Abstract
Introduction:
Several fluorescent proteins (FPs) and chromoproteins (CPs) are present in anthozoans and play possible roles in photoprotection. Coral tissues in massive corals often display discoloration accompanied by inflammation. Incidences of the pink pigmentation response (PPR) in massive Porites, described as inflammatory pink lesions of different shapes and sizes, has recently increased worldwide. FPs are reported to be present in PPR lesions, wherein a red fluorescent protein (RFP) appears to play a role in reducing reactive oxygen species. However, to date, the biochemical characterization and possible roles of the pigments involved are poorly understood. The present study aimed to identify and characterize the proteins responsible for pink discoloration in massive Porites colonies displaying PPRs, as well as to assess the differential distribution of pigments and the antioxidant properties of pigmented areas.
Method:
CPs were extracted from PPR lesions using gel-filtration chromatography and identified via genetic analysis using liquid chromatography-tandem mass spectrometry. The coexistence of CPs and RFP in coral tissues was assessed using microscopic observation. Photosynthetic antivity and hydrogen peroxide-scavenging activitiy were measured to assess coral stress conditions.
Results:
The present study revealed that the same CP (plut2.m8.16902.m1) isolated from massive Porites was present in both the pink spot and patch morphologies of the PPR. CPs were also found to coexist with RFP in coral tissues that manifested a PPR, with a differential distribution (coenosarc or tip of polyps’ tentacles). High hydrogen peroxide-scavenging rates were found in tissues affected by PPR.
Discussion and Conclusion:
The coexistence of CPs and RFP suggests their possible differential role in coral immunity. CPs, which are specifically expressed in PPR lesions, may serve as an antioxidant in the affected coral tissue. Overall, this study provides new knowledge to our understanding of the role of CPs in coral immunity.
1 Introduction
Global climate change and anthropogenic disturbances have led to an increased incidence of coral diseases and bleaching during the last 3 decades, particularly in corals inhabiting tropical regions in the Caribbean and Indo-Pacific Ocean (; ; Weil et al., 2012; 2016; ; ). In the last decade, heat-susceptible genotypes may have declined and/or adapted to such conditions; therefore, the remaining coral populations could have a higher thermal threshold for bleaching (Sully et al., 2019). Despite the increasing risk of climate change affecting coral health, studies have revealed that corals can improve their resilience through certain innate physiological mechanisms that involve chaperones and antioxidative enzymes, particularly heat shock proteins (Hsp70, Hsp60, and Hsp32) (; ; ; ; ; ; Thummasan et al., 2021).
Massive Porites spp. are reef-building corals commonly found in reefs of the Indo-Pacific region, including the Ryukyu Islands in southern Japan (Veron, 1992; ). The health compromised coral tissues in massive corals such as Porites spp. often display non-normal pigmentation and develop some discoloration, such as pink, purple, and blue, that potentially represent an inflammation-like response (). Among these, the pink pigmentation response (PPR) in massive Porites spp. colonies, a generalized inflammatory response characterized by the formation of pink lesions of different shapes and sizes, has been reported to increase in the Ryukyu Islands (), with chronic seasonal variations (Yucharoen, 2016). In general, PPRs in corals develop swollen areas with pink discoloration, described as “pink lines” (; ; ; ; ; ), “pink spots” (Willis et al., 2004; ; Thinesh et al., 2011; ; ), and “pink pigmentation” (; ).
Discoloration in PPRs is a phenomenon frequently observed in Porites spp. corals, but there are some reports regarding similar pigmentation phenomenon in other genera, such as Acropora (; ) and Montipora (; ; found that corals manifesting pink spots were infected by the trematode Podocotyloides stenometra. However later in the literature; ; Yucharoen 2016, found that the pink spots and other pink swollen lesions observed in massive corals, may not always be the result of tissue inflammation caused by the trematodes, but also injuries caused by other organisms penetrating the coral tissues, bites of fishes and the response to environmental stressors like high sea-surface temperature, strong illumination, low salinity, and desiccation. Therefore, the PPR is linked with an immune response of corals to those stresses mainly promoting the formation of reactive oxygen species (ROS) and the coral innate immune response through the production of antioxidant enzymes and FP (fluorescent proteins) (; ; ). and reported the presence of a red fluorescent protein (RFP) that plays an important role in photoprotection and the reduction of ROS. reported that RFP expression in pink-pigmented lesions of Porites lobata is an innate immune response. Moreover, green fluorescent proteins (GFPs) in scleractinian corals play an important role in the removal of ROS ().
To date, several FPs and chromoproteins (CPs) have been reported in anthozoans with possible roles in photoprotection (; ; Verkhusha and Lukyanov 2004; ). The CPs present in anthozoans are highly homologous to FPs, such as GFPs. FPs and FP-like CPs are classified into four groups: cyan, green, and red that are fluorescent, and nonfluorescent CPs (). Apart from the normal green-brown color of anthozoans from their symbiotic algae, CPs are also responsible for the nonfluorescent coloration (; Wiedenmann et al., 2000). Since the discovery of GFPs in the crystal jelly, Aequorea victoria, CPs and FPs have been extensively studied. revealed for the first time that several CPs are present in some scleractinian coral genomes. Similarly, Shinzato et al. (2012) reported the presence of fluorescent and nonfluorescent CPs in a whole-genome analysis of Acropora corals. In recent years, it has become clear that diverse FPs are present with complex expression in corals of the genus Acropora (; ). However, it is not clear what condition will promote the expression of these proteins in Porites spp. corals. Therefore, this study aimed to identify and characterize the CPs expressed in the discolored tissues of massive Porites spp. colonies manifesting PPRs, by extracting and purifying their proteins and further identifying the genes involved in their expression. In addition, microscopic observations of coral tissues under normal and ultraviolet light were conducted to clarify differences in the localization of CPs and RFP.
2 Materials and methods
2.1 Coral sampling
Colonies of massive Porites spp. were sampled from a coral reef at Sesoko Beach in Sesoko Island, Okinawa, Japan (26°39ʹN 127°51ʹE), at low tide (depth 0.5–1 m) on 18 September 2018 (sampling permit No. 30–55, granted by the Okinawa Prefectural Government) (Figure 1). For protein analysis, a hammer and chisel were used to collect coral pieces from three colonies of Porites spp., two displaying PPRs as pink spots (Ps) and pink patches (Pp), and one healthy colony (H) (Figure 2). For microscopic observation, the coral pieces displaying Pp and the healthy-appearing colony were used. Sampled fragments of each colony (10–20 cm2) were kept in sterilized tagged bags with surrounding seawater and transported to the laboratory at the Tropical Biosphere Research Centre (University of The Ryukyus, Okinawa, Japan) at Sesoko Island. Samples were maintained in an aquarium for 24 h with natural running seawater, temperature fluctuating between 26.5°C and 27.5°C, and attenuated natural illumination with a maximum of 200 μmol photons cm−2 s−1 to avoid the formation of ROS until treatment.
FIGURE 1
FIGURE 2
2.2 Extraction and concentration of chromoproteins
Tissue solutions were obtained from the pink-pigmented area of the colonies displaying Ps and Pp, as well as from H as a control. Coral tissues of 0.8–1.6 cm2 (Ps), 3–5 cm2 (Pp), and 4 cm2 of H were removed from the skeleton with a Waterpik dental flosser (DENTREX; Ricoh Elemex, Aichi, Japan) () using 3.5% NaCl solution and 10 mM sodium phosphate buffer (pH 7.5). Crude tissue solutions were homogenized using a glass homogenizer and filtered through Whatman glass microfiber filters (Grade GF/F, pore size 0.7 µm; GE Healthcare Life Sciences, Buckinghamshire, United Kingdom) to remove the endosymbiotic algae Symbiodiniaceae cells and coral tissue debris. The soluble fractions were centrifuged at 3,000 × g using Amicon Ultra centrifugal filters (Merck KGaA, Darmstadt, Germany) to concentrate molecules with masses greater than 10,000 Da to retain proteins. Concentrated extracts were transferred to microtubes using Pasteur pipettes. The Amicon meshes were then washed three times with 200 µL of 10 mM sodium phosphate buffer (pH 7.5) for complete recovery of the samples. The final volume of the extract was approximately 1.5 mL. Approximately 50 μL of the protein extracts were used for separation through electrophoresis, and the remaining used for purification. A scheme of the experimental flow is shown in Figure 3.
FIGURE 3
2.3 Purification and characterization of chromoproteins
Partial purification of CPs from the protein extracts was performed via successive gel-filtration chromatography (Superdex 200 HR 10/30 column; GE Healthcare Life Science) on a fast protein liquid chromatography (FPLC) system (ÄKTA prime; GE Healthcare Life Science). The samples were eluted with 10 mM sodium phosphate buffer (pH 7.5) containing 0.15 M NaCl at a flow rate of 0.5 mL/min. Forty elution products were collected in 1-mL fractions each, and their optical properties and enzymatic activity measured. Absorbance at 280 and 580 nm was measured for each fraction using a spectrophotometer (model UV-2450; Shimadzu, Kyoto, Japan). Molecular weights were estimated using a Gel Filtration Standard molecular marker (Bio-Rad Laboratories, Hercules, California, United States of America).
2.4 Amino acid sequence identification
2.4.1 Protein concentration
The total protein content was determined using a Bio-Rad Protein Assay Kit (Bio-Rad Laboratories) based on the Bradford method () with bovine serum albumin as a standard. The Bradford method quantifies proteins using Coomassie Brilliant Blue G-250, a triphenylmethane blue dye that binds to proteins in acidic solutions and shifts the maximum absorption wavelength from 465 to 595 nm. Absorbance at 595 nm was measured using a Shimadzu spectrophotometer (model UV-2450) at 25°C.
2.4.2 Electrophoresis
Sodium dodecyl polyacrylamide gel electrophoresis (SDS-PAGE) was performed using a RAPIDAS AE-6500 apparatus (ATTO, Tokyo, Japan) with 1-mm thick precast slab gels containing 10%–20% gradient acrylamide (e-PAGEL E-T1020L; ATTO), according to the procedure described by . 100 μg of each protein extract (Pp, Ps, and H) were loaded onto the gel. Electrophoresis was performed at 40 mA for 80 min. After electrophoresis, the gel was stained with a CBB-250 solution (Wako Pure Chemical Industries, Osaka, Japan). The applied molecular mass standard (Precision Plus Protein Standards; Bio-Rad Laboratories) contained protein bands of 10, 20, 25, 37, 50, 75, 100, 150, and 250 kDa in size. Gel photographs were taken with a Panasonic DMC-GF3 camera (Panasonic, Osaka, Japan), and the molecular weights of the protein sample bands calculated using ImageJ software (http://imagej.net/) after the exposure and contrast were adjusted.
2.4.3 In-gel tryptic digestion
The protein bands obtained from the CBB-stained SDS-PAGE gel were sliced into small pieces (approximately 1 mm3) and faded with 50 mM NH4HCO3/50% acetonitrile. Proteins in the sliced gel fragments were reduced and alkylated with 10 mM dithiothreitol/50 mM NH4HCO3 for 45 min at 56°C and 55 mM iodoacetamide/50 mM NH4HCO3 at 25°C for 30 min in the dark. After being washed with acetonitrile, the proteins were digested in 10 µL trypsin (Sequencing Grade; Promega, Madison, WI, United States of America) at 37°C overnight. Tryptic peptides were extracted from the gel fragments using 50% acetonitrile containing 3% formic acid, and the peptide extracts centrifuged at 10,000 × g for 20 min in a vacuum centrifuge.
2.4.4 Liquid chromatography-tandem mass spectrometry analysis
Liquid chromatography-tandem mass spectrometry analysis was performed using a linear ion trap time-of-flight mass spectrometer (LIT–TOF MS; NanoFrontier eLD; Hitachi High-Technologies Corporation, Tokyo, Japan) coupled to a nanoflow HPLC (NanoFrontier nLC; Hitachi High-Technologies Corporation) at the Instrumental Research Support Center of the Research Institute of Green Science and Technology, Shizuoka University (Shizuoka, Japan). Peptides extracted from the gel were trapped and desalted using a C18 monolith trap column (0.05 mm ID × 150 mm long; Hitachi High-Technologies Corporation) and thereafter loaded onto a MonoCap C18 Fast-flow column (0.05 mm ID × 150 mm long; GL Sciences, Inc., Tokyo, Japan). Elution was done using a linear gradient from 5% to 40% solvent B for 60 min at a flow rate of 200 nL/min. Solvent A comprised 2% acetonitrile and 0.1% formic acid, and solvent B contained 98% acetonitrile and 0.1% formic acid. The eluent was ionized using a nanoelectrospray ionization source equipped with an uncoated silica tip (New Objective, Woburn, MA, United States of America) and analyzed using LIT–TOF MS. Mass spectra were obtained by scanning in the positive ion mode in the mass range of m/z 200–2000. MS/MS spectra were generated by using collision-induced dissociation in a linear ion trap. The proteins were identified by analyzing the MS/MS data via de novo sequencing and with the protein identification software, PEAKS Studio (version 7.0; Bioinformatics Solutions, Inc., Waterloo, ON, Canada) (). A protein identification database was generated using the protein sequences of P. astreoides, P. australiensis, and P. lobata obtained from Reef Genomics (http://reefgenomics.org/) (). Reliability of the protein identification results obtained via PEAKS was increased through further analysis of the sequences using MASCOT MS/MS Ions Search (http://www.matrixscience.com/) () and the sequence tag search tool, SPIDER (). The detected proteins were identified through a similarity search of amino acid sequences using the Basic Local Alignment Search Tool (BLAST) on the National Center of Biotechnology Information database (https://blast.ncbi.nlm.nih.gov/), the DNA Data Bank of Japan (DDBJ) (http://blast.ddbj.nig.ac.jp/), and Reef Genomics.
2.4.5 Phylogenetic analysis
A phylogenetic tree of the proteins identified in this study, together with other FPs described previously (), was constructed using an online program (http://www.phylogeny.fr/) developed by Dereeper et al. (; ). Phylogenetic analysis was performed using the following programs: MUSCLE 3.8.31 for multiple alignments, Gblocks 0.91b for alignment refinement, PhyML 3.1 for phylogeny using maximum likelihood, and TreeDyn for tree rendering.
2.5 Microscopic observation of in vivo fluorescence in corals
Overview photographs of corals manifesting PPR and healthy-appearing corals were taken in the laboratory with an OLYMPUS E-PL6 camera under a white light-emitting diode (LED) and processed using Adobe Lightroom (Adobe, San Jose, CA, United States of America) with the following settings: exposure, +0.5; highlight, −75; shadow, −20; white level, +65; black level, −40. The fluorescence levels of each sample were observed using a stereoscopic microscope (Nikon SMZ-1000; Nikon, Tokyo, Japan), and photographs obtained using an OLYMPUS E-PL6 camera equipped with a mount conversion ring. Visible images were obtained under environmental light and an exposure of one-fifth of a second with a sensitivity of ISO 400. Fluorescence images were obtained through excitation with a blue LED with a wavelength range of 380–550 nm (KR93SP; Eco-lamps Inc., Kowloon, Hong Kong), exposure for 13 s with a sensitivity of ISO 100, and filtering through a 600-nm bandpass filter (BPB-60; Fujifilm, Tokyo, Japan). The bandpass filter was attached to the objective lens of the microscope. All images were processed using Adobe Lightroom software.
2.6 Maximum quantum yield of photosystem II
The photosynthetic activity of Symbiodiniaceae under each coral condition was evaluated using the maximum quantum yield of photosystem II (Fv/Fm), and the minimum fluorescence yield (F0) measured using Junior-PAM (Walz, Effeltrich, Germany). Coral nubbins were subjected to dark acclimation for 30 min (). The Fv/Fm and F0 values measured at 10 different points in every coral nubbin were used to estimate averages and standard errors (Supplementary Table S1).
2.7 Hydrogen peroxide-scavenging activity
Enzyme samples were prepared by removing excess water from the collected coral pieces and excavating nine points (1.0–1.5 cm2) on each coral colony surface (Pp and H) using whetstone drilling. The excavated areas were rinsed with 1 mL of 50 mM Tris-HCl buffer (pH 7.6) to collect the coral tissue, and the extract centrifuged at 10,000 × g for 3 min to remove debris. The supernatant was used to measure the protein concentration and hydrogen peroxide-scavenging activity (HSA), following the method described in . To measure HSA, each 50 µL of the sample (coral tissue in buffer solution) and 50 µL of 50 mM hydrogen peroxide solution were mixed on 96-wells microplate. The absorbance at 240 nm was measured every 81 s for 30 min, and the data converted using a standard curve of hydrogen peroxide (serial dilutions: 0, 6.25, 12.5, 25, and 50 mM). HSA was normalized to the protein concentration (Supplementary Table S2).
2.8 Statistical analysis
Independent-samples t-test analysis was carried out to determine significant differences between the Fv/Fm and HSA data from Pp colony and H colony. Normality of the data was tested using Anderson–Darling test. Significant differences were evaluated at p < 0.01.
3 Results
3.1 Purification and characterization of chromoproteins
The soluble fraction of coral tissues manifesting Pp was separated into 40 elution fractions using FPLC. Of these, elution product 18 (18 mL elution volume) showed the highest absorbance at a wavelength of 580 nm (Figure 4A). Using a marker protein, the molecular weight of the main peak fraction (18) was estimated to be 49 kDa. The absorption spectrum of the main fraction is shown in Figure 4B.
FIGURE 4
3.2 Identification of chromoproteins from corals manifesting pink pigmentation responses
Three notable bands on the SDS-PAGE gel were found in the Ps and Pp coral tissues (Figure 5; bands 1–3). PEAKS analysis showed that the proteins extracted from bands 1 and 2 (Protein A) had the same alignment as that of the candidate protein (Porites_australiensis_11250) that was detected in the protein sequences of P. australiensis with high coverage (75%). The amino acid sequence of Protein A was queried on Reef Genomics with the protein database “Porites lutea gene models (ReFuGe 2020),” which identified 20 homologous proteins. Reanalysis of the Protein A was performed with these 20 proteins using PEAKS, where the database identified six proteins with high scores and coverage values with respect to the proteins synthesized by P. lutea. The amino acid sequences of these six proteins are shown in Figure 6. Among the six proteins, plut2.m8.16902.m1 with a GFP domain had the highest coverage (81%). Alignment of plut2.m8.16902.m1 using the BLAST search program in the DDBJ database revealed high similarities with other CPs and FPs from Acropora aculeus, A. digitifera, Goniopora tenuidens, Galaxea fascicularis, A. millepora, and many other coral species (Table 1). Using electrophoresis and amino acid sequence analyses (in-gel trypsin digestion and liquid chromatography-tandem mass spectrometry analysis), its molecular weight was determined to be 25 kDa (Figure 5; Table 1). The protein in band 3 (Protein B) was also analyzed using the same methods and showed a high similarity with thioredoxin-like proteins from several marine organisms (Table 1). On the other hand, no remarkable band in the electrophoresis result near 25 kDa (CPs and GFP) was found for the healthy colony: the greenish appearance of the healthy colony (Figure 2A) was due to the reflection from the green band of the endolithic community that was well developed underneath the coral tissue and not to the presence of GFP. Moreover, the molecular weight of GFP in Porites lutea is 24.8 kDa (Porites lutea database in Reef Genomics) but, from the electrophoresis study, the healthy coral did not show high expression of protein in the band corresponding to GFP’s molecular weight. Phylogenetic analysis revealed that the six identified proteins were nonfluorescent, similar to that of other CPs in several coral species (Figure 7).
FIGURE 5
FIGURE 6
TABLE 1
| [Bands 1 and 2; protein A] | [Band 3; Protein B] | ||||||
|---|---|---|---|---|---|---|---|
| Alignment | Alignment | ||||||
| Name: plut2.m8.16902.m1 Alignment: SVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVKLTVTKGGPLPFAWDILSPQTQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMKFEDGAVCTVTNDSSMQGNCFIYNVKFSGLNFPPNGPVMQKKTQGWEPNTERLYARDGMLIGNNFMALKLEGGGHYTCEFKSTYKAKKPVMMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA | Name: plut2.m8.16752.m1 Alignment: QDDFDAFLKEAGSTLVVVDFYADWCGPCKMIAPKIKGFAEEFSGKVYFAKVNVDENDEVAGKEGISAMPTFNLYKNGAKVDELTGANEAKLRELIEKRI | ||||||
| Average mass: 24,870 | Average mass: 10,957 | ||||||
| Putative conserved domains: GFP superfamily | Putative conserved domains: TRX_family, thioredoxin and thioredoxin_like superfamily | ||||||
| Similar proteins | Similar proteins | ||||||
| Accession number | Protein name | Species | Identity | Accession number | Protein name | Species | Identity |
| Q66PU8 | Chromoprotein | Acropora aculeus | 211/220 (95%) | A0A2B4SRX0 | Thioredoxin | Stylophora pistillata | 61/94 (64%) |
| A0A1S7IWH7 | Fluorescent protein | Acropora digitifera | 211/220 (95%) | A0A1X7VQB2 | Thioredoxin | Amphimedon queenslandica (sponge) | 56/97 (57%) |
| Q95P04 | GFP-like non-fluorescent chromoprotein | Goniopora tenuidens | 211/220 (95%) | A0A3S3QB26 | Thioredoxin | Dinothrombium tinctorium (red velvet mite) | 58/98 (59%) |
| A8CLV6 | GFP-like chromoprotein | Galaxea fascicularis | 211/220 (95%) | A0A1D2NA26 | Thioredoxin-2 | Orchesella cincta (springtail) | 61/98 (62%) |
| A0A1S7IWI5 | Fluorescent protein | Acropora digitifera | 210/220 (95%) | L7XAL0 | Thioredoxin | Scylla paramamosain (mud crab) | 58/97 (59%) |
| Q66PV0 | Chromoprotein | Acropora millepora | 210/220 (95%) | Accession number | Protein name | Species | Identity |
| B5T1L1 | Chromoprotein CP584 | Acropora pulchra | 210/220 (95%) | A0A2B4SRX0 | Thioredoxin | Stylophora pistillata | 61/94 (64%) |
| M4R4D0 | Chromoprotein 580 | Acropora millepora | 211/220 (95%) | A0A1X7VQB2 | Thioredoxin | Amphimedon queenslandica (sponge) | 56/97 (57%) |
| A0A1S7IWI6 | Fluorescent protein | Acropora digitifera | 209/220 (95%) | A0A3S3QB26 | Thioredoxin | Dinothrombium tinctorium (red velvet mite) | 58/98 (59%) |
| A8CLL3 | GFP-like chromoprotein | Goniopora djiboutiensis | 209/220 (95%) | A0A1D2NA26 | Thioredoxin-2 | Orchesella cincta (springtail) | 61/98 (62%) |
Amino acid sequences and homologues of protein that were specific for corals manifesting Ps and Pp. Alignments were determined by BLAST search from database of P. lutea on Reef Genomics. Putative conserved domains and similar proteins were determined by BLAST search from UniProtKB/Swiss-Prot + TrEMBL database on DDBJ.
FIGURE 7
3.3 Localization of chromoproteins and red fluorescent protein in corals displaying pink pigmentation responses
Figure 8 shows the aspect of the colony manifesting Pp (Figure 8A,C,E) and healthy-appearing coral colony (Figure 8B,D,F) under visible light, and their fluorescence under a stereoscopic microscope using the bandpass filter transmitting light at 600 nm wavelength. Under visible light, the entire surface of the corals was purple and the tentacles a pale pink (Figure 8C). Conversely, under blue LED light and bandpass filter, red fluorescence was observed only at the tip of the tentacles (Figure 8E), and slight fluorescence was observed in healthy-appearing corals (Figure 8F).
FIGURE 8

Aspects of Porites nubbins and fluorescence image that were taken under microscope. Images of (A, B) are overview of corals nubbins and (C–F) are magnified images (10X). (A, C, and E) Coral manifesting pink patch (Pp), (B, D and F) healthy-appearing colony (H). The (E and F) are fluorescent image under blue LED light.
3.4 Evaluation of the coral stress state
The stress conditions of the studied corals and their Symbiodiniaceae were estimated by measuring the Fv/Fm and F0 (Table 2), as well as the HSA (Table 3). The Fv/Fm and F0 values of the corals with pink pigmentation were 0.434 and 369.5, respectively, which were significantly lower than those of healthy-appearing corals (0.521 and 597.3, respectively) (p < 0.01). Furthermore, the HSA value of corals manifesting pink pigmentation (1.88 nmol min−1 mg−1 protein) was 4.3 times significantly higher than that of healthy-appearing corals (0.44 nmol min−1 mg−1 protein) (p < 0.01).
TABLE 2
| Fv/Fm | s.e. | F0 | s.e. | |
|---|---|---|---|---|
| Pp colony | 0.434* | ±0.036 | 369.5* | ±44.8 |
| H colony | 0.521 | ±0.016 | 597.3 | ±25.4 |
Comparison of maximum quantum yield of photosystem II (Fv/Fm) and minimum fluorescence yield (F0) of each coral colony (Pp and H). Means ± s.e. (n = 10). Asterisks mean significant differences with healthy-appearing coral by t-test at p < 0.01.
TABLE 3
| HSA (decrease of nmol H2O2 min-1 mg protein−1) | ||
|---|---|---|
| Pp colony | 1.88* | ±0.05 |
| H colony | 0.44 | ±0.06 |
Comparison of hydrogen peroxide scavenging activity (HSA) of each coral colony (Pp and H). Means ± s.d. (n = 9). Asterisks mean significant differences with healthy-appearing coral by t-test at p < 0.01.
4 Discussion
The pink pigment produced by corals manifesting PPRs was found to be a type of nonfluorescent CP. Our results also revealed that the CP was common in Ps and Pp lesions and homologous to other nonfluorescent CPs that have been reported in other corals (
The present study demonstrated that CPs were encoded in the genome of Porites corals (P. astreoides, P. australiensis, and P. lobata), and the same CP expressed in different morphologies of PPRs (Ps and Pp), associated with the pink pigmentation response of inflamed tissues. Three presumed CP sequences were also identified in A. digitifera (Shinzato et al., 2012). These sequences were also included in the same clade as the six Porites sequences obtained in our study, which supports the present results as the 6 detected proteins beat similar properties as non-fluoresce and the formation of dimers. Moreover, in addition to plutCP synthesized by Porites spp. corals, a thioredoxin-like protein that is linked to redox signaling was expressed at high levels in the Ps lesions (Figure 5, Band 3).
The CP of Porites spp. was detected only in tissues that manifested PPRs. In relation to other types of CPs, Shinzato et al. (2012) reported that the three CPs of A. digitifera were highly expressed in the developmental stages but very poorly in adults. Studies by Takahashi-Kariyazono et al. (2018) also showed that FPs in middle-/long-wavelength emissions (519, 606, and 613 nm) and CPs were important for Acropora larvae, but were not expressed in adults. However, Smith et al. (2013) and
The PPRs in Porites spp. corals are highly distributed in the apical area of the colony, which is impacted by light in the shallow reefs of Okinawa during the low-tide period, in contrast to those medial and basal areas of the colony which are self-shaded (Yucharoen, 2016). The high production of CPs in the restricted PPR lesions reflects a focalized immune response of these corals to environmental stressors: biotic as the penetration of boring organisms, and more importantly, abiotic factors such as the salinity, the height of low tide, the time of exposure to air, and nutrient concentration, among others (In Yucharoen, 2016, pg.41, Table 5). In addition, RFPs and CPs coexist in the PPR lesions, but their distribution differs within the coral tissue, mainly coenosarc for CPs and tip of polyps’ tentacles for RFPs. CPs and their homologs have been suggested to serve as coral health indicators, as they usually protect cells against free radicals, and CPs likely also play important roles in the coral immune system and photoprotection, similar to that of RFPs.
Although Porites corals are tolerant species that can adapt to various environments (
This is the first study to report the role and distribution of CPs in corals manifesting PPR lesions. We believe that these findings will aid our understanding of PPR formation mechanism, which is an important subject in coral disease research. In addition, we describe, for the first time, the coexistence of nonfluorescent proteins and FPs in massive Porites spp. manifesting PPRs. Despite the PPR morphology (Ps or Pp) of Porites spp., the corals expressed the same type of CP. CPs have potential applications as genetic markers and cellular biosensors because of their ease of detection (
5 Compliance
Permission for coral sampling was obtained from Okinawa Prefecture (permit No. 30–55). The permit period was from 20 July 2018 to 19 July 2019.
Statements
Data availability statement
The original contributions presented in the study are included in the article/Supplementary Material, further inquiries can be directed to the corresponding author.
Ethics statement
The manuscript presents research on animals that do not require ethical approval for their study.
Author contributions
TS: Writing–original draft, Investigation, Conceptualization, Methodology, Formal Analysis, Visualization, Validation, Data curation, Writing–review and editing. BC: Writing–original draft, Writing–review and editing, Validation, Supervision, Resources, Project administration, Methodology, Funding acquisition. MY: Writing–original draft, Writing–review and editing, Formal Analysis, Validation, Data curation. HD: Writing–review and editing, Methodology, Formal Analysis, Data curation. YS: Writing–review and editing, Supervision, Project administration.
Funding
The author(s) declare that financial support was received for the research, authorship, and/or publication of this article. Grant-in-Aid for Fund for the Promotion of Joint International Research [Fostering Joint International Research (B)] from the Japanese Ministry of Education, Culture, Sports, Science and Technology (MEXT) (No. 18KK0298), and by the 50th Anniversary Grant from the Mitsubishi Corporation on “Global Coral Reef Conservation Project (GCRCP). The funders were not involved in the study design, collection, analysis, interpretation of data, the writing of this article, or the decision to submit it for publication.
Acknowledgments
We are grateful to the staff at Sesoko Station, Tropical Biosphere Research Center (University of the Ryukyus, Japan), for providing the necessary facilities during this study, and to Mr. Sunao Uehara for his assistance with coral sampling.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
The author(s) declared that they were an editorial board member of Frontiers, at the time of submission. This had no impact on the peer review process and the final decision.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fphys.2024.1339907/full#supplementary-material
References
1
AebyG. S. (1992). The potential effect the ability of a coral intermediate host to regenerate has had on the evolution of its association with a marine parasite. Proceeding of the Seventh International Coral Reef Symposium, Guam, 1992, 2.
2
AebyG. S. (2003). Corals in the genus Porites are susceptible to infection by a larval trematode. Coral Reefs22, 216. 10.1007/s00338-003-0310-9
3
AebyG. S.WilliamsG. J.FranklinE. C.KenyonJ.CoxE. F.ColesS.et al (2011). Patterns of coral disease across the Hawaiian Archipelago: relating disease to environment. PLoS ONE6, e20370. 10.1371/journal.pone.0020370
4
AhmedF. H.CaputoA. T.FrenchN. G.PeatT. S.WhitfieldJ.WardenA. C.et al (2022). Over the rainbow: structural characterization of the chromoproteins gfasPurple, amilCP, spisPink and eforRed. Acta Crystallogr. D. Struct. Biol.78 (Pt 5), 599–612. 10.1107/S2059798322002625
5
AlievaN. O.KonzenK. A.FieldS. F.MeleshkevitchE. A.HuntM. E.Beltran-RamirezV.et al (2008). Diversity and evolution of coral fluorescent proteins. PLoS ONE3, e2680. 10.1371/journal.pone.0002680
6
AryaR.MallikM.LakhotiaS. C. (2007). Heat shock genes - integrating cell survival and death. J. Biosci.32, 595–610. 10.1007/s12038-007-0059-3
7
BeedenR.WillisB.RaymundoL.PageC.WeilE. (2008). Underwater cards for assessing coral health on indo-pacific reefs - Resources - CCRES.
8
BenzoniF.GalliP.PichonM. (2010). Pink spots on Porites: not always a coral disease. Coral Reefs29, 153. 10.1007/s00338-009-0571-z
9
BollatiE.LyndbyN. H.D'AngeloC.KühlM.WiedenmannJ.WangpraseurtD. (2022). Green fluorescent protein-like pigments optimise the internal light environment in symbiotic reef-building corals. eLife11, e73521. 10.7554/eLife.73521
10
BongiorniL.RinkevichB. (2005). The pink-blue spot syndrome in Acropora eurystoma (Eilat, Red Sea): a possible marker of stress?Zoology108, 247–256. 10.1016/j.zool.2005.05.002
11
BorgerJ. L. (2005). Dark spot syndrome: a scleractinian coral disease or a general stress response?Coral Reefs24, 139–144. 10.1007/s00338-004-0434-6
12
Bou-AbdallahF.ChasteenN. D.LesserM. P. (2006). Quenching of superoxide radicals by green fluorescent protein. Biochimica Biophysica Acta - General Subj.1760, 1690–1695. 10.1016/j.bbagen.2006.08.014
13
BradfordM. M. (1976). A rapid and sensitive method for the quantitation of microgram quantities of protein utilizing the principle of protein-dye binding. Anal. Biochem.72, 248–254. 10.1006/abio.1976.9999
14
BridgesM. C.WoodleyC. M.PetersE. C.MayL. A.GallowayS. B. (2020). Expression and characterization of a bright far-red fluorescent protein from the pink-pigmented tissues of Porites lobata. Mar. Biotechnol.22, 67–80. 10.1007/s10126-019-09931-9
15
CantinN. E.LoughJ. M. (2014). Surviving coral bleaching events: Porites growth anomalies on the Great Barrier Reef. PLoS One9, e88720. 10.1371/journal.pone.0088720
16
CervinoJ.GoreauT. J.NagelkerkenI.SmithG. W.HayesR. (2001). Yellow band and dark spot syndromes in Caribbean corals: distribution, rate of spread, cytology, and effects on abundance and division rate of zooxanthellae. Hydrobiologia460, 53–63. 10.1023/A:1013166617140
17
CottrellJ. S. (2011). Protein identification using MS/MS data. J. Proteomics74, 1842–1851. 10.1016/j.jprot.2011.05.014
18
D’AngeloC.SmithE. G.OswaldF.BurtJ.TchernovD.WiedenmannJ. (2012). Locally accelerated growth is part of the innate immune response and repair mechanisms in reef-building corals as detected by green fluorescent protein (GFP)-like pigments. Coral Reefs31, 1045–1056. 10.1007/s00338-012-0926-8
19
DereeperA.AudicS.ClaverieJ. M.BlancG. (2010). BLAST-EXPLORER helps you building datasets for phylogenetic analysis. BMC Evol. Biol.10, 8. 10.1186/1471-2148-10-8
20
DereeperA.GuignonV.BlancG.AudicS.BuffetS.ChevenetF.et al (2008). Phylogeny.fr: robust phylogenetic analysis for the non-specialist. Nucleic acids Res.36, W465–W469. 10.1093/nar/gkn180
21
GittinsJ. R.D’AngeloC.OswaldF.EdwardsR. J.WiedenmannJ. (2015). Fluorescent protein-mediated colour polymorphism in reef corals: multicopy genes extend the adaptation/acclimatization potential to variable light environments. Mol. Ecol.24, 453–465. 10.1111/mec.13041
22
HanY.MaB.ZhangK. (2004).SPIDER: software for protein identification from sequence tags with de novo sequencing error. Proceedings - 2004 IEEE Computational Systems Bioinformatics Conference, CSB 2004. IEEE Computer Society, 206–215.
23
HughesT. P.KerryJ. T.BairdA. H.ConnollyS. R.DietzelA.EakinC. M.et al (2018). Global warming transforms coral reef assemblages. Nature556 (7702), 492–496. 10.1038/s41586-018-0041-2
24
JinY. K.LundgrenP.LutzA.RainaJ. B.HowellsE. J.PaleyA. S.et al (2016). Genetic markers for antioxidant capacity in a reef-building coral. Sci. Adv.2 (5), e1500842. 10.1126/sciadv.1500842
25
JohannesR. E.WiebeW. J. (1970). Method for determination of coral tissue biomass and composition. Limnol. Oceanogr.15, 822–824. 10.4319/lo.1970.15.5.0822
26
JohnsonJ. V.ExtonD. A.DickJ. T. A.OakleyJ.JompaJ.Pincheira-DonosoD. (2022). The relative influence of sea surface temperature anomalies on the benthic composition of an Indo-Pacific and Caribbean coral reef over the last decade. Ecol. Evol.12 (9), e9263. 10.1002/ece3.9263
27
KashimotoR.HisataK.ShinzatoC.SatohN.ShoguchiE. (2021). Expansion and diversification of fluorescent protein genes in fifteen Acropora species during the evolution of acroporid corals. Genes.12 (3), 397. 10.3390/genes12030397
28
KenkelC. D. (2008). Coral disease: baseline surveys in the andaman sea and gulf of Thailand. Phuket Mar. Biol. Cent. Res. Bull.53, 43–53.
29
KrauseG. H.WeisE. (1991). Chlorophyll fluorescence and photosynthesis: the basics. Annu. Rev. Physiol. Plant Mol. Biol.42, 313–349. 10.1146/annurev.pp.42060191.001525
30
KritsanapuntuS.AngkhananukrohP. (2014). Coral disease prevalence in samui Island and the adjacent islands, southern part of the gulf of Thailand | international network for natural Sciences INNSPUB - academia.edu. J. Biodivers. Environ. Sci.5, 158–165.
31
KubomuraT.WeeH. B.ReimerJ. D. (2021). Investigating incidence and possible causes of pink and purple pigmentation response in hard coral genus Porites around Okinawajima Island, Japan. Regional Stud. Mar. Sci.41, 101569. 10.1016/j.rsma.2020.101569
32
KumarJ. S. Y.GeethaS.SatyanarayanaC.VenkataramanK.KambojR. D. (2014). Observations on coral diseases in marine national park, gulf of kachchh. Scholars Acad. J. Biosci.2, 370–373. 10.36347/sajb.2014.v02i06.002
33
LabasY. A.GurskayaN. G.YanushevichY. G.FradkovA. F.LukyanovK. A.LukyanovS. A.et al (2002). Diversity and evolution of the green fluorescent protein family. Proc. Natl. Acad. Sci. U. S. A.99, 4256–4261. 10.1073/pnas.062552299
34
LaemmliU. K. (1970). Cleavage of structural proteins during the assembly of the head of bacteriophage T4. Nature227, 680–685. 10.1038/227680a0
35
LanneauD.BrunetM.FrisanE.SolaryE.FontenayM.GarridoC. (2008). Heat shock proteins: essential proteins for apoptosis regulation. J. Cell. Mol. Med.12, 743–761. 10.1111/j.1582-4934.2008.00273.x
36
LiewY. J.ArandaM.VoolstraC. R. (2016). Reefgenomics.Org - a repository for marine genomics data. Database J. Biol. databases curation2016, baw152. 10.1093/database/baw152
37
LiljeruhmJ.FunkS. K.TietscherS.EdlundA. D.JamalS.Wistrand-YuenP.et al (2018). Engineering a palette of eukaryotic chromoproteins for bacterial synthetic biology. J. Biol. Eng.12, 8. 10.1186/s13036-018-0100-0
38
LukyanovK. A.FradkovA. F.GurskayaN. G.MatzM. V.LabasY. A.SavitskyA. P.et al (2000). Natural animal coloration can be determined by a nonfluorescent green fluorescent protein homolog. J. Biol. Chem.275, 25879–25882. 10.1074/jbc.C000338200
39
MaB.ZhangK.HendrieC.LiangC.LiM.Doherty-KirbyA.et al (2003). PEAKS: powerful software for peptide de novo sequencing by tandem mass spectrometry. Rapid Commun. Mass Spectrom.17, 2337–2342. 10.1002/rcm.1196
40
MatzM. V.FradkovA. F.LabasY. A.SavitskyA. P.ZaraiskyA. G.MarkelovM. L.et al (1999). Fluorescent proteins from nonbioluminescent Anthozoa species. Nat. Biotechnol.17, 969–973. 10.1038/13657
41
MiyawakiA. (2002). Green fluorescent protein-like proteins in reef anthozoa animals. Cell. Struct. Funct.27, 343–347. 10.1247/csf.27.343
42
MohamedA. R.AliA.-H. A. M.Abdel-SalamH. A. (2012). “Status of coral reef health in the northern Red Sea, Egypt,” in 12th international coral reef symposium, 5.
43
MontalbettiE.BiscéréT.Ferrier-PagèsC.HoulbrèqueF.OrlandiI.ForcellaM.et al (2021). Manganese benefits heat-stressed corals at the cellular level. Front. Mar. Sci. 29 June 2021 Sec. Aquat. Physiol.8–2021. 10.3389/fmars.2021.681119
44
MullenK. M.HarvellC. D.AlkerA. P.DubeD.Jordán-DahlgrenE.WardJ. R.et al (2006). Host range and resistance to aspergillosis in three sea fan species from the Yucatan. Mar. Biol.149, 1355–1364. 10.1007/s00227-006-0275-7
45
NishihiraM. (2004). “Hermatypic corals of Japan,” in: Coral Reefs of Japan, eds. Ministry of the Environment and The Japanese Coral Reef Society (Tokyo, Japan: Ministry of the Environment), 10–13.
46
PalmerC. V.ModiC. K.MydlarzL. D. (2009a). Coral fluorescent proteins as antioxidants. PLoS ONE4, e7298. 10.1371/journal.pone.0007298
47
PalmerC. V.RothM. S.GatesR. D. (2009b). Red fluorescent protein responsible for pigmentation in trematode-infected Pontes compressa tissues. Biol. Bull.216, 68–74. 10.1086/BBLv216n1p68
48
PutchimL.YamarunpattanaC.PhongsuwanN. (2012). Observations of coral disease in Porites lutea in the Andaman Sea following the 2010 bleaching. Phuket Mar. Biol. Cent. Res. Bull.71, 57–62.
49
RavindranJ.RaghukumarC. (2002). Pink line syndrome (PLS) in the scleractinian coral Porites lutea. Coral Reefs21, 252. 10.1007/s00338-002-0247-4
50
RavindranJ.RaghukumarC. (2006). Histological observations on the scleractinian coral Porites lutea affected by pink-line syndrome. Curr. Sci.90, 720–724. 10.2307/24089122
51
RaymundoL. J.ResellK. B.RebotonC. T.KaczmarskyL. (2005). Coral diseases on Philippine reefs: genus Porites is a dominant host. Dis. Aquatic Org.64, 181–191. 10.3354/dao064181
52
RinkevichB.FrankU.BakR. P. M.MüllerW. E. G. (1994). Alloimmune responses between Acropora hemprichi conspecifics: nontransitive patterns of overgrowth and delayed cytotoxicity. Mar. Biol.118, 731–737. 10.1007/BF00347522
53
SatohN.KinjoK.ShintakuK.KezukaD.IshimoriH.YokokuraA.et al (2021). Color morphs of the coral, Acropora tenuis, show different responses to environmental stress and different expression profiles of fluorescent-protein genes. G311 (2), jkab018. 10.1093/g3journal/jkab018
54
SéréM. G.ChabanetP.TurquetJ.QuodJ. P.SchleyerM. H. (2015). Identification and prevalence of coral diseases on three Western Indian Ocean coral reefs. Dis. Aquatic Org.114, 249–261. 10.3354/dao02865
55
SevesoD.ArrigoniR.MontanoS.MaggioniD.OrlandiI.BerumenM. L.et al (2020). Investigating the heat shock protein response involved in coral bleaching across scleractinian species in the central Red Sea. Coral Reefs39, 85–98. 10.1007/s00338-019-01878-6
56
SevesoD.MontanoS.MaggioniD.PedrettiF.OrlandiI.GalliP.et al (2018). Diel modulation of Hsp70 and Hsp60 in corals living in a shallowreef. Coral Reefs37, 801–806. 10.1007/s00338-018-1703-0
57
ShinzatoC.ShoguchiE.TanakaM.SatohN. (2012). Fluorescent protein candidate genes in the coral Acropora digitifera genome. Zoological Sci.29, 260–264. 10.2108/zsj.29.260
58
SmithE. G.D’AngeloC.SalihA.WiedenmannJ. (2013). Screening by coral green fluorescent protein (GFP)-like chromoproteins supports a role in photoprotection of zooxanthellae. Coral Reefs32, 463–474. 10.1007/s00338-012-0994-9
59
SullyS.BurkepileD. E.DonovanM. K.HodgsonG.van WoesikR. (2019). A global analysis of coral bleaching over the past two decades. Nat. Commun.10 (1), 1264–1265. 10.1038/s41467-019-09238-2
60
Takahashi-KariyazonoS.SakaiK.TeraiY. (2018). Presence–absence polymorphisms of highly expressed FP sequences contribute to fluorescent polymorphisms in Acropora digitifera. Genome Biol. Evol.10, 1715–1729. 10.1093/gbe/evy122
61
ThineshT.MathewsG.EdwardJ. K. P. (2011). Coral disease prevalence in the Palk Bay, Southeastern India – with special emphasis to black band. Indian J. Geo-Marine Sci.40, 813–820.
62
ThummasanM.CasaretoB. E.RamphulC.SuzukiT.ToyodaK.SuzukiY. (2021). Physiological responses (Hsps 60 and 32, caspase 3, H2O2 scavenging, and photosynthetic activity) of the coral Pocillopora damicornis under thermal and high nitrate stresses. Mar. Pollut. Bull.171, 112737. 10.1016/j.marpolbul.2021.112737
63
VerkhushaV. V.LukyanovK. A. (2004). The molecular properties and applications of Anthozoa fluorescent proteins and chromoproteins. Nat. Biotechnol.22, 289–296. 10.1038/nbt943
64
VeronJ. E. N. (1992). Conservation of biodiversity: a critical time for the hermatypic corals of Japan. Coral Reefs11, 13–21. 10.1007/BF00291930
65
WardW. W.CormierM. J. (1979). An energy transfer protein in coelenterate bioluminescence. Characterization of the Renilla green-fluorescent protein. J. Biol. Chem.254 (3), 781–788. 10.1016/S0021-9258(17)37873-0
66
WeilE.IrikawaA.CasaretoB.SuzukiY. (2012). Extended geographic distribution of several Indo-Pacific coral reef diseases. Dis. Aquatic Org.98, 163–170. 10.3354/dao02433
67
WeilE.RogersC. S.CroquerA. (2016). “Octocoral diseases in a changing ocean,” in Marine animal forests. Editors RossiS.BramantiL.GoriA.Orejas Saco del ValleC. (Springer International Publishing), 1–55.
68
WiedenmannJ.ElkeC.SpindlerK. D.FunkeW. (2000). Cracks in the β-can: fluorescent proteins from Anemonia sulcata (anthozoa, actinaria). Proc. Natl. Acad. Sci. U. S. A.97, 14091–14096. 10.1073/pnas.97.26.14091
69
WillisB. L.PageC. A.DinsdaleE. A. (2004). Coral disease on the great barrier reef. Coral health and disease. Berlin Heidelberg: Springer, 69–104.
70
YucharoenM. (2016). Pink pigmentation response during recovery period after coral bleaching. dissertation/PhD Thesis. Shizuoka (Japan): Shizuoka University. 10.14945/00009914
Summary
Keywords
chromoprotein, fluorescent protein, non-fluorescent chromoprotein, Porites spp., oxidative stress, pink pigmentation response, innate immune response
Citation
Suzuki T, Casareto BE, Yucharoen M, Dohra H and Suzuki Y (2024) Coexistence of nonfluorescent chromoproteins and fluorescent proteins in massive Porites spp. corals manifesting a pink pigmentation response. Front. Physiol. 15:1339907. doi: 10.3389/fphys.2024.1339907
Received
17 November 2023
Accepted
16 April 2024
Published
17 June 2024
Volume
15 - 2024
Edited by
Davide Seveso, University of Milano-Bicocca, Italy
Reviewed by
Adán Guillermo Jordán-Garza, Universidad Veracruzana, Mexico
Rachel Alderdice, University of Technology Sydney, Australia
Updates

Check for updates
Copyright
© 2024 Suzuki, Casareto, Yucharoen, Dohra and Suzuki.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Toshiyuki Suzuki, suzuki.toshiyuki@shizuoka.ac.jp
† These authors have contributed equally to this work and share first authorship
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.