ORIGINAL RESEARCH article

Front. Physiol., 21 February 2020

Sec. Striated Muscle Physiology

Volume 11 - 2020 | https://doi.org/10.3389/fphys.2020.00128

Cryptochromes Mediate Intrinsic Photomechanical Transduction in Avian Iris and Somatic Striated Muscle

  • Department of Neurosciences, University of Toledo College of Medicine and Life Sciences, Toledo, OH, United States

Abstract

Irises isolated from the eyes of diverse species constrict when exposed to light. Depending on species this intrinsic photomechanical transduction response (PMTR) requires either melanopsin or cryptochrome (CRY) photopigment proteins, generated by their respective association with retinoid or flavin adenine dinucleotide (FAD) chromophores. Although developmentally relevant circadian rhythms are also synchronized and reset by these same proteins, the cell type, mechanism, and specificity of photomechanical transduction (PMT) and its relationship to circadian processes remain poorly understood. Here we show that PMTRs consistent with CRY activation by 430 nm blue light occur in developing chicken iris striated muscle, identify relevant mechanisms, and demonstrate that similar PMTRs occur in striated iris and pectoral muscle fibers, prevented in both cases by knocking down CRY gene transcript levels. Supporting CRY activation, iris PMTRs were reduced by inhibiting flavin reductase, but unaffected by melanopsin antagonism. The largest iris PMTRs paralleled the developmental predominance of striated over smooth muscle fibers, and shared their requirement for extracellular Ca2+ influx and release of intracellular Ca2+. Photo-stimulation of identified striated myotubes maintained in dissociated culture revealed the cellular and molecular bases of PMT. Myotubes in iris cell cultures responded to 435 nm light with increased intracellular Ca2+ and contractions, mimicking iris PMTRs and their spectral sensitivity. Interestingly PMTRs featuring contractions and requiring extracellular Ca2+ influx and release of intracellular Ca2+ were also displayed by striated myotubes derived from pectoral muscle. Consistent with these findings, cytosolic CRY1 and CRY2 proteins were detected in both iris and pectoral myotubes, and knocking down myotube CRY1/CRY2 gene transcript levels specifically blocked PMTRs in both cases. Thus CRY-mediated PMT is not unique to iris, but instead reflects a more general feature of developing striated muscle fibers. Because CRYs are core timing components of circadian clocks and CRY2 is critical for circadian regulation of myogenic differentiation CRY-mediated PMT may interact with cell autonomous clocks to influence the progression of striated muscle development.

Introduction

Irises isolated from the eyes of fish, amphibians, reptiles, birds as well as nocturnal and crepuscular mammals constrict within seconds when exposed to light (reviewed by Barr, 1989; Xue et al., 2011). This intrinsic photomechanical transduction response (PMTR) is postulated to be initiated by a “light sensor” associated with the iris sphincter muscle that triggers an increase in free intracellular Ca2+ (Zucker and Nolte, 1978; Barr, 1989; Tu, 2004; Xue et al., 2011). Melanopsin (OPN4) and Cryptochrome (CRY) are photopigments expressed in irises that underlie PMT in a species-dependent manner; they also function over longer times to exert neural control over circadian rhythms and cell autonomous circadian clocks. OPN4 induces phototransduction in retinal ganglion cells which transmit day/night cycle information to the hypothalamic suprachiasmatic nucleus (SCN) a “master pacemaker” that generates rhythmic output firing allowing it to synchronize peripheral circadian clocks through neural and humoral pathways (Paul et al., 2009; Welsh et al., 2010). Correlative and gene knockdown studies indicate that OPN4 underlies the PMTR in Xenopus iris (OPN4X) and the mammalian form (OPN4M) is at least partly responsible for the PMTR in mouse iris muscle, acting via phospholipase-C (PLC) to trigger an increase in intracellular Ca2+ (Provencio et al., 1998; Lucas et al., 2003; Xue et al., 2011; Wang et al., 2017). Unlike the OPN4s, that utilize retinoid based light-sensitive chromophore, Type I CRYs are classified as flavoproteins in that they stoichiometrically bind a flavin adenine dinucleotide (FAD) chromophore to initiate a phototransduction process (Oztürk et al., 2008). Type I CRYs signal via blue light FAD photoreduction/phosphorylation, and are distantly related to photolyases responsible for repairing DNA damaged by ultraviolet light. Drosophila Type I CRY is instrumental in light-dependent magnetoreception (Gegear et al., 2008) and phototransduction in arousal neurons (Fogle et al., 2011, 2015) and also has transcriptional activity, transducing light-dependent molecular interactions important for circadian clock functions (Busza et al., 2004). In vertebrates, CRYs are molecular components of circadian clocks that drive light-independent expression of cell-specific genes, and have been classified as Type II. In mammals CRYs set clock periodicity by acting as transcriptional repressors in a negative feedback cycle, dimerizing with Per proteins in the cytoplasm and translocating to the nucleus where they inhibit CLOCK:BMAL1 factors from initiating further transcription (Griffin et al., 1999; Cashmore, 2003; Mohawk et al., 2012; Buhr and Takahashi, 2013).

Avian CRYs pose an exception to the simple invertebrate light-dependent (Type I) versus vertebrate light-independent (Type II) classification since an avian CRY (CRY4) binds FAD and plays a light-dependent role in magnetoreception (Kubo et al., 2006; Watari et al., 2012; Wang et al., 2018). Moreover, avian CRY1 and CRY2 share 14 of the 17 amino acids with CRY4 at sites implicated in FAD binding as well as a triad of tryptophans believed to facilitate light-activated intramolecular electron transfer (Kubo et al., 2006). Consistent with a role in PMT, the robust PMTR observed in embryonic chicken iris (reviewed by Pilar et al., 1987) requires CRY1 and CRY2. Specifically, PMT persisted after retinoid depletion, its action spectrum with a peak at 430 nm matched that for bacterial CRY absorption but not that of any opsin-based photopigment, and PMTRs were attenuated after siRNA CRY1 and CRY2 transcript knockdown but persisted after OPN4 knockdown (Tu, 2004). Despite strong evidence for CRYs underlying chick iris PMT, the relevant light sensing cells have not been identified and neither their dependence on CRY proteins therein, nor relevant downstream signaling mechanisms have been identified. To approach these gaps, cellular and molecular mechanisms underlying PMT in chick iris and muscle fibers were explored. Here we show that PMTRs consistent with CRY activation occur in developing chick iris striated muscle, identify relevant mechanisms, and demonstrate that similar PMTRs occur in striated iris and pectoral muscle fibers that are prevented in both cases by knocking down CRY1and CRY2 gene transcripts with anti-sense oligonucleotides. The results indicate that cytosolic CRY-photoactivation couples to mobilization of intracellular Ca2+, mediating PMT and reflecting a shared feature of developing striated iris and somatic muscle.

Materials and Methods

Chick Iris Preparation

According to PHS policy, no vertebrate animals will be used. “PHS Policy is applicable to proposed activities that involve live vertebrate animals. While embryonal stages of avian species develop vertebrae at a stage in their development prior to hatching, OPRR has interpreted “live vertebrate animal” to apply to avians (e.g. chick embryos) only after hatching1.”. Fertile chicken (Gallus gallus) eggs were obtained from the Department of Animal Sciences, Michigan State University and housed in a forced draft egg incubator at 38°C. After 8–18 days of embryonic development (E8-18) (Hamburger and Hamilton, 1951) iris preparations were excised from the eyes of embryos of both sexes by making circumferential cuts along the cornea-scleral border and gently pulling the resulting disk free from the underlying lens and vitreous humor. The preparations, including iris sphincter muscle as well as associated dilator, pigment epithelium (PE) and cornea and were pinned cornea down, maintained at 21–22°C in a recording solution (RS; pH 7.4) containing (in mM): 145 NaCl, 5.3 KCl, 5 HEPES, 5.4 Glucose, 0.8 MgSO4, and 2.5 CaCl2, and dark adapted for 15–20 min between photo-stimulation trials. In some cases, the PE was removed with a cotton-tipped applicator.

Cell Culture

Because the PMT light sensor is postulated to be within the iris sphincter muscle (Barr, 1989; Tu, 2004; Xue et al., 2011) a culture system was employed to assess its cellular basis. Cultures were prepared from 6 to 12 E13-14 iris sphincter muscles and their associated PE, or from 2 to 3 E11-12 pectoral muscles. Dissociated cells were obtained by pre-incubating dissected tissue pieces for 20–30 min at 37°C followed by trituration and filtration in growth medium. The growth medium consisted of Eagle’s minimum essential medium (MEM) supplemented with 2 mM glutamine, 100 U/ml penicillin, 100 μg/ml streptomycin, 10% heat-inactivated horse serum (all components from Invitrogen) and freshly-prepared 5% E11 chick embryo extract (MEMHS/CEE). For Ca2+ imaging, triturated samples were plated in MEMHS/CEE on 12 mm diameter glass coverslips or on 35 mm glass-bottom WillCo-dishes (BioSoft International) that were pre-coated with 100-300 KdA poly-d-lysine hydrobromide (1 mg/ml, Sigma P1149) and Collagen (0.1%, Gibco A-10483). For RNA extraction, triturated samples were plated at high-density (>100 × 103/ml) in identically pre-coated 25 mm diameter plastic tissue culture wells. Cultures were maintained in 95% air/5% CO2 at 37°C for 4–7 days and MEMHS/CEE was replenished every 2–3 days. In cultures used for RNA extraction MEMHS/CEE was supplemented cytosine arabinoside (ARA-C, 5–10 μM) added 2–3 days after plating to inhibit proliferation of rapidly dividing non-muscle cells.

Whole Iris Photostimulation and Data Analysis

Light was applied to iris preparations from a Xenon source (Zeiss 75W) filtered through 360 nm longpass and 550 nm shortpass filters (ET360lp, #NC548428 Chroma and Techspec SP, #84-708 Edmund Optics). The resulting broadband 360 to 550 nm violet-blue-cyan light was focused through a 30 mm condenser lens and applied via a 1.5 mm core optical fiber cable (Condenser ACL3026-A, and cable 1500UMT 0.39 NA; Thorlabs). Light power was measured using a photodiode sensor (200–1100 nm, 50 mW, 9.5 mm diameter) and optical power meter (Thorlabs S120VC and PM100D) and had a median irradiance value of 25 mW cm–2 for the 360 to 550 nm filtered light, similar to that used previously to evoke the PMTR in chick iris (35 mW cm–2, for 350 to 590 nm light) (Tu, 2004). For controls, 525 nm orange light (25–35 mW cm–2) was applied using a longpass filter (#84-744 Edmund Optics). Preparations were viewed at 12X with a Wild dissecting microscope and digital images acquired (usually at 1Hz for 25–60 s) using a cooled CCD camera (Retiga 1434, Q-Imaging) controlled by IP Lab 4.0 (Scanalytics Software; Reading PA). PMTRs were quantified offline from iris sphincter open areas measured at each time point using macros written for Image J (v 1.45s). Iris responses to pharmacological stimulation were obtained in red light, but acquired and analyzed in a similar fashion.

Myotube Photosensitivity, Photostimulation and Data Analysis

Myotube photosensitivity was assessed by imaging changes in [Ca2+]in using the Ca2+ indicator Rhod-2 (Molecular Probes, 80% maximal excitation at 540 nm). After 4–6 days myotube cultures were loaded with 2–5 μM Rhod-2-AM in RS at 22°C for 30–45 min, washed, dark-adapted for 15–20 min and examined in RS using a Zeiss 200M inverted microscope equipped with a HBO 100 Mercury Arc light source and a Zeiss Plan-Neofluar 40X/0.75NA objective. To achieve simultaneous, non-overlapping PMTR activation and Rhod-2 excitation/emission in myotubes, light was applied via a dual wavelength excitation filter (435/10x nm and 535/10x nm excitation; Chroma 59033X). The dual wavelength light was attenuated using a 1.0 OD neutral density (ND) filter and applied to myotubes via the 40X objective. In a previous report, peak PMTRs were achieved in chick iris using 430 nm light delivered at irradiances of 7–14 mW cm–2 (corresponding to photon flux values of 1.5–3.0 × 1016 photons s–1cm–2) and undetectable using 530 to 550 nm light at the same fluxes (Tu, 2004). After measuring the excitation irradiance and integrating the respective power outputs from the HBO light source applied through the 1.0 OD ND filter and the 40X objective, calculated photon flux values at the 435 and 535 nm wavelengths were similar (1.5 × 1016 and 1.8 × 1016 photons s–1 cm–2, respectively) with the 435 nm flux sufficient to activate PMTRs, and the 535 nm flux exciting Rhod-2 but causing minimal or no PMTR (Tu, 2004). In control experiments, a 545 nm single wavelength CY3/TRITC excitation filter (ET545/25x; Chroma 49004 ET) and 1.0 OD ND filter were used to deliver 545 nm light to Rhod-2 loaded myotubes at ≈3 × 1016 photons s–1 cm–2.

Light was applied to fields containing segments of 1–3 myotubes for 25–90 s and time-lapse images were simultaneously acquired at 1–2 Hz for exposure times of 50–200 ms. Camera, exposure, and light stimuli timing were controlled by IP Lab 4.0 (Scanalytics Software; Reading, PA). Changes in [Ca2+]in were assessed off-line from the acquired image stacks using custom macros written for Image-J (v 1.45s) to determine at each time the average fluorescence intensity within a region of interest (ROI) circumscribing the myotube perimeter (Ft) and the associated average background fluorescence intensity (FB,t). For each time point ΔF (Ft − FB,t) was normalized to FB,t to obtain the net fluorescence intensity relative to background (ΔF/FB). In some cases, light induced concentric myotube contractions were assessed in the same image stacks by measuring the distance between two fluorescent spots (usually nuclei) along the longitudinal axis of the resting and contracted myotube.

In control experiments Ca2+ responses were induced in Rhod-2 loaded myotubes by AChR activation or membrane depolarization. To do so RS containing carbachol (CCh, 1 mM) or KCl (100 mM) was applied from blunt patch pipettes by pressure microperfusion (5 psi, 10 s) and myotube Ca2+ responses assessed using single wavelength 545 nm light.

Myotube nAChR and CRY Detection

nAChRs were detected by labeling live myotube cultures with Alexa Fluor 488 conjugated α-Bungarotoxin (AF488-αBgt, Molecular Probes). Coverslip cultures were equilibrated to room temperature (RT, 21°C) washed 3X in 0.1 M phosphate buffered saline (PBS) containing BSA (2 mg/ml), incubated with AF488-αBgt (1:250), followed by PBS washing, fixation in paraformaldehyde (2–4% in PBS, 20 min), PBS washing, and mounting (Fluoromount-G, Invitrogen) on glass slides. CRY proteins were detected by immunolabeling muscle cultures with anti-CRY1 or anti-CRY2 polyclonal antibodies (pAbs; Boster, PB9540 or PB9576, respectively) raised against synthetic N-terminal human CRY peptides. The human CRY peptide immunogens (CRY1: F153QTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK189 and CRY2: R171FQAIISRMELPKKPVGLVTSQQMESCRAE200) were 89 and 90% identical, respectively, to corresponding regions of Gallus CRY1 and CRY2. Coverslip cultures were equilibrated to RT, washed 3X in 0.1 M PBS, fixed in paraformaldehyde (2–4% in PBS, 20 min), permeablized in block solution (BS; 0.1 M Tris, 0.3% Triton X-100, 5% donkey serum), incubated in BS containing CRY1 or CRY2 pAb (5–10 μg/ml; 16 h, 4°C), washed, treated with AF546-conjugated donkey anti-rabbit IgG secondary antibody (4 μg/ml in BS, 1 h, RT) washed, in some cases treated with the nuclear marker 4′,6-diamidino-2-phenylindole (DAPI, 300 nM, 5 min) washed 3X in PBS and mounted as above. Labeled cultures were examined with epifluorescence optics using the same Zeiss 200M inverted microscope, and 40X objective as for photosensitivity measurements with filter sets appropriate for AF488 or AF546 detection (480/30 nm excitation, 535/40 nm emission Chroma 31001, or 545/25 nm excitation, 605/70 nm emission Chroma 49004 ET). To assess CRY localization in cytoplasm and nuclei, CRY/DAPI co-labeled cultures were examined using a Leica TCS SP5 laser scanning confocal microscope (Leica Microsystems, Bannockburn, IL, United States) equipped with conventional solid state and a Ti-sapphire tunable multi-photon laser (Coherent, Santa Clara, CA, United States). Images were acquired at 512 × 512 pixels with a 63X objective (NA 1.40) in 1 μm thick optical sections. Images were collected using a motorized galvanometer in sequential scan mode with laser power, gain and offset optimized to minimize saturation and avoid background. Nuclear DAPI labeling was excited with the multiphoton laser at 790 nm and emission at 400–483 nm, while AF546 CRY labeling was excited with the conventional laser at 488 nm (to minimize photobleaching) and emission detected at 554–605 nm.

Photopigment Transcript Detection and CRY Knockdown

Transcripts encoding chicken (Gallus gallus) melanopsin (OPN4) and CRY subtypes (OPN4M, OPN4X, CRY1, and CRY2) and the housekeeping protein, glyceraldehyde 3-phosphate dehydrogenase (GAPDH) were detected in E11 and 17 iris, E14 pectoral muscle, and (for CRY1, CRY2 and CRY4) in 4–7 days pectoral muscle cultures by reverse transcription-based polymerase chain reaction (RT-PCR). Total RNA was isolated from iris and pectoral muscle and cultures (RNAqueous-Micro kit, Ambion), treated with 0.1 U/μl DNase 1 (New England Biolabs) and quantified by spectrophotometry (NanoDrop 1000, Thermo Scientific). RNA was converted to cDNA in RT reactions containing 2.5 U/μl MultiScribe reverse transcriptase and 2.0 U/μl RNAse inhibitor (2 h at 37°C, followed by 5 min at 85°C, both enzymes from Applied Biosystems). The cDNA templates were amplified in reactions containing 0.08 U/μl Platinum Taq DNA Polymerase (Invitrogen), MgCl2 and relevant primer pairs listed below (0.05–0.10 μM for GAPDH set 1, 0.1–0.2 μM for OPN4X and OPN4M, and 0.1–0.2 μM for CRYs). The PCR products and DNA molecular weight markers (pGEM 75–2645 bp; Promega) were loaded on 1.5% agarose gels containing EtBr and separated by electrophoresis (70 V, 2 h). Images of EtBr stained products were visualized with UV light, acquired with a digital CCD camera (Kodak DC290), and bands identified using Kodak 1D software.

Gallus GAPDH (NM_204305.1)

  • Primer Set 1:

  • Forward: 5′-G589CCATCACAGCCACACAGAA608-3′

  • Reverse: 5′-A1037CCATCAAGTCCACAACACG1018-3′

  • PCR product Size: 449 bp

  • Primer Set 2:

  • Forward: 5′-C265ACGCCATCACTATCTTCCAGGA G288-3′

  • Reverse: 5′-C786AGGTCAACAACAGAGACATTGG G763-3′

  • PCR product Size: 522 bp

Gallus CRY1 (NM_204245.1)

  • Primer Set (Tu, 2004):

  • Forward: 5′-A1440ATGCCCCAGAGAGTGTCCAGAAG1463-3′

  • Reverse: 5′-C1740ACATGTCTGAACGCCAACTGTC1718 -3′

  • PCR product Size: 301 bp

Gallus CRY2 (NM_204244.1)

  • Primer Set (Tu, 2004):

  • Forward: 5′-G1399CCAAGTGCATCATTGGAGTGG1420 -3′

  • Reverse: 5′-C1684TTCAGTGCACAGCTCTTCTGCTC1661-3′

  • PCR product Size: 286 bp

Gallus CRY4 (XM_015298682.2)

  • Primer Set (Based on Wang et al., 2018)

  • Forward: 5′-G1801AGGAGGGGAGAGCGAAGG1819-3′

  • Reverse: 5′-A1963AGCTGCGGACTGACAGGCA1944-3′

  • PCR product Size: 163 bp

Gallus OPN4m (NM_001044653.1)

  • Primer Set (Verra et al., 2011):

  • Forward: 5′-T1710CTCGCCGTAGAACATCC1727-3′

  • Reverse: 5′-G1954AAGTGTTTCAGAGCAAGGTAGGA1931-3′

  • PCR product Size: 245 bp

Gallus OPN4x (GenBank AY036061.1)

To achieve CRY knockdown, three CRY1 and three CRY2 antisense oligonucleotides (ASOs) with 2′-deoxy-2′-fluoro-beta-D-arabinose sugar (FANA) modifications were synthesized (21 nt each, AUM BioTech) and assessed for their ability to knock down CRY1 or CRY2 transcripts. In this case 2–3 days pectoral muscle cultures were switched to MEMHS/CEE containing 5–10 μM ARA-C, with or without 2–5 μM CRY1 or CRY2 ASO for 24–48 h, and RNA isolation and RT conducted as above. For quantification, PCR conditions were optimized to ensure sub-saturating product amplification of both GAPDH and CRY products in the same reactions (Marone et al., 2001). Optimization involved using cDNA templates derived from 100 to 150 ng RNA, using GAPDH primers (set 2) at 0.1 μM, and MgCl2 at 2 mM, and adjusting thermocycler parameters for CRY1 and CRY2 to 5 min at 95°C followed by 24–26 cycles of 45 s at 95°C, 45 s at 65°C and 1 min at 72°C, and for CRY4 to 3 min at 95°C followed by 30 cycles of 60 s at 95°C, 75 s at 68°C and 45 s at 72°C. Knockdown efficiency (EKD) was evaluated using Kodak 1D analysis software by comparing EtBR-fluorescence intensity in ROIs drawn around CRY product bands (FC,ROI) minus background intensity from an equivalent ROI (FB) divided by FB (ΔFC/FB = (FC,ROI−FB)/FB) relative to a similarly calculated value for the GAPDH product band (ΔFG/FB). To determine the effect of CRY knockdown on PMT in myotubes from iris or pectoral muscle cultures, MEMHS/CEE containing CRY1 and CRY2 ASOs that maximally reduced transcripts, or a scrambled oligonucleotide (2–5 μM each) were applied to 4–5 days iris or pectoral muscle cultures for 24–48 h. Oligonucleotide-treated and control cultures were then washed, loaded with Rhod-2, and myotubes assayed for PMTRs using dual excitation 435 and 535 nm wavelength light stimulation as described above. We assume that ASO efficacy is unaffected by the minor differences in culture conditions employed for RNA versus functional analyses. In control experiments, single excitation 545 nm wavelength light stimulation was used to compare Rhod-2 Ca2+ responses to membrane depolarization (achieved by focal application of 100 mM KCl) in control and ASO-treated muscle fibers.

Statistics

Parameter values are expressed as mean ± SEM, followed by the number of irises or myotubes tested (n) and, for myotube cultures by the number (N) of individually cultured coverslips. Values obtained following drug treatments are presented relative to those obtained for sham-treated controls from the same day or culture (1.00) such that a fold-change value of 0.5 indicates a 50% decrease. Statistical comparisons were made using Prism software (v 5.0d GraphPad, La Jolla, CA, United States). Statistical significance was assessed using Students unpaired, two-tailed t-test with criterion cutoff at p < 0.05 following Welch’s correction for unequal variances, when necessary. Asterisks () in figures indicate a significant difference (assessed by p < 0.05) between n values for test and control measurements.

Results

Iris PMT Is Generated by Striated Muscle

Broadband violet-blue-cyan light (360 < λ < 550 nm @ 25 mW cm–2) induced PMTRs in embryonic day 14.5–18 (E14.5-18) chick irises, featuring ≈50% constriction of pupillary open area within 25 s (Figures 1A,B). While the iris preparations contain sphincter and dilator muscles as well as pigment epithelium (PE) PMTRs arose specifically from sphincter muscle because identical responses were obtained in preparations after removing the PE or when connections to the dilator were damaged (latter not shown). Consistent with previous action spectrum studies indicating PMTR specificity for 430 nm light (Tu, 2004) filtered orange light (λ > 525 nm, 25–35 mW cm–2) failed to evoke pupil constriction, and neither light stimulus paradigms detectably changed recording solution (RS) temperature. To explore the PMTR dependence on sphincter muscle fiber type, irises were isolated at developmental stages corresponding to the presence of smooth and striated muscle fibers, respectively (Yamashita and Sohal, 1986). The largest PMTRs occurred at stages when irises contain mostly striated muscle fibers (Figures 1C,D). Photomechanical responses to 360 < λ < 550 nm light were barely distinguishable in irises isolated at E8, then rose to plateau values of ≈30% constriction at E10-12.5, stages when only smooth muscle fibers are present (Yamashita and Sohal, 1986). After E13, PMTRs rose to a second plateau with 40–50% pupil constriction observed between E14.5-18, times associated with the appearance and predominance of striated over smooth muscle fibers (80 versus 20% by E21) (Yamashita and Sohal, 1986). Finding that chick iris PMT does not require PE and correlates with the developmental appearance and predominance of striated muscle supports the view that it is triggered by a light sensor in striated sphincter muscle. In addition, the requirement for 360 < λ < 550 nm light seen here at E14.5-18 is consistent with previous studies implicating CRYs as the photosensitive molecules underlying PMT in E15 irises (Tu, 2004).

FIGURE 1

Because mRNA transcripts encoding OPN4 and CRY proteins are expressed in chick iris (Figure 2A) pharmacological tests were performed to further assess their respective relevance to iris PMT. AA92593 is a small molecule inhibitor of Homo sapiens OPN4-mediated phototransduction that acts by competing with chromophore (i.e. retinoid) binding (Jones et al., 2013). AA92593 has not been tested as a melanopsin antagonist in other species, but it is expected to also recognize chicken (Gallus) OPN4s. Specifically, OPN4s from Homo sapiens, Gallus (and Xenopus) share 90% identity in transmembrane segment 7 (TM7) including a conserved Lys residue therein that acts as a site for Schiff base retinoid linkage (Wang et al., 1980) as well as 77% identity in TM3 including a conserved aromatic Tyr residue believed to stabilize retinoid binding (Provencio et al., 1998). Consistent with previous work showing that PMTRs persisted after either retinoid depletion or siRNA-mediated OPN4 transcript knock down (Tu, 2004) AA92593 failed to reduce chick iris PMTRs (Figure 2B). By contrast, interfering with CRY-FAD signaling by inhibiting flavin-specific reduction with diphenyleneiodonium (DPI) or by simulating FAD oxidation with H2O2 significantly reduced PMTRs (Figure 2B). While redox interference can affect other cellular functions, DPI has been used previously to inhibit light-induced CRY-FAD signaling in Drosophila (Fogle et al., 2011) and reoxidation is thought to promote the CRY-associated FAD resting state (van Wilderen et al., 2015). These latter findings are also consistent with previous results, which showed that siRNA-mediated CRY1 and CRY2 transcript knockdown reduced PMTRs (Tu, 2004). Thus the pharmacological tests with AA92593, DPI and H2O2 provide additional evidence that, at developmental stages associated with striated sphincter muscle predominance, the chick iris PMTR requires CRYs whereas OPN4s appear dispensable.

FIGURE 2

Possible downstream targets were next probed to determine how CRYs generate PMT in chick iris. Na+ channel activation was not required since iris PMTRs were unaffected by incubation with tetrodotoxin (data not shown and Tu, 2004; Xue et al., 2011). Also dispensable were nicotinic and muscarinic acetylcholine receptors (nAChRs and mAChRs) that are present on striated iris sphincter muscle fibers and underlie nerve-evoked iris constriction (Pilar et al., 1987). Their possible activation (e.g. by light evoked ACh release from presynaptic terminals) was also not required for PMT because light-evoked iris area constrictions obtained during 15–30 min incubations in RS containing (ATR, 1 μM) and 100 μM d-tubocurarine (dTC, 100 μM), competitive inhibitors of the respective AChR classes, were indistinguishable from controls tested in parallel (47 ± 5%, n = 13 versus 52 ± 2%, n = 22). The ATR/dTC inhibitor cocktail was effective, however, in inhibiting AChRs; identical treatments reduced iris constrictions induced by perfusion with the pan-specific AChR agonist Carbachol (CCh; 1 mM) by 72 ± 6% relative to untreated controls (n = 6 each). Consistent with the importance of Ca2+ dynamics in muscle contraction (Kuo and Ehrlich, 2015) both extracellular Ca2+ influx and Ca2+ release from intracellular stores were involved in generating chick iris PMT (Figure 2C). Extracellular Ca2+ was required because light-evoked iris area constriction was reduced by >90% when irises were tested in extracellular RS containing 0 Ca and 2 mM EGTA. In Drosophila arousal neurons, CRY signaling couples to membrane depolarization leading to an increased rate of action potential firing (Fogle et al., 2011, 2015). Consistent with CRY signaling coupling to Ca2+ influx via membrane depolarization, light induced pupil constrictions were reduced by 45% in irises tested in RS containing Cd2+, a generic inhibitor of voltage- (i.e. depolarization-) gated Ca2+ channels (VGCC) (Swandulla and Armstrong, 1989). In skeletal muscle, VGCC mediated Ca2+ influx triggers Ca2+ release from intracellular sarcoplasmic reticulum (SR) stores, thereby allowing Ca2+ to activate the contractile apparatus (Endo, 2009; Kuo and Ehrlich, 2015). In accord with previous findings (Tu, 2004) chick iris PMT also requires Ca2+ release from intracellular sarco/endoplasmic stores because incubation in RS containing Thapsigargin (TG) to block the sarco/endoplasmic Ca2+-ATPase (SERCA) pump and deplete Ca2+, reduced PMTRs by 55%. Contrasting with the requirement for PLC and subsequent IP3-receptor mediated Ca2+ release implicated in mammalian smooth muscle iris (Xue et al., 2011) IP3-receptor inhibition with 2-Aminoethoxydiphenyl borate (2-APB) or Xestospongin-C (XeC) had little or no significant effect on the striated muscle mediated PMTR in chick iris. Consistent with the regulation of skeletal muscle SR stores by Ryanodine receptors (RyRs), however, Ryanodine reduced the PMTR by 42%. Taken together, these findings indicate that 360 < λ < 550 nm light activates CRY signaling to trigger PMT in chick iris striated sphincter muscle by a process involving VGCC mediated Ca2+ influx causing Ca2+ release from RyR regulated SR stores to initiate muscle contraction.

PMT in Myotubes

Cell culture, photo-stimulation and Ca2+ imaging approaches were developed to reveal the cellular basis and mechanisms underlying PMTRs. Multinucleated myotubes, resulting from myoblast fusion, first appeared in dissociated cell cultures prepared from E13-14 irises after 3–4 days. Iris myotubes displayed the long cylindrical shape and diffuse expression pattern of nAChR puncta characteristic of chick striated muscle fibers (Vogel et al., 1972; Figure 3A). Consistent with the expression of CRY1 and CRY2 transcripts in chick iris and in accord with the action spectrum for its peak CRY-dependent response (Figure 3A) and (Tu, 2004) 435 nm excitation light evoked PMTRs in single iris myotubes (Figures 3B–D). After loading with the fluorescent Ca2+ indicator Rhod-2, nearly all myotubes responded to dual excitation 435 and 535 nm (435/535 nm) light, respectively exciting CRY and Rhod-2 with increases in peak Ca2+ ΔF/FB of 49 ± 9% that were accompanied by concentric contractions (12 ± 7% shortening) in 5 of the 16 responsive myotubes. The observation that a minor fraction of Ca2+ responsive myotubes displayed contractions was correlated with their intermittently loose attachment to the collagen/poly-d-lysine substrate, thereby allowing visual detection of fiber shortening. Presumably this method was insufficient for more reliable contraction detection because in most cases myotubes were uniformly adhered to the substrate. Consistent with CRY activation, the iris myotube PMT required 435 nm light excitation because application of single wavelength 545 nm green light, appropriate for Rhod-2 excitation alone, failed to increase myotube Ca2+ fluorescence or induce contractions. These results demonstrate that whole iris PMT is recapitulated in its striated muscle derived myotubes. They further indicate that iris muscle fibers contain a light sensor that, by extension, likely underlies PMT in the whole tissue.

FIGURE 3

In order to determine if iris myotube PMT is confined to iris muscle, identical tests were performed using myotube cultures derived from pectoral muscle (Figure 4). Like those from iris, pectoral myotubes had the shape and nAChR distribution pattern characteristic of striated muscle fibers (Figure 4A1). In addition, when viewed with epifluorescence optics pectoral myotubes expressed specific cytosolic CRY1 and CRY2 immunolabeling (Figures 4A2–4) and similar results were obtained for myotubes from iris muscle cultures (data not shown). Confocal images acquired from iris and pectoral muscle cultures co-labeled with anti-CRY pAbs and DAPI (to identify muscle nuclei) confirmed extensive CRY1 and CRY2 cytosolic localization in myotubes with little or no CRY localization detectable in their nuclei (Figures 4B1–4). Because cytosolic CRYs have been linked to light sensitivity in avians (Mouritsen et al., 2004; Wang et al., 2018) it was expected that pectoral myotubes would also exhibit intrinsic photosensitivity. In accord with this expectation, 435/535 nm dual excitation light evoked PMT in pectoral myotubes (Figures 4C,D) featuring peak increases in Ca2+ ΔF/FB that were even larger than those from iris myotubes (140 ± 14% versus 49 ± 9%, respectively, p < 0.05) while displaying a similar degree and incidence of contractions (11 ± 2% shortening, in 20 of 74 myotubes). As with iris striated myotubes, application of single wavelength 545 nm green light appropriate for Rhod-2 excitation alone failed to increase Ca2+ fluorescence or induce contractions in pectoral myotubes. Pharmacological tests were conducted to elucidate mechanisms underlying pectoral myotube PMT (Figure 4E). As with whole irises, peak Ca2+ ΔF/FB increases to dual excitation wavelength 435/535 nm light were not significantly different in pectoral myotubes where AChRs were inhibited with the ATR/dTC cocktail (124 ± 23%) compared to controls (88 ± 24%), but were dramatically reduced (by 95%) after blocking Ca2+ influx with Cd2+. In control experiments using single wavelength 545 nm light, the ATR/dTC cocktail blocked myotube Ca2+ responses to AChR activation induced by focal application of RS containing carbachol (CCh, 1 mM) and Cd2+ blocked Ca2+ responses induced by application of RS containing elevated K+ to trigger depolarization-induced Ca2+ entry (data not shown). Similar to whole iris, the pectoral myotube PMTR required mobilization of intracellular Ca2+ from a SR store because responses to dual excitation wavelength 435/535 nm light were blocked or reduced by 85% following incubations with Thapsigargin or Ryanodine, respectively, relative to untreated controls. These findings demonstrate that like iris (Figure 1) pectoral myotubes display AChR-independent PMT involving release of intracellular Ca2+ initiated by 435 nm light-driven Ca2+ influx and subsequent Ca2+ release from a Ryanodine sensitive intracellular SR store. These results further indicate that cell autonomous PMT involving canonical mechanisms of Ca2+ mobilization is a general feature of developing striated muscle.

FIGURE 4

Cryptochromes 1 and 2 Mediate Myotube PMT

A cryptochrome requirement for PMT in iris and pectoral myotubes was assessed using synthetic FANA modified ASOs (AUM BioTech, 21 nt each) to knock down CRY1 and CRY2 gene transcripts (Figure 5). Myotubes in cultures incubated with any one of the six CRY ASOs tested (5 μM; 24–48 h) were visually indistinguishable from controls indicating the CRY ASOs did not grossly affect the survival of differentiated myotubes. CRY1 and CRY2 primers were used to amplify products by PCR using equivalent amounts of cDNA templates derived from control and ASO-treated pectoral myotube cultures. Semi-quantitative assessment of CRY relative to GAPDH PCR amplification products revealed no effect on CRY transcripts with four of the six ASOs tested (data not shown) while two, CRY1 ASO 1.3 and CRY2 ASO 2.3, dramatically reduced CRY1 and CRY2 transcripts by 87 ± 6% (N = 4 experiments) and 91 ± 5% (N = 3 experiments) respectively, compared to CRY transcript levels in untreated controls (Figures 5A,B). Since avian CRY4 binds FAD, is expressed in striated muscle, and plays a light-dependent role in magnetoreception (Kubo et al., 2006; Watari et al., 2012; Wang et al., 2018) the possibility that CRY1 ASO 1.3 or CRY2 ASO 2.3 might knock down CRY4 transcripts and thereby reduce PMTRs was tested by amplifying CRY4 from cDNA templates derived from the same control and ASO treated cultures. This possibility seemed unlikely because Gallus mRNAs encoding CRYs 1 and 2 respectively have only 39 and 36% identity with CRY4 mRNA, and because neither CRY1 ASO 1.3 nor CRY2 ASO 2.3 is predicted to bind to corresponding sites on CRY4. In accord with this expectation, neither ASO 1.3 nor 2.3 treatments decreased the degree of CRY4 transcripts relative to untreated controls; instead there was a 20–30% increase in CRY4 transcripts apparent in two experiments (Figure 5C).

FIGURE 5

The functional consequences of the observed knockdown in CRY1 and CRY2 gene transcripts on PMT was next tested using Rhod-2 loaded myotubes from pectoral and iris sphincter muscle cultures as in Figures 3, 4. Because maximal reduction of whole iris PMTRs required knockdown of both CRY1 and CRY2 transcripts (Tu, 2004) pectoral and iris myotube cultures were treated with both CRY1 ASO 1.3 and CRY2 ASO 2.3 (2–5 μM; 24–48 h). In nearly all ASO treated myotubes, dual excitation wavelength 435/535 nm light induced slow decreases in Ca2+ ΔF/FB, contrasting with the increases typical of untreated control myotubes, including those tested in parallel (Figures 5D–F). The loss of PMT following CRY ASO treatment was specific in the sense that PMTRs persisted after treatment with a 21-nt scrambled FANA-modified oligonucleotide (SO). Here, dual excitation 435/535 nm light induced peak increases in Ca2+ ΔF/FB that were indistinguishable between SO treated pectoral myotubes (128 ± 6%, n = 6, N = 2) and untreated controls (129 ± 24%, n = 12, N = 3) (Figure 5G, left). While the CRY ASO 1.3 and 2.3 treatment blocked subsequent myotube PMT, the downstream transduction machinery involving membrane depolarization-triggered Ca2+ elevation was unaffected. Thus, when pectoral myotubes from cultures treated with CRY ASOs 1.3 and 2.3 were observed using single wavelength 545 nm light they displayed robust increases in Ca2+ ΔF/FB in response to focal application of RS containing elevated K+ (464 ± 151%, n = 5, N = 2) that were indistinguishable from those of untreated controls (522 ± 192%, n = 11, N = 2) including those tested in parallel (Figure 5G, right). These results extend the idea that CRYs mediate PMT in chick iris (Tu, 2004; Figure 3) by identifying CRYs selectively expressed in iris sphincter muscle cells as relevant photosensitive molecules. Because CRYs are also expressed in and responsible for PMT in somatic pectoral myotubes, the results further indicate that developing striated muscle fibers, in general, respond to 435 nm light through CRY photoactivation thereby eliciting PMT via downstream canonical mechanisms of Ca2+ influx and CICR from a ryanodine sensitive SR store.

Discussion

Initially based on identifying the cells and mechanisms underlying CRY-mediated PMT in Gallus iris, these studies reveal that similar CRY-dependent signaling and transduction mechanisms occur in somatic muscle. The correlation of embryonic iris light response size with muscle type appearance (Figure 1) later confirmed in culture (Figure 3) support the conclusion that developing iris striated muscle fibers contain a PMT-relevant light sensor. Circadian OPN4 and CRY proteins have both been implicated as photo-sensitive proteins relevant to PMT (Tu, 2004; Xue et al., 2011). In amphibian and mammalian smooth muscle irises PMT requires OPN4 (Barr, 1989; Xue et al., 2011; Wang et al., 2017) but its cellular origin remains somewhat unclear. While PMT is linked functionally to smooth iris sphincter muscle in mouse, only a tiny fraction (<10%) of iris smooth muscle fibers from OPN4-Cre;Rosa-Alkaline Phosphatase or OPN4-Cre-Rosa-tdTomato reporter mice were identified as OPN4 positive, and OPN4 immunoreactivity was undetectable in smooth muscle fibers even though it was present in the sphincter muscle region (Wang et al., 2017). Although RNA transcripts encoding both OPN4 and CRY subtypes were detected in chick iris, our pharmacological findings support earlier results (Tu, 2004) that CRYs alone are required for chick iris PMT (Figure 2). The expression of OPN4 transcripts in chick iris suggests melanopsin may be expressed in smooth muscle or other cell components and contribute to the weak PMT seen at early stages of development or to processes unrelated to PMT at later stages.

Myotubes cultured from chick iris sphincter or pectoral muscle generated similar cellular PMTRs (Figures 3, 4) suggesting that canonical mechanisms of striated muscle contraction are recruited for iris PMT. In iris and myotubes these mechanisms involved extracellular Ca2+ influx and CICR from a SR, ryanodine-sensitive intracellular store. Our results support the view that VGCCs responding to membrane depolarization provide a pathway for Ca2+ influx in both cases. This conclusion is based on the observation that the VGCC inhibitor Cd2+ reduced and blocked PMTRs in iris and myotubes, respectively (Figures 2, 4), and that Cd2+ blocked myotube responses to membrane depolarization induced by application of elevated K+. CRY signaling could induce membrane depolarization via co-modulation of a cytoplasmic K+ channel redox sensor β-subunit (KVβ) as has been proposed for phototransduction in Drosophila arousal neurons (Fogle et al., 2011, 2015). Although KVβ subunits are expressed in muscle (Grande et al., 2003) and circadian redox reactions are implicated in regulating excitability (Bothwell and Gillette, 2018) it is not known if similar mechanisms apply for myotube PMT. Other Ca2+-permeable plasma membrane channels may also be recruited for PMTRs in iris and striated myotubes. Results with dTC rule out a contribution from nAChRs, and while transient receptor potential channels, implicated in mammalian iris OPN4-mediated PMT (Xue et al., 2011) are plausible candidates, their contributions were not tested. Neither extracellular Ca2+ nor membrane depolarization are required for PMT in frog (smooth muscle) iris where GPCR activation of PLC is thought to cause subsequent IP3 mediated Ca2+ release from SR (Barr and Alpern, 1963; Kargacin and Detwiler, 1985; Barr, 1989). For PMT in chick iris and striated myotubes, Ca2+ influx induced Ca2+ release (CICR) over PLC/IP3- mediated signaling seems more likely because CICR is the canonical route for Ca2+ release in striated muscle (Endo, 2009) and because the IP3 inhibitors tested had marginal (2-APB) or no effect (XeC) on chick iris PMT. In accord with results from other species tested, PMT in chick iris and myotubes requires Ca2+ release from an intracellular SR store as indicated by the ability of Thapsigargin to reduce iris PMTRs and Ryanodine to inhibit PMTRs in iris and block them in myotubes (Figures 3, 5).

Our results reveal a clear requirement for CRYs in mediating PMT in embryonic iris and pectoral Gallus muscle (see below) despite the classification of vertebrate, including avian, CRYs as light-insensitive Type II. Classifying vertebrate CRYs as Type II because their real or theoretical interaction with FAD chromophore predicts light-insensitivity is problematic because experiments to do so have drawn mixed conclusions. On the one hand, while results obtained with CRYs isolated from mammalian cells or expressed in heterologous systems are consistent with some FAD binding, the extent appears small (Hoang et al., 2008; Vieira et al., 2012; Xing et al., 2013) and a recent computational/experimental study suggests vertebrate CRYs express amino acids different from those at positions that confer FAD binding in Type I CRYs (Kutta et al., 2017). However, experimental conditions can influence FAD binding (Özgür and Sancar, 2003) and more flexible requirements may prevail for CRY-FAD interactions to produce phototransduction. Noteworthy here is that expression of a human (Type II) CRY transgene in Type I CRY-deficient Drosophila rescues light-dependent magnetosensitivity (Foley et al., 2011) that both human and Drosophila CRYs expressed in Sf21 cells display photo-conversion in response to blue light (Hoang et al., 2008) and that an avian CRY (CRY4) binds FAD and plays a light-dependent role in magnetoreception (Kubo et al., 2006; Watari et al., 2012; Wang et al., 2018).

Avian CRY1 and CRY2 have structural features consistent with light-sensitivity. Multiple sequence alignment (ClustalW, v1.83) reveals that they share 14 of the 17 amino acids with CRY4 at sites implicated in FAD binding as well as a triad of tryptophans believed to facilitate light-activated intramolecular electron transfer (Kubo et al., 2006; Kutta et al., 2017). Their light-sensitivity was demonstrated here by showing that PMTRs induced by 435 nm light in iris sphincter and pectoral striated myotubes were blocked after knocking down CRY1 and CRY2 transcripts (Figure 5) consistent with observations drawn from pharmacological studies in whole iris (Figure 2). Two ASOs each reduced CRY1 or CRY2 gene transcripts by ≈90%, without reducing CRY4 transcripts, and their combined application blocked PMT in iris and pectoral myotubes, doing so without affecting Ca2+ mobilization induced by membrane depolarization. While prior studies using siRNAs suggested that CRY1 and CRY2 additively support whole iris PMT (Tu, 2004) the possibility that the two subtypes have differential actions on myotube PMT was not tested. Because avian cytosolic CRYs are linked to light sensitivity (Mouritsen et al., 2004; Wang et al., 2018) the localization of CRY1 and CRY2 to iris and pectoral myotube cytosol (Figure 4) further supports their role in PMT. Taken together our results are consistent with a scheme where photoactivation of cytosolic CRY stimulates canonical mechanisms of contraction in developing striated muscle via muscle membrane depolarization (possibly by K+ channel modulation) and subsequent influx of extracellular Ca2+ (likely via VGCCs and possibly other Ca2+ permeable channels) thereby inducing Ca2+ induced Ca2+ release from a RyR controlled SR store to allow actin-myosin filament interaction.

Our findings further reveal that Gallus CRY-mediated PMT, rather than being confined to the iris, is a general feature shared by developing avian striated muscle. Might this CRY- and light-dependent PMT be related to widespread CRY dependent transcriptional control of circadian metabolic processes? While scant clues are available, knowing if light generates CRY-mediated Ca2+ mobilization in striated muscle from other species and/or in other cell types may provide useful insights. Given the developmentally transient PMT in developing Gallus iris shown here and elsewhere to be CRY-mediated (Meriney and Pilar, 1987; Pilar et al., 1987; Tu, 2004) some crossover functions seem likely since CRY2 and CRY associated redox rhythms have recently been implicated in myogenesis (Grande et al., 2003; Bothwell and Gillette, 2018; Lowe et al., 2018). In this regard it would be useful to know if altering CRY expression and light exposure in myoblasts influences their subsequent differentiation.

Statements

Data availability statement

The datasets generated for this study are available on request to the corresponding author.

Author contributions

JM conducted most experiments, analyzed and interpreted all results, and prepared the manuscript. MH acquired confocal images, consulted on approaches and result interpretation, and participated in manuscript revisions.

Funding

Support was provided to JM by NSF (Grant # 0951549) and by University of Toledo Research Innovation Award, and to MH by a University of Toledo Research Incentive Award.

Acknowledgments

Three University of Toledo Medical students (Alexandra Sutula, Stephen Werner-Sleva, and Bret Gustafson) participated in early aspects of the work. Ms. Samantha J. McKee provided technical assistance for some experiments.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  • 1

    BarrL. (1989). Photomechanical coupling in the vertebrate sphincter pupillae.Crit. Rev. Neurobiol.4325366.

  • 2

    BarrL.AlpernM. (1963). Photosensitivity of the frog Iris.J. Gen. Physiolm.4612491265. 10.1085/jgp.46.6.1249

  • 3

    BothwellM. Y.GilletteM. U. (2018). Circadian redox rhythms in the regulation of neuronal excitability.Free Radic. Biol. Med.1194555. 10.1016/j.freeradbiomed.2018.01.025

  • 4

    BuhrE. D.TakahashiJ. S. (2013). Molecular components of the Mammalian circadian clock.Handb. Exp. Pharmacol.217327. 10.1007/978-3-642-25950-0_1

  • 5

    BuszaA.Emery-LeM.RosbashM.EmeryP. (2004). Roles of the two Drosophila CRYPTOCHROME structural domains in circadian photoreception.Science30415031506. 10.1126/science.1096973

  • 6

    CashmoreA. R. (2003). Cryptochromes: enabling plants and animals to determine circadian time.Cell114537543.

  • 7

    ChaurasiaS. S.RollagM. D.JiangG.HayesW. P.HaqueR.NatesanA.et al (2005). Molecular cloning, localization and circadian expression of chicken melanopsin (Opn4): differential regulation of expression in pineal and retinal cell types.J. Neurochem.92158170. 10.1111/j.1471-4159.2004.02874.x

  • 8

    EndoM. (2009). Calcium-Induced calcium release in skeletal muscle.Physiol. Rev.8911531176. 10.1152/physrev.00040.2008

  • 9

    FogleK. J.BaikL. S.HoulJ. H.TranT. T.RobertsL.DahmN. A.et al (2015). CRYPTOCHROME-mediated phototransduction by modulation of the potassium ion channel β-subunit redox sensor.Proc. Natl. Acad. Sci. U.S.A.11222452250. 10.1073/pnas.1416586112

  • 10

    FogleK. J.ParsonK. G.DahmN. A.HolmesT. C. (2011). Cryptochrome is a blue-light sensor that regulates neuronal firing rate.Science33114091413. 10.1126/science.1199702

  • 11

    FoleyL. E.GegearR. J.ReppertS. M. (2011). Human cryptochrome exhibits light-dependent magnetosensitivity.Nat. Commun.2:356. 10.1038/ncomms1364

  • 12

    GegearR. J.CasselmanA.WaddellS.ReppertS. M. (2008). Cryptochrome mediates light-dependent magnetosensitivity in Drosophila.Nature45410141018. 10.1038/nature07183

  • 13

    GrandeM.SuàrezE.VicenteR.CantóC.ComaM.TamkunM. M.et al (2003). Voltage-dependent K+ channel β subunits in muscle: differential regulation during postnatal development and myogenesis.J. Cell. Physiol.195187193. 10.1002/jcp.10203

  • 14

    GriffinE. A.StaknisD.WeitzC. J. (1999). Light-independent role of CRY1 and CRY2 in the mammalian circadian clock.Science286768771. 10.1126/science.286.5440.768

  • 15

    HamburgerV.HamiltonH. L. (1951). A series of normal stages in the development of the chick embryo.J. Morphol.884992. 10.1002/jmor.1050880104

  • 16

    HoangN.SchleicherE.KacprzakS.BoulyJ.-P.PicotM.WuW.et al (2008). Human and Drosophila cryptochromes are light activated by flavin photoreduction in living cells.PLoS Biol.6:e160. 10.1371/journal.pbio.0060160

  • 17

    JonesK. A.HatoriM.MureL. S.BramleyJ. R.ArtymyshynR.HongS.-P.et al (2013). Small-molecule antagonists of melanopsin-mediated phototransduction.Nat. Chem. Biol.9630635. 10.1038/nchembio.1333

  • 18

    KargacinG. J.DetwilerP. B. (1985). Light-evoked contraction of the photosensitive iris of the frog.J. Neurosci.530813087. 10.1523/jneurosci.05-11-03081.1985

  • 19

    KuboY.AkiyamaM.FukadaY.OkanoT. (2006). Molecular cloning, mRNA expression, and immunocytochemical localization of a putative blue-light photoreceptor CRY4 in the chicken pineal gland.J. Neurochem.9711551165. 10.1111/j.1471-4159.2006.03826.x

  • 20

    KuoI. Y.EhrlichB. E. (2015). Signaling in muscle contraction.Cold Spring Harb. Perspect. Biol.7:a006023. 10.1101/cshperspect.a006023

  • 21

    KuttaR. J.ArchipowaN.JohannissenL. O.JonesA. R.ScruttonN. S. (2017). Vertebrate cryptochromes are vestigial flavoproteins.Sci. Rep.7:44906. 10.1038/srep44906

  • 22

    LoweM.LageJ.PaatelaE.MunsonD.HostagerR.YuanC.et al (2018). Cry2 Is Critical for Circadian regulation of myogenic differentiation by Bclaf1-mediated mRNA stabilization of cyclin D1 and Tmem176b.Cell Rep.2221182132. 10.1016/j.celrep.2018.01.077

  • 23

    LucasR. J.HattarS.TakaoM.BersonD. M.FosterR. G.YauK. W. (2003). Diminished pupillary light reflex at high irradiances in melanopsin-knockout mice.Science299245247. 10.1126/science.1077293

  • 24

    MaroneM.MozzettiS.De RitisD.PierelliL.ScambiaG. (2001). Semiquantitative RT-PCR analysis to assess the expression levels of multiple transcripts from the same sample.Biol. Proced. Online31925. 10.1251/bpo20

  • 25

    MerineyS. D.PilarG. (1987). Cholinergic innervation of the smooth muscle cells in the choroid coat of the chick eye and its development.J. Neurosci.738273839. 10.1523/jneurosci.07-12-03827.1987

  • 26

    MohawkJ. A.GreenC. B.TakahashiJ. S. (2012). Central and peripheral circadian clocks in mammals.Annu. Rev. Neurosci.35445462. 10.1146/annurev-neuro-060909-153128

  • 27

    MouritsenH.Janssen-BienholdU.LiedvogelM.FeendersG.StalleickenJ.DirksP.et al (2004). Cryptochromes and neuronal-activity markers colocalize in the retina of migratory birds during magnetic orientation.Proc. Natl. Acad. Sci. U.S.A.1011429414299. 10.1073/pnas.0405968101

  • 28

    ÖzgürS.SancarA. (2003). Purification and properties of human blue-light photoreceptor cryptochrome 2.Biochemistry4229262932. 10.1021/bi026963n

  • 29

    OztürkN.SongS.-H.SelbyC. P.SancarA. (2008). Animal type 1 cryptochromes. Analysis of the redox state of the flavin cofactor by site-directed mutagenesis.J. Biol. Chem.28332563263. 10.1074/jbc.m708612200

  • 30

    PaulK. N.SaafirT. B.TosiniG. (2009). The role of retinal photoreceptors in the regulation of circadian rhythms.Rev. Endocr. Metab. Disord.10271278. 10.1007/s11154-009-9120-x

  • 31

    PilarG.NunezR.McLennanI. S.MerineyS. D. (1987). Muscarinic and nicotinic synaptic activation of the developing chicken Iris.J. Neurosci.738133826. 10.1523/jneurosci.07-12-03813.1987

  • 32

    ProvencioI.JiangG.De GripW. J.HayesW. P.RollagM. D. (1998). Melanopsin: an opsin in melanophores, brain, and eye.Proc. Natl. Acad. Sci. U.S.A.95340345. 10.1073/pnas.95.1.340

  • 33

    SwandullaD.ArmstrongC. M. (1989). Calcium channel block by cadmium in chicken sensory neurons.Proc. Natl. Acad. Sci. U.S.A.8617361740. 10.1073/pnas.86.5.1736

  • 34

    TuD. C. (2004). Nonvisual photoreception in the chick iris.Science306124129.

  • 35

    van WilderenL. J. G. W.SilkstoneG.MasonM.van ThorJ. J.WilsonM. T. (2015). Kinetic studies on the oxidation of semiquinone and hydroquinone forms of Arabidopsis cryptochrome by molecular oxygen.FEBS Open Bio.5885892. 10.1016/j.fob.2015.10.007

  • 36

    VerraD. M.ContinM. A.HicksD.GuidoM. E. (2011). Early onset and differential temporospatial Expression of melanopsin isoforms in the developing chicken retina.Invest. Ophthalmol. Vis. Sci.5251115120. 10.1167/iovs.11-75301

  • 37

    VieiraJ.JonesA. R.DanonA.SakumaM.HoangN.RoblesD.et al (2012). Human cryptochrome-1 confers light independent biological activity in transgenic Drosophila correlated with flavin radical stability.PLoS One7:e31867. 10.1371/journal.pone.0031867

  • 38

    VogelZ.SytkowskiA. J.NirenbergM. W. (1972). Acetylcholine receptors of muscle grown in vitro.Proc. Natl. Acad. Sci. U.S.A.6931803184. 10.1073/pnas.69.11.3180

  • 39

    WangJ. K.McDowellJ. H.HargraveP. A. (1980). Site of attachment of 11-cis-retinal in bovine rhodopsin.Biochemistry1951115117. 10.1021/bi00563a027

  • 40

    WangQ.YueW. W. S.JiangZ.XueT.KangS. H.BerglesD. E.et al (2017). Synergistic signaling by light and acetylcholine in mouse iris sphincter muscle.Curr. Biol.271791.e51800.e5. 10.1016/j.cub.2017.05.022

  • 41

    WangX.JingC.SelbyC. P.ChiouY.-Y.YangY.WuW.et al (2018). Comparative properties and functions of type 2 and type 4 pigeon cryptochromes.Cell. Mol. Life Sci.7546294641. 10.1007/s00018-018-2920-y

  • 42

    WatariR.YamaguchiC.ZembaW.KuboY.OkanoK.OkanoT. (2012). Light-dependent structural change of chicken retinal Cryptochrome4.J. Biol. Chem.2874263442641. 10.1074/jbc.M112.395731

  • 43

    WelshD. K.TakahashiJ. S.KayS. A. (2010). Suprachiasmatic nucleus: cell autonomy and network properties.Annu. Rev. Physiol.72551577. 10.1146/annurev-physiol-021909-135919

  • 44

    XingW.BusinoL.HindsT. R.MarionniS. T.SaifeeN. H.BushM. F.et al (2013). SCF(FBXL3) ubiquitin ligase targets cryptochromes at their cofactor pocket.Nature4966468. 10.1038/nature11964

  • 45

    XueT.DoM. T. H.RiccioA.JiangZ.HsiehJ.WangH. C.et al (2011). Melanopsin signalling in mammalian iris and retina.Nature4796773. 10.1038/nature10567

  • 46

    YamashitaT.SohalG. S. (1986). Development of smooth and skeletal muscle cells in the iris of the domestic duck, chick and quail.Cell Tissue Res.244121131.

  • 47

    ZuckerR.NolteJ. (1978). Light-induced calcium release in a photosensitive vertebrate smooth muscle.Nature2747880. 10.1038/274078a0

Summary

Keywords

eye, iris, striated, muscle, light, cryptochrome, photomechanical, circadian

Citation

Margiotta JF and Howard MJ (2020) Cryptochromes Mediate Intrinsic Photomechanical Transduction in Avian Iris and Somatic Striated Muscle. Front. Physiol. 11:128. doi: 10.3389/fphys.2020.00128

Received

06 December 2019

Accepted

06 February 2020

Published

21 February 2020

Volume

11 - 2020

Edited by

P. Bryant Chase, Florida State University, United States

Reviewed by

Chentao Lin, University of California, Los Angeles, United States; Karyn Esser, University of Florida, United States; Qin Wang, Fujian Agriculture and Forestry University, China

Updates

Copyright

*Correspondence: Joseph F. Margiotta,

This article was submitted to Striated Muscle Physiology, a section of the journal Frontiers in Physiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics