptide was then analyzed for GABAB receptor expression using antibodies directed against the GABAB2 subunit. As expected, we detected a considerable reduction of GABAB receptor expression in the VTA in METH-addicted mice (Figure 2A). We then tested whether inhibiting the interaction of GABAB receptors with PP2A would restore GABAB receptor expression. Indeed, infusion of PP2A-Pep into the VTA of METH-addicted mice normalized GABAB receptor expression as tested about 24 h after peptide application (Figure 2A). Infusion of PP2A-Pep into the VTA of non-addicted control mice had no effect on the expression of GABAB receptors.
FIGURE 2

Infusion of PP2A-Pep into the VTA of METH-addicted mice normalized GABAB receptor expression. Mice received multiple METH/saline (METH-addicted mice) or saline/saline (control mice) injections and were then either infused into the VTA with PP2A-Pep or the inactive Ctrl-Pep. About 24 h after peptide application the mice were analyzed for GABAB receptor expression using GABAB2 antibodies in the VTA (A), nucleus accumbens (B), hippocampus (C), and motor cortex (D) on a regional level. (A) GABAB receptor expression was reduced in the VTA of METH-addicted mice and restored after infusion of PP2A-Pep. Left: Representative images display peptide uptake (green) and GABAB receptor expression (red) in the VTA (scale bar: 100 μm). Right: Quantification of fluorescence intensities in the area stained for the peptide (the data was normalized to the mean immunofluorescence value of Ctrl-Pep infused into the VTA of saline treated control mice). The data represents the mean ± SD of 9–10 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05). (B) GABAB expression was reduced in the nucleus accumbens of METH-addicted mice but unaffected by PP2A-Pep infusion into the VTA. Left: Representative images (upper row: low magnification images, scale bar 200 μm; lower row, high magnification images, scale bar 20 μm). Right: Quantification of fluorescence intensities (the data was normalized to the mean immunofluorescence value of control mice). The data represents the mean ± SD of 8–10 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05). (C) GABAB expression remained unaffected in the hippocampus of METH-addicted mice. Left: Representative images (upper row: low magnification images, scale bar 100 μm; lower row, high magnification images, scale bar 20 μm). Right: Quantification of fluorescence intensities (the data was normalized to the mean immunofluorescence value of control mice). The data represents the mean ± SD of 5–7 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05). (D) GABAB expression in the motor cortex remained unaffected in METH-addicted mice. Left: Representative images (upper row: low magnification images, scale bar 200 μm; lower row, high magnification images, scale bar 20 μm). Right: Quantification of fluorescence intensities (the data was normalized to the mean immunofluorescence of control mice). The data represents the mean ± SD of 7–8 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05).
One of the main projection areas of the VTA involved in addictive phenotypes is the nucleus accumbens. Like the VTA, GABAB receptor expression was significantly reduced in the nucleus accumbens but remained unaffected by infusion of PP2A-Pep into the VTA (Figure 2B). By contrast, GABAB receptor expression in the hippocampus (Figure 2C) and motor cortex (Figure 2D) was not significantly affected in METH-addicted mice.
Next, we analyzed GABAB receptor expression in the VTA on the cellular level. For this, we quantified immunofluorescence intensities for GABAB2 in the somata of peptide positive VTA neurons. As observed on the more global, VTA wide level, GABAB receptor expression in the soma of individual VTA neurons was downregulated in METH-addicted mice (Figure 3). Infusion of PP2A-Pep into the VTA normalized GABAB receptor expression in the somata of neurons in METH-addicted mice (Figure 3).
FIGURE 3

PP2A-Pep normalized GABAB receptor expression in the somata of VTA neurons of METH-addicted mice. METH-addicted and control mice were infused into the VTA either with PP2A-Pep or the inactive Ctrl-Pep. About 24 h after peptide application, the mice were analyzed for GABAB receptor expression in the soma of individual neurons that had taken up the peptide using GABAB2 antibodies. Left: Representative images displaying peptide uptake (green) and GABAB receptor expression (orange) in VTA neurons (scale bar: 20 μm). Right: Quantification of fluorescence intensities (the data was normalized to the mean immunofluorescence value of Ctrl-Pep infused into the VTA of saline treated control mice). The data represents the mean ± SD of 15 neurons per mouse derived from 6–8 mice per condition. The symbols in the graph display the mean values of all neurons analyzed in a single mouse. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05).
Taken together, these results indicate that GABAB receptors were downregulated in the VTA and nucleus accumbens of METH-addicted mice. Infusion of PP2A-Pep into the VTA restored receptor expression to normal levels in the VTA but did not affect receptor expression in the nucleus accumbens.
PP2A-Pep infusion into the VTA reduced METH-induced locomotor sensitization
Locomotor sensitization is a hallmark of psychostimulant-induced addiction (
FIGURE 4

PP2A-Pep infusion into the VTA reduced METH-induced locomotor sensitization in the OFT. (A) Schematic outline of the OFT procedure. Mice received alternating METH and saline injections for 10 days to induce METH addiction. The control group received solely saline injections. One day after the last saline injection (day 11), the interfering peptide (PP2A-Pep) or the control peptide (Ctrl-Pep) was infused into the VTA via the implanted cannula. The next day, the mice were injected with a challenge dose of METH (1 mg/kg, i. p.) and immediately placed into the open-field test chamber to allow free exploration for 30 min. (B) METH-addicted mice exhibited increased locomotor activity, which was reduced to normal levels after PP2A-Pep injection into the VTA. Application of the control peptide (Ctrl-Pep) had no effect. The data represents the mean ± SD of 7–11 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05). (C) Heat maps depicting the frequencies of locations visited by mice in the open field arena under the different experimental conditions (representative images).
PP2A-Pep infusion into the VTA of METH-addicted mice reduced drug seeking behavior
The effect of PP2A-Pep on drug seeking behavior of METH-addicted mice was evaluated in the CPP test (
FIGURE 5

Injection of PP2A-Pep into the VTA of METH-addicted mice reduced drug seeking behavior as tested by CPP. (A,B) Schematic outline of the CPP procedure (A) and the CCP device (B). CPP was conducted in a device consisting of two visually distinct plexiglass compartments connected through a short gray tunnel. The CPP procedure included three phases: habituation and baseline preference (day 1), conditioning phase (days 2–6) and preference tests (days 7 and day 8). During the conditioning phase (day 2–6), mice received METH injections (2 mg/kg, i. p.) in the initially non-preferred compartment and access was restricted to this compartment. After 6 h, mice were injected with saline in their initially preferred compartment. The control group received the same procedure, but mice were injected with two saline doses. On the test day (day 7, 24 h after the last conditioning trial), the preference test was performed. One hour after the test, mice were microinfused either with PP2A-Pep or Ctrl-Pep via the implanted cannula and tested a second time the next day (day 8). (C) METH-conditioned mice showed increased preference for the METH-paired chamber on the first test day. The data represents the mean ± SD of 18–20 mice per condition. Statistical analysis: Two-tailed unpaired t-test. (D) Infusion of PP2A-Pep into the VTA after the first test diminished the preference for the METH-paired chamber in METH-addicted mice on the second test day. Application of the control peptide (Ctrl-Pep) had no effect. The data represents the mean ± SD of 8–10 mice per condition. Statistical analysis: Two-way ANOVA with Tukey’s multiple comparison test (ns, p > 0.05). (E) Heat maps depicting the frequencies of locations visited in the CPP chambers by mice under the different experimental conditions (representative images).
Discussion
This study indicates that repeated METH treatment in mice downregulates GABAB receptor expression in the VTA. Infusion of an interfering peptide that inhibits the interaction of GABAB receptors with PP2A into the VTA of METH-treated mice restored the expression of GABAB receptors. This diminished METH-induced locomotor sensitization and drug seeking behavior.
Excessive neuronal excitation triggers the downregulation of GABAB receptors by increasing their lysosomal degradation on the expense of recycling the receptors back to the plasma membrane (
In the present study we found that in most neurons of the VTA analyzed, GABAB receptors were downregulated after repetitive METH treatment in mice. Likewise, we found a similar reduction of GABAB receptors in the nucleus accumbent, a main projection area of the VTA neurons associated with drug addiction. This finding is well supported by a recent study indicating reduced GABAB receptor expression in the nucleus accumbens of cocaine-addicted rats involving CaMKII dependent phosphorylation of the receptors (
In all our previous studies, a loss of GABAB receptor immunofluorescence staining always correlated with a similar reduction of receptor protein signals in western blots and with diminished GABAB receptor mediated inhibition (see e.g.,
Repeated psychostimulant administration in rodents leads to locomotor sensitization, a phenotype that is triggered by enhanced dopamine release within the VTA and nucleus accumbens. Re-exposure to even a small quantity of the psychostimulants in the addicted subject, induces a strong activity in the VTA (
It is believed that drug addiction is a form of Pavlovian conditioning, establishing long-term memories to stabilize drug associated behaviors. In the CPP experiment, associations are formed between a rewarding stimulus (e.g., METH) and a contextual environment (
However, our CPP protocol cannot rule out the possibility that the interfering peptide might additionally facilitate memory extinction, a process which is tightly associated with psychostimulant withdrawal (
We expect that PP2A-Pep is associated with negligible adverse side effects because it selectively inhibits the interaction of GABAB receptors with PP2A and does not appreciably affect GABAB receptor expression in healthy control mice. Therefore, side effects observed after global activation the receptors with the agonist baclofen such as sedation, dizziness, fatigue, insomnia, headache, paresthesia, tinnitus, and restlessness (
In conclusion, restoring GABAB receptor expression in VTA neurons of METH-addicted mice by inhibiting PP2A-mediated downregulation of the receptors inhibited locomotor sensitization and drug seeking behavior. This finding indicates that interfering with disease-relevant protein-protein interactions might be a promising alternative approach toward the development of a selective and efficient therapeutic intervention.
Statements
Data availability statement
The datasets analyzed for this study have been deposited at ZENODO.org and are publicly available (doi: 10.5281/zenodo.10554456). Due to their large size, raw images and behavioral recordings can be made available upon reasonable request to the corresponding author.
Ethics statement
The animal study was approved by the Veterinary office of the Canton of Zurich, Waltersbachstrasse 5, CH-8006 Zurich (license ZH164/2020). The study was conducted in accordance with the local legislation and institutional requirements.
Author contributions
MH: Conceptualization, Data curation, Formal Analysis, Writing – original draft, Writing – review & editing, Investigation, Methodology. DB: Conceptualization, Data curation, Formal Analysis, Writing – original draft, Writing – review & editing, Funding acquisition, Project administration, Resources, Supervision.
Funding
The authors declare financial support was received for the research, authorship, and/or publication of this article. This research was funded by the Swiss National Science Foundation, grant number 31003A_182325 to DB.
Acknowledgments
We thank Thomas Grampp for excellent technical assistance.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
References
1
AgabioR.SaulleR.RösnerS.MinozziS. (2023). Baclofen for alcohol use disorder.Cochr. Datab. Syst. Rev.1:Cd012557. 10.1002/14651858.CD012557.pub3
2
AraiS.TakumaK.MizoguchiH.IbiD.NagaiT.KameiH.et al (2009). GABAB receptor agonist baclofen improves methamphetamine-induced cognitive deficit in mice.Eur. J. Pharmacol.602101–104. 10.1016/j.ejphar.2008.10.065
3
AroraD.HearingM.HalukD. M.MirkovicK.Fajardo-SerranoA.WessendorfM. W.et al (2011). Acute cocaine exposure weakens GABAB receptor-dependent G-protein-gated inwardly rectifying K+ signaling in dopamine neurons of the ventral tegmental area.J. Neurosci.3112251–12257. 10.1523/JNEUROSCI.0494-11.2011
4
BaikJ. H. (2020). Stress and the dopaminergic reward system.Exp. Mol. Med.521879–1890. 10.1038/s12276-020-00532-4
5
BalakrishnanK.HleihilM.BhatM. A.GanleyR. P.VaasM.KlohsJ.et al (2023). Targeting the interaction of GABAB receptors with CaMKII with an interfering peptide restores receptor expression after cerebral ischemia and inhibits progressive neuronal death in mouse brain cells and slices.Brain Pathol.33:e13099. 10.1111/bpa.13099
6
BardoM. T.BevinsR. A. (2000). Conditioned place preference: What does it add to our preclinical understanding of drug reward?Psychopharmacology15331–43. 10.1007/s002130000569
7
BartolettiM.GubelliniC.RicciF.GaiardiM. (2004). The GABAB agonist baclofen blocks the expression of sensitisation to the locomotor stimulant effect of amphetamine.Behav. Pharmacol.15397–401. 10.1097/00008877-200409000-00014
8
BartolettiM.GubelliniC.RicciF.GaiardiM. (2005). Baclofen blocks the development of sensitization to the locomotor stimulant effect of amphetamine.Behav. Pharmacol.16553–558. 10.1097/01.fbp.0000179279.98029.e9
9
BellfyL.KwapisJ. L. (2020). Molecular mechanisms of reconsolidation-dependent memory updating.Int. J. Mol. Sci.216580. 10.3390/ijms21186580
10
BenkeD.MichelC.MohlerH. (2002). Structure of GABAB receptors in rat retina.J. Recept. Signal Transduc.22253–266.
11
BhatM. A.EsmaeiliA.NeumannE.BalakrishnanK.BenkeD. (2022). Targeting the interaction of GABAB receptors with CHOP after an ischemic insult restores receptor expression and inhibits progressive neuronal death.Front. Pharmacol.13:870861. 10.3389/fphar.2022.870861
12
BhatM. A.GramppT.BenkeD. (2023). ERK1/2-dependent phosphorylation of GABAB1(S867/T872), controlled by CaMKIIβ, is required for GABAB receptor degradation under physiological and pathological conditions.Int. J. Mol. Sci.2413436. 10.3390/ijms241713436
13
BrebnerK.AhnS.PhillipsA. G. (2005). Attenuation of d-amphetamine self-administration by baclofen in the rat: Behavioral and neurochemical correlates.Psychopharmacology177409–417. 10.1007/s00213-004-1968-6
14
CedilloL. N.MirandaF. (2013). Effects of co-administration of the GABAB receptor agonist baclofen and a positive allosteric modulator of the GABAB receptor, CGP7930, on the development and expression of amphetamine-induced locomotor sensitization in rats.Pharmacol Rep651132–1143. 10.1016/s1734-1140(13)71471-3
15
CedilloL. N.Ruiz-GarciaR. I.JimenezJ. C.MirandaF. (2019). Effect of coadministration of the GABAB agonist baclofen and the 5-HT2C agonist Ro60-0175 on the expression of amphetamine-induced locomotor sensitization.Exp. Brain. Res.2371691–1697. 10.1007/s00221-019-05540-z
16
ChalifouxJ. R.CarterA. G. (2011). GABAB receptor modulation of synaptic function.Curr. Opin. Neurobiol.21339–344. 10.1016/j.conb.2011.02.004
17
ChenG.van den PolA. N. (1998). Presynaptic GABAB autoreceptor modulation of P/Q-type calcium channels and GABA release in rat suprachiasmatic nucleus neurons.J. Neurosci.181913–1922.
18
CheronJ.Kerchove d’ExaerdeA. (2021). Drug addiction: From bench to bedside.Transl. Psychiatry11424. 10.1038/s41398-021-01542-0
19
CunninghamC. L.GremelC. M.GroblewskiP. A. (2006). Drug-induced conditioned place preference and aversion in mice.Nat. Protoc.11662–1670. 10.1038/nprot.2006.279
20
de BeaurepaireR.SinclairJ. M. A.HeydtmannM.AddoloratoG.AubinH. J.BerahaE. M.et al (2018). The use of baclofen as a treatment for alcohol use disorder: A clinical practice perspective.Front. Psychiatry9:708. 10.3389/fpsyt.2018.00708
21
EdwardsN. J.TejedaH. A.PignatelliM.ZhangS.McDevittR. A.WuJ.et al (2017). Circuit specificity in the inhibitory architecture of the VTA regulates cocaine-induced behavior.Nat. Neurosci.20438–448. 10.1038/nn.4482
22
FischerK. D.KnackstedtL. A.RosenbergP. A. (2021). Glutamate homeostasis and dopamine signaling: Implications for psychostimulant addiction behavior.Neurochem Int144104896. 10.1016/j.neuint.2020.104896
23
GähwilerB. H.BrownD. A. (1985). GABAB-receptor-activated K+ current in voltage-clamped CA3 pyramidal cells in hippocampal cultures.Proc. Natl. Acad. Sci. USA821558–1562. 10.1073/pnas.82.5.1558
24
GarbuttJ. C. (2020). Approval of baclofen for alcohol use disorders in France: A perspective from the United States.Alcohol Alcohol5548. 10.1093/alcalc/agz084
25
GoodR. L.RadcliffeR. A. (2011). Methamphetamine-induced locomotor changes are dependent on age, dose and genotype.Pharmacol. Biochem. Behav.98101–111. 10.1016/j.pbb.2010.12.004
26
GuetgN.AzizS. A.HolbroN.TurecekR.RoseT.SeddikR.et al (2010). NMDA receptor-dependent GABAB receptor internalization via CaMKII phosphorylation of serine 867 in GABAB1.Proc. Natl. Acad. Sci. USA10713924–13929.
27
HaradaM.PascoliV.HiverA.FlakowskiJ.LüscherC. (2021). Corticostriatal activity driving compulsive reward seeking.Biol. Psychiatry90808–818. 10.1016/j.biopsych.2021.08.018
28
HearingM.KoteckiL.Marron Fernandez de VelascoE.Fajardo-SerranoA.ChungH. J.LujanR.et al (2013). Repeated cocaine weakens GABA-Girk signaling in layer 5/6 pyramidal neurons in the prelimbic cortex.Neuron80159–170. 10.1016/j.neuron.2013.07.019
29
HeinzerlingK. G.ShoptawS.PeckJ. A.YangX.LiuJ.RollJ.et al (2006). Randomized, placebo-controlled trial of baclofen and gabapentin for the treatment of methamphetamine dependence.Drug Alcohol. Depend.85177–184. 10.1016/j.drugalcdep.2006.03.019
30
HleihilM.BalakrishnanK.BenkeD. (2022). Protein phosphatase 2A regulation of GABAB receptors normalizes ischemia-induced aberrant receptor trafficking and provides neuroprotection.Front. Mol. Neurosci.15:1015906. 10.3389/fnmol.2022.1015906
31
HleihilM.VaasM.BhatM. A.BalakrishnanK.BenkeD. (2021). Sustained baclofen-induced activation of GABAB receptors after cerebral ischemia restores receptor expression and function and limits progressing loss of neurons.Front. Mol. Neurosci.14:726133. 10.3389/fnmol.2021.726133
32
JingL.ZhangM.LiJ. X.HuangP.LiuQ.LiY. L.et al (2014). Comparison of single versus repeated methamphetamine injection induced behavioral sensitization in mice.Neurosci. Lett.560103–106. 10.1016/j.neulet.2013.12.024
33
JonesK. A.BorowskyB.TammJ. A.CraigD. A.DurkinM. M.DaiM.et al (1998). GABAB receptor function as a heteromeric assembly of the subunits GABABR1 and GABABR2.Nature396674–679.
34
KaupmannK.MalitschekB.SchulerV.HeidJ.FroestlW.BeckP.et al (1998). GABAB receptor subtypes assemble into functional heteromeric complexes.Nature396683–687.
35
KumarP.WuH.McBrideJ. L.JungK. E.KimM. H.DavidsonB. L.et al (2007). Transvascular delivery of small interfering RNA to the central nervous system.Nature44839–43. 10.1038/nature05901
36
LaliveA. L.LüscherC. (2016). “GABAB receptor functions in the mesolimbic dopamine system,” in GABAB Receptor, ed.ColomboG. (Cham: Springer International Publishing), 129–154.
37
LeggioL.LittenR. Z. (2021). The GABAB receptor agonist baclofen helps patients with alcohol use disorder: Why these findings matter.Neuropsychopharmacology462228–2229. 10.1038/s41386-021-01142-y
38
Leite-MorrisK. A.FukudomeE. Y.ShoebM. H.KaplanG. B. (2004). GABAB receptor activation in the ventral tegmental area inhibits the acquisition and expression of opiate-induced motor sensitization.J. Pharmacol. Exp. Ther.308667–678. 10.1124/jpet.103.058412
39
LiJ. Y.YuY. J.SuC. L.ShenY. Q.ChangC. H.GeanP. W. (2023). Modulation of methamphetamine memory reconsolidation by neural projection from basolateral amygdala to nucleus accumbens.Neuropsychopharmacology48478–488. 10.1038/s41386-022-01417-y
40
LiM.PetersonC.XuL.MikoszC. A.LuoF. (2023). Medical costs of substance use disorders in the US employer-sponsored insurance population.JAMA Netw Open6e2252378. 10.1001/jamanetworkopen.2022.52378
41
LiS. M.YinL. L.RenY. H.PanL. S.ZhengJ. W. (2001). GABAB receptor agonist baclofen attenuates the development and expression of d-methamphetamine-induced place preference in rats.Life Sci.70349–356. 10.1016/s0024-3205(01)01397-2
42
LingW.ShoptawS.MajewskaD. (1998). Baclofen as a cocaine anti-craving medication: A preliminary clinical study.Neuropsychopharmacology18403–404. 10.1016/s0893-133x(97)00128-0
43
LiuJ. F.TianJ.LiJ. X. (2019). Modulating reconsolidation and extinction to regulate drug reward memory.Eur. J. Neurosci.502503–2512. 10.1111/ejn.14072
44
LuM. F.FuQ.QiuT. Y.YangJ. H.PengQ. H.HuZ. Z. (2023). The CaMKII-dependent phosphorylation of GABAB receptors in the nucleus accumbens was involved in cocaine-induced behavioral sensitization in rats.CNS Neurosci. Ther.291345–1356. 10.1111/cns.14107
45
LuscherC.JanL. Y.StoffelM.MalenkaR. C.NicollR. A. (1997). G protein-coupled inwardly rectifying K+ channels (GIRKs) mediate postsynaptic but not presynaptic transmitter actions in hippocampal neurons.Neuron19687–695.
46
MaS.ZhongH.LiuX.WangL. (2023). Spatial distribution of neurons expressing single, double, and triple molecular characteristics of glutamatergic, dopaminergic, or GABAergic neurons in the mouse ventral tegmental area.J. Mol. Neurosci.73345–362. 10.1007/s12031-023-02121-2
47
MaierP. J.MarinI.GramppT.SommerA.BenkeD. (2010). Sustained glutamate receptor activation down-regulates GABAB receptors by shifting the balance from recycling to lysosomal degradation.J. Biol. Chem.28535606–35614. 10.1074/jbc.M110.142406
48
MayA. C.AupperleR. L.StewartJ. L. (2020). Dark times: The role of negative reinforcement in methamphetamine addiction.Front. Psychiatry11:114. 10.3389/fpsyt.2020.00114
49
McKendrickG.GrazianeN. M. (2020). Drug-induced conditioned place preference and Its practical use in substance use disorder research.Front. Behav. Neurosci.14:582147. 10.3389/fnbeh.2020.582147
50
MintzI. M.BeanB. P. (1993). GABAB receptor inhibition of P-type Ca2+ channels in central neurons.Neuron10889–898.
51
MizoguchiH.YamadaK. (2011). Pharmacologic treatment with GABAB receptor agonist of methamphetamine-induced cognitive impairment in mice.Curr. Neuropharmacol.9109–112. 10.2174/157015911795016976
52
MunozM. B.PadgettC. L.RifkinR.TerunumaM.WickmanK.ContetC.et al (2016). A role for the GIRK3 subunit in methamphetamine-induced attenuation of GABAB receptor-activated GIRK currents in VTA dopamine neurons.J. Neurosci.363106–3114. 10.1523/jneurosci.1327-15.2016
53
MyersK. M.CarlezonW. A.Jr. (2010). Extinction of drug- and withdrawal-paired cues in animal models: Relevance to the treatment of addiction.Neurosci. Biobehav. Rev.35285–302. 10.1016/j.neubiorev.2010.01.011
54
Nair-RobertsR. G.Chatelain-BadieS. D.BensonE.White-CooperH.BolamJ. P.UnglessM. A. (2008). Stereological estimates of dopaminergic, GABAergic and glutamatergic neurons in the ventral tegmental area, substantia nigra and retrorubral field in the rat.Neuroscience1521024–1031. 10.1016/j.neuroscience.2008.01.046
55
NestlerE. J. (2005). The neurobiology of cocaine addiction.Sci. Pract. Perspect.34–10. 10.1151/spp05314
56
OstroumovA.DaniJ. A. (2018). Inhibitory plasticity of mesocorticolimbic circuits in addiction and mental illness.Trends Neurosci.41898–910. 10.1016/j.tins.2018.07.014
57
PadgettC. L.LaliveA. L.TanK. R.TerunumaM.MunozM. B.PangalosM. N.et al (2012). Methamphetamine-evoked depression of GABAB receptor signaling in GABA neurons of the VTA.Neuron73978–989. 10.1016/j.neuron.2011.12.031
58
PaxinosG.FranklinK. B. J. (2001). The mouse brain in steriotaxic coordinates.San Diego, CA: Academic Press.
59
RanaldiR.PoeggelK. (2002). Baclofen decreases methamphetamine self-administration in rats.Neuroreport131107–1110. 10.1097/00001756-200207020-00007
60
RobertsD. C.BrebnerK. (2000). GABA modulation of cocaine self-administration.Ann. N Y Acad. Sci.909145–158. 10.1111/j.1749-6632.2000.tb06680.x
61
RollandB.SimonN.FranchittoN. (2018). Safety challenges of using high dose baclofen for alcohol use disorder: A focused review.Front. Psychiatry9:367. 10.3389/fpsyt.2018.00367
62
RollandB.SimonN.FranchittoN.AubinH. J. (2020). France grants an approval to baclofen for alcohol dependence.Alcohol Alcohol.5544–45. 10.1093/alcalc/agz082
63
SantosA. E.CarvalhoC. M.MacedoT. A.CarvalhoA. P. (1995). Regulation of intracellular [Ca2+] and GABA release by presynaptic GABAB receptors in rat cerebrocortical synaptosomes.Neurochem. Int.27397–406.
64
SchindelinJ.Arganda-CarrerasI.FriseE.KaynigV.LongairM.PietzschT.et al (2012). Fiji: An open-source platform for biological-image analysis.Nat. Methods9676–682. 10.1038/nmeth.2019
65
SharpeA. L.VarelaE.BettingerL.BecksteadM. J. (2015). Methamphetamine self-administration in mice decreases GIRK channel-mediated currents in midbrain dopamine neurons.Int. J. Neuropsychopharmacol.181–10. 10.1093/ijnp/pyu073
66
ShoptawS.YangX.Rotheram-FullerE. J.HsiehY. C.KintaudiP. C.CharuvastraV. C.et al (2003). Randomized placebo-controlled trial of baclofen for cocaine dependence: Preliminary effects for individuals with chronic patterns of cocaine use.J. Clin. Psychiatry641440–1448. 10.4088/jcp.v64n1207
67
SteketeeJ. D.KalivasP. W. (2011). Drug wanting: Behavioral sensitization and relapse to drug-seeking behavior.Pharmacol. Rev.63348–365. 10.1124/pr.109.001933
68
TerunumaM.VargasK. J.WilkinsM. E.RamirezO. A.Jaureguiberry-BravoM.PangalosM. N.et al (2010). Prolonged activation of NMDA receptors promotes dephosphorylation and alters postendocytic sorting of GABAB receptors.Proc. Natl. Acad. Sci. USA10713918–13923.
69
TirelliE.LaviolaG.AdrianiW. (2003). Ontogenesis of behavioral sensitization and conditioned place preference induced by psychostimulants in laboratory rodents.Neurosci. Biobehav. Rev.27163–178. 10.1016/s0149-7634(03)00018-6
70
TronsonN. C.TaylorJ. R. (2007). Molecular mechanisms of memory reconsolidation.Nat. Rev. Neurosci.8262–275. 10.1038/nrn2090
71
TzschentkeT. M. (2007). Measuring reward with the conditioned place preference (CPP) paradigm: Update of the last decade.Addict. Biol.12227–462. 10.1111/j.1369-1600.2007.00070.x
72
VolmanS. F.LammelS.MargolisE. B.KimY.RichardJ. M.RoitmanM. F.et al (2013). New insights into the specificity and plasticity of reward and aversion encoding in the mesolimbic system.J. Neurosci.3317569–17576. 10.1523/jneurosci.3250-13.2013
73
WhiteJ. H.WiseA.MainM. J.GreenA.FraserN. J.DisneyG. H.et al (1998). Heterodimerization is required for the formation of functional GABAB receptors.Nature396679–682.
74
ZemouraK.BalakrishnanK.GramppT.BenkeD. (2019). Ca2+/Calmodulin-dependent protein kinase II (CaMKII) b-dependent phosphorylation of GABAB1 triggers lysosomal degradation of GABAB Receptors via mind bomb-2 (MIB2)-mediated Lys-63-linked ubiquitination.Mol. Neurobiol.561293–1309. 10.1007/s12035-018-1142-5
Summary
Keywords
addiction, GABA receptor, interfering peptide, methamphetamine, protein phosphatase 2A, ventral tegmental area (VTA)
Citation
Hleihil M and Benke D (2024) Restoring GABAB receptor expression in the ventral tegmental area of methamphetamine addicted mice inhibits locomotor sensitization and drug seeking behavior. Front. Mol. Neurosci. 17:1347228. doi: 10.3389/fnmol.2024.1347228
Received
30 November 2023
Accepted
15 January 2024
Published
07 February 2024
Volume
17 - 2024
Edited by
Detlev Boison, The State University of New Jersey, United States
Reviewed by
Yasmine Nonose, New York Stem Cell Foundation, United States
Justyna Zmorzynska, International Institute of Molecular and Cell Biology in Warsaw (IIMCB), Poland
Updates

Check for updates
Copyright
© 2024 Hleihil and Benke.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Dietmar Benke, benke@pharma.uzh.ch
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.