Abstract
The giant protein titin performs structure-preserving functions in the sarcomere and is important for the passive stiffness (Fpassive) of cardiomyocytes. Protein kinase D (PKD) enzymes play crucial roles in regulating myocardial contraction, hypertrophy, and remodeling. PKD phosphorylates myofilament proteins, but it is not known whether the giant protein titin is also a PKD substrate. Here, we aimed to determine whether PKD phosphorylates titin and thereby modulates cardiomyocyte Fpassive in normal and failing myocardium. The phosphorylation of titin was assessed in cardiomyocyte-specific PKD knock-out mice (cKO) and human hearts using immunoblotting with a phosphoserine/threonine and a phosphosite-specific titin antibody. PKD-dependent site-specific titin phosphorylation in vivo was quantified by mass spectrometry using stable isotope labeling by amino acids in cell culture (SILAC) of SILAC-labeled mouse heart protein lysates that were mixed with lysates isolated from hearts of either wild-type control (WT) or cKO mice. Fpassive of single permeabilized cardiomyocytes was recorded before and after PKD and HSP27 administration. All-titin phosphorylation was reduced in cKO compared to WT hearts. Multiple conserved PKD-dependent phosphosites were identified within the Z-disk, A-band and M-band regions of titin by quantitative mass spectrometry, and many PKD-dependent phosphosites detected in the elastic titin I-band region were significantly decreased in cKO. Analysis of titin site-specific phosphorylation showed unaltered or upregulated phosphorylation in cKO compared to matched WT hearts. Fpassive was elevated in cKO compared to WT cardiomyocytes and PKD administration lowered Fpassive of WT and cKO cardiomyocytes. Cardiomyocytes from hypertrophic cardiomyopathy (HCM) patients showed higher Fpassive compared to control hearts and significantly lower Fpassive after PKD treatment. In addition, we found higher phosphorylation at CaMKII-dependent titin sites in HCM compared to control hearts. Expression and phosphorylation of HSP27, a substrate of PKD, were elevated in HCM hearts, which was associated with increased PKD expression and phosphorylation. The relocalization of HSP27 in HCM away from the sarcomeric Z-disk and I-band suggested that HSP27 failed to exert its protective action on titin extensibility. This protection could, however, be restored by administration of HSP27, which significantly reduced Fpassive in HCM cardiomyocytes. These findings establish a previously unknown role for PKDin regulating diastolic passive properties of healthy and diseased hearts.
Introduction
Protein kinase (PK)D is a serine/threonine kinase that belongs to the family of calcium/calmodulin-dependent kinases (CaMKII) due to its catalytic domain structure and substrate specificity. The PKD kinase family consists of three members: PKD1 (formerly known as PKCμ) (Valverde et al., ) and the predominant isoforms in the heart (Sin and Baillie, ), PKD2 (Sturany et al., ), and PKD3 (also known as PKCν) (Hayashi et al., ). The isoforms differ in structural and enzymatic properties from members of the PKC family. Some substrates that are targets of PKC are not phosphorylated by PKD (Johannes et al., ; Valverde et al., ; Van Lint et al., ), and unlike CaMKII, PKD is not directly activated by Ca2+ or calmodulin (Avkiran et al., ).
PKD can be activated by other stimuli including reactive oxygen species (ROS), growth factors (i.e., platelet-derived growth factor), and triggering of immune cell receptors. The PKD kinase is involved in the regulation of myocardial contraction by phosphorylating cardiac myosin binding protein C (cMyBP-C), cardiac troponin I (cTnI) and the L-type, voltage gated Ca2+ channel (Haworth et al., ; Cuello et al., ; Aita et al., ; Dirkx et al., ). Phosphorylation of TnI by PKD resulted in a significant rightward shift of the tension–pCa relationship, indicating reduced myofilament Ca2+ sensitivity (Haworth et al., ; Cuello et al., ; Aita et al., ; Dirkx et al., ). At submaximal Ca2+ activation, PKD-mediated phosphorylation also accelerated isometric cross-bridge cycling kinetics (Haworth et al., ; Cuello et al., ), suggesting a beneficial effect of PKD activation on cardiac function. PKD also alters gene expression leading to hypertrophy and influencing cardiac remodeling processes (Vega et al., ; Harrison et al., ).
With a molecular mass ranging from 3,000 to 3,700 kDa, titin is the largest known protein and its function as a molecular spring is important for the elasticity of striated muscle. Spanning the half-sarcomere from the Z-disk to the M-band, titin is expressed in various isoforms that confer different elastic properties to the sarcomere. Two main isoform classes of titin are expressed in the human heart: a shorter, stiffer N2B (3,000 kDa) isoform and several longer, more compliant, N2BA isoforms (>3,200 kDa). These variants differ in their elastic I-band region due to alternative splicing, whereas the Z-disk, A-band, and M-band regions of titin are essentially constitutively expressed. The titin spring region has a complex sequence comprising two types of extensible segments: (1) regions composed of immunoglobulin-like (Ig-) domains (proximal; middle; distal) arranged in tandem; and (2) intrinsically disordered structures, including a unique sequence of the cardiac specific “N2-B” element (“N2-Bus”) and the “PEVK” segment rich in proline, glutamate, valine, and lysine.
The titin filaments in cardiomyocytes are considered to be a main determinant of myocardial “passive” stiffness, along with the collagen fibers of the extracellular matrix and additional factors such as diastolic Ca2+ levels. We have previously demonstrated that the stiffness of cardiac titin is highly variable and depends on titin isoform switching and/or post-translational modifications such as phosphorylation and oxidation (Linke and Hamdani, ).
In our previous study, using a CaMKII knockout mouse model together with the stable isotope labeling of amino acids in cell culture (SILAC) mouse model, we found ~20 CaMKII-dependent phosphosites along the titin molecule (Hamdani et al., ). Some phosphosites were located within the extensible region of titin, e.g., at the N2-Bus and PEVK spring elements, while others were within the A-band, M-band, and Z-disk regions of titin. Using this approach, we also detected >50 additional titin phosphosites that appeared to be not regulated by CaMKII. As regards to other kinases, protein kinase A and G and ERK2 were shown to phosphorylate the titin springs at specific sites within the cardiac-specific N2-Bus element (Kruger et al., ; Kotter et al., ). This modification alters the molecular stiffness of N2-Bus. Yet another kinase, PKCα, was shown to phosphorylate titin's PEVK element (Hidalgo et al., ).
A well-known substrate of PKD, among others, is heat shock protein 27 (HSP27) (Doppler et al., ). HSPs are molecular chaperones comprising a large family of proteins involved in protection against various forms of cellular stress (Mymrikov et al., ). HSPs generally facilitate protein refolding, target misfolded proteins to the proteasome and stabilize and transport partially folded proteins to different cellular compartments. Under various environmental insults such as heat, oxidative stress or acidosis, protein denaturation occurs and leads to unfolding and undesirable protein aggregates (Mymrikov et al., ). HSP27 is a small (ATP-independent) HSP whose function is regulated, in part, by posttranslational modifications, including phosphorylation at Ser-18, Ser-78, Ser-82, and Thr-143 (Kostenko and Moens, ; Mymrikov et al., ). Previous work showed that the unfolded Ig regions of I-band titin, but not the intrinsically disordered segments, can aggregate, causing high titin-dependent myocyte stiffness, and that HSP27 prevented this aggregation and suppressed the stiffening (Kotter et al., ). We speculated that cardiomyocyte elastic function could be protected under stress, at least in part, by HSP27 being regulated via PKD-mediated phosphorylation. The main aim of the present study was to investigate the effects of PKD on titin phosphorylation in vivo and resulting functional changes using cardiomyocyte specific Prkd1, which encodes for PKD1, knockout mice, SILAC mouse hearts, and human hypertrophic cardiomyopathy (HCM) heart tissues. We identified various PKD1-dependent phosphosites within titin using quantitative mass spectrometry (MS) and showed that PKD1-mediated titin-phosphorylation reduces cardiomyocyte Fpassive. Additionally, we found increased oxidative stress in human HCM tissues along with increased HSP27 expression and phosphorylation. HCM tissues also showed increased CaMKII-dependent phosphorylation at the PEVK and N2Bus titin regions. High cardiomyocyte stiffness was corrected by incubation with HSP27 and PKD, probably through relief of titin aggregation. Taken together, our results highlight the important roles of PKD and HSP27, in the presence of oxidative stress, in modulating diastolic function via titin-based stiffness regulation.
Methods
Detailed methods descriptions are provided in the online Supplementary Methods.
Human Heart Tissues
The investigation conforms to the principles outlined in the Declaration of Helsinki and samples were obtained after informed consent and with approval of the local Ethics Committee. LV tissue was obtained from end-stage heart failure patients (NYHA III or IV; n = 10), hypertrophic cardiomyopathy (male, mean age 45 years). LV tissue from non-failing donor hearts (N = 10; +- 40 years of age) served as reference and was obtained from donor hearts (n = 5).
Cardiomyocyte Specific Prkd1 Knock-Out Mice
All animal procedures were performed in accordance with the guidelines of Charité Universitätsmedizin Berlin as well as Max-Delbrück Center for Molecular Medicine and were approved by the Landesamt für Gesundheit und Soziales (LaGeSo, Berlin, Germany) for the use of laboratory animals (permit number: G 0229/11) and followed the ‘Principles of Laboratory Animal Care’ (NIH publication no. 86–23, revised 1985) as well as the current version of German Law on the Protection of Animals. The generation and usage of the conditional Prkd1 allele was published elsewhere (Fielitz et al., ; Kim et al., ). The Cre-loxP recombination system was used for the generation of a conditional Prkd1 allele. Prkd1loxP/loxP mice were crossed with Cre carrying mice controlled by cardiomyocyte-specific alpha-myosin-heavy-chain promotor (αMHC-Cre) (Agah et al., ) (cKO, Prkd1loxP/loxP; αMHC-Cre). αMHC-Cre-negative littermates were used as controls (WT, Prkd1loxP/loxP). Cardiac tissue was obtained when mice were 8–10 weeks of age. N = 7 for both KO and WT.
SILAC-Based Quantitative Mass Spectrometry
We mixed equal amounts of protein lysates from heart tissue (7.5 mg) from the 13Lys6 heavy-labeled SILAC mouse and a non-labeled WT or non-labeled Prkd1 cKO mouse. After protein digestion and phosphopeptide enrichment, the ratio of labeled:unlabeled peptides was determined by liquid chromatography and tandem MS and used to identify the cKO:WT ratio of titin phosphopeptides (Kruger et al., ).
Titin Isoform Separation
Homogenized myocardial samples were analyzed by 1.8% SDS-PAGE. Protein bands were visualized by Coomassie staining and analyzed densitometrically.
All-Titin Phosphorylation Assays
Titin bands were stained with anti-phospho-antibody directed against phospho-serine/threonine. Phospho-protein signals were indexed to total-protein signals and normalized to the intensity of coomassie staining to correct for differences in sample loading. Alternatively, all-titin phosphorylation was measured by PKD-mediated back-phosphorylation (Hamdani et al., ).
Titin and Phosphotitin Western Blots
Western blots were performed using custom-made, affinity-purified, anti-phosphoserine-specific antibodies directed against phospho-Ser-4010, -Ser-4062, -Ser-4099 (all N2Bus), -Ser-11878, and –Ser-12022 (both PEVK), of human titin (UniProtKB identifyer, Q8WZ42), and antibodies recognizing the corresponding nonphosphorylated sequence at these sites (Hamdani et al., ). We also used phosphosite-specific antibodies against phospho-Ser-3991, -Ser-4043, -Ser-4080 (all N2Bus), -Ser-12742, and –Ser-12884 (both PEVK), of mouse titin (UniProtKB identifyer, A2ASS6) (Hamdani et al., ).
Force Measurements on Isolated Cardiomyocytes
Cardiomyocytes were skinned and single isolated cells (n = 12–42/5–6 heart/group) attached between a force transducer and motor (Hamdani et al., ,). Fpassive was recorded over the sarcomere length (SL) range, 1.8–2.4 μm, and was measured before/after PKD and/or HSP27 incubation.
Quantification of Tissue Oxidative Stress
Myocardial levels (n = 7 LV sample/group) of oxidative stress markers were tested with enzyme-linked immunosorbent assay (ELISA). Hydrogen peroxide (H2O2) was assessed in LV tissue homogenates (n = 4–10/group). Samples containing equal amounts of total protein were analyzed for H2O2 formation. Total reduced glutathione in heart samples was determined in duplicate with a colorimetric glutathione assay kit (CS0260, Sigma Aldrich).
Amount and Phosphorylation of PKD and HSP27
The content of PKD and HSP27, as well as their phosphorylation were measured by 15% SDS–PAGE and western blot.
CaMKII Content and Activity
The content of CaMKII was determined using 15% SDS–PAGE and western blot and its activity by using non-radioactive kinase activity-assay kit (CycLex).
Immunofluorescence Imaging
Frozen histological LV sections (n = 3/group) were fixed, blocked and dual-stained with anti-PKD (Sigma-Aldrich; dilution 1:200) or anti-phospho-HSP27 (Ser 82) (Cell Signaling Technology; 1:50) and anti-α-actinin (sarcomere; Sigma-Aldrich; dilution 1:400) antibody, and were incubated with the appropriate secondary antibodies: (FITC) anti-mouse (Rockland Immunochemicals Inc, Limerick, PA, USA; dilution 1:300) and Cy3 anti-rabbit (Jackson ImmunoResearch Laboratories Inc, West Grove, PA, USA; dilution 1:100). Immunostained samples were analyzed by confocal laser scanning microscopy (Nikon Eclipse Ti-E Inverted Microscope System; Nikon Instruments, Nikon Corp, Shinagawa, Tokyo, Japan). Immunofluorescence imaging was processed equally among groups, for 2D intensity histogram analysis the Coloc2 plugin in FIJI was used.
Electron Microscopy (EM)
Frozen LV samples were cut, fixed and blocked. Samples were then immunolabeled against primary antibodies of PKD (Abcam; 1:200) and HSP27 (Abcam; 1:200), then with nanogold conjugated secondary antibodies. After counterstaining with osmium-tetroxide, and dehydration, blocks were embedded into resin. 50 nm thin sections were cut.
Statistics
Values are given as mean ± SEM. Statistically significant differences were tested using Bonferroni adjusted unpaired or paired Student's t-test, with P < 0.05 considered significant.
Results
We hypothesized that Prkd1 cKO mouse hearts would show altered titin phosphorylation compared to matched WT hearts.
Quantitative Mass Spectrometry Detects Disturbed Regulation in Prkd1 cKO Mice
Using the SILAC technique, we detected a wide range of cardiac proteins that were either significantly upregulated (>80 proteins), downregulated (>105 proteins) or unchanged (remainder) in cKOs (Figure 1A). In total we detected 9,833 phosphosites (4,859 of them with −log10 p > 0) from 3,652 different proteins (2,507 of them with log10 p > 0) (Figure 1B). In total, 505 proteins were downregulated in cKO (log2 ratio KO/WT < −0.37) with a significant downregulation of 105 proteins. In addition to 422 proteins found to be upregulated (log2 ratio KO/WT >0.37), 80 proteins showed a significant upregulation, while the rest remained either unchanged or with no relevant pvalue (Figure 1A). Among the significantly up- or downregulated proteins were numerous myofilament and calcium handling proteins, in addition to several phosphatases and kinases (Figures 1C–F). We also detected many cardiac peptides that were either hypophosphorylated (70 phosphopeptides), hyperphosphorylated (63 phosphopeptides), or unchanged in cKOs (Figure 1B).
Figure 1
Quantitative Mass Spectrometry Detects Conserved PKD Phosphosites in Titin
Quantitative MS was combined with a modified SILAC technique to facilitate identification of PKD-dependent phosphorylation sites in titin. Titin was among the proteins that showed the largest alterations in phosphorylation in cKO compared to WT hearts. We identified 332 titin phosphopeptide (including 77.7% serines, 19.3% threonines, and 3.0% tyrosines), including 258 phosphosites with a ratio of cKO to WT phosphorylation levels (ratio WT/cKO) for titin. Among them, 164 phosphosites were with –log10 p > 0 (Figure 2A). Most of the identified phosphopeptides were class 1 (localization probability 0.75–1.00), although 27 phosphopeptides showed a localization probability <0.75 and were therefore class 2 phosphopeptides (see Tables 1–5). The majority of the phosphopeptides showed single phosphorylation, although some showed double phosphorylation. According to the conservative estimate that a cKO/WT ratio should be ≤ −0.37 or ≥ +0.37 in order to represent a significant change in cKO vs. WT, ten significantly altered titin phosphorylation sites could be identified in cKO hearts (Table 1). We identified 24 phosphosites in the elastic spring region of titin (see Table 2). Most of them were located in the N2B-element, PEVK region and distal Ig region. In total, hypophosphorylation (log2 ratio cKO/WT < −0.37) was seen in 133 titin phosphopeptides, the majority of which originated from A- and M-band titin (see Table 3). Furthermore, 25 titin phosphosites were hyperphosphorylated (log2 ratio cKO/WT >0.37; Table 4). One hundred and twelve titin phosphopeptides showed no significant differences in phosphorylation in cKO compared to WT (−0.37> cKO/ WT ratio < +0.37; see Table 5).
Figure 2
Table 1
| Position within titin | UniProt identifyer | Log2 ratio (KO/WT) | –Log 10 p-value KO/WT | Charge | Multiplicity | Localization probability | Classification of phosphosite | Sequence window |
|---|---|---|---|---|---|---|---|---|
| S33880 | A2ASS6 | −0.659036 | 1.33033 | 3 | 1 | 1 | Class 1 | DLYYYRRRRRSLGDMSDEELLLPIDDYLAMK |
| S264 | A2ASS6 | 0.419615 | 1.33152 | 2 | 2 | 1 | Class 1 | PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ |
| S315 | A2ASS6 | 0.40279 | 1.45166 | 2 | 1 | 0.997856 | Class 1 | PSPVRSVSPAGRISTSPIRSVKSPLLIRKTQ |
| S16544 | A2ASS6 | −0.489219 | 1.48858 | 3 | 1 | 0.993809 | Class 1 | AEEEEPFSLPLTERLSINNSKQGESQLRIRD |
| S20332 | A2ASS6 | −0.239112 | 1.58029 | 2 | 1 | 1 | Class 1 | IIGYVVEMRPKIADASPDEGWKRCNAAAQLI |
| S264 | A2ASS6 | 0.767076 | 2.14935 | 2 | 3 | 1 | Class 1 | PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ |
| T266 | A2ASS6 | 0.767076 | 2.14935 | 2 | 3 | 1 | Class 1 | KTPPRIPPKPKSRSPTPPSIAAKAQLARQQS |
| S262 | A2ASS6 | 0.720452 | 2.29218 | 2 | 3 | 1 | Class 1 | QLPHKTPPRIPPKPKSRSPTPPSIAAKAQLA |
| S322 | A2ASS6 | 0.325277 | 3.06343 | 2 | 1 | 1 | Class 1 | SPAGRISTSPIRSVKSPLLIRKTQTTTMATG |
| S307 | A2ASS6 | 0.509144 | 3.60898 | 2 | 2 | 1 | Class 1 | VRHVRAPTPSPVRSVSPAGRISTSPIRSVKS |
Significantly changed titin phosphosites (–log 10 p-value KO/WT > 1.3).
A-band.
Multiplicity contains information about the phosphorylation of the peptides (single. double. triply phosphorylated).
Table 2
| Position within titin | UniProt identifyer | Log2 ratio (KO/WT) | –Log 10 p-value KO/WT | Charge | Multiplicity | Localization probability | Classification of phosphosite | Sequence window |
|---|---|---|---|---|---|---|---|---|
| T9146 | A2ASS6 | −0.650309 | 0.429695 | 3 | 1 | 0.616703 | Class 2 | KERLIPPSFTKKLSETVEETEGNSFKLEGRV |
| S3286 | A2ASS6 | −0.938293 | 0.866542 | 2 | 1 | 0.851679 | Class 1 | RPQPKISWYKEEQLLSTGFKCKFLHDGQEYT |
| S3977 | A2ASS6 | −0.319098 | 0.36361 | 2 | 1 | 0.840288 | Class 1 | CTEGKILMASADTLKSTGQDVALRTEEGKSL |
| T13665 | A2ASS6 | −0.316873 | 0.41921 | 2 | 1 | 1 | Class 1 | CEVSREPKTFRWLKGTQEITGDDRFELIKDG |
| S13228 | A2ASS6 | −0.273069 | 0 | 2 | 1 | 0.993076 | Class 1 | DIPGEWKLKGELLRPSPTCEIKAEGGKRFLT |
| S9201 | A2ASS6 | −0.230981 | 0 | 2 | 1 | 1 | Class 1 | IMFKNNALLLQVKRASMADAGLYTCKATNDA |
| S9144 | A2ASS6 | −0.203903 | 0.163212 | 2 | 1 | 1 | Class 1 | NIKERLIPPSFTKKLSETVEETEGNSFKLEG |
| S4175 | A2ASS6 | −0.168399 | 0.396358 | 3 | 1 | 1 | Class 1 | HEEDKIDVQGGRDHLSDAQKVETVIEAEADS |
| T14268 | A2ASS6 | −0.16409 | 0.087451 | 2 | 1 | 0.99985 | Class 1 | VFTKNLANLEVSEGDTIKLVCEVSKPGAEVI |
| S9459 | A2ASS6 | −0.158813 | 0.124587 | 3 | 1 | 1 | Class 1 | DLRAMLKKTPALKKGSGEEEEIDIMELLKNV |
| S13204 | A2ASS6 | −0.0662166 | 0.089154 | 2 | 1 | 0.880947 | Class 1 | LKPIEDVTIYEKESASFDAEISEEDIPGEWK |
| S4018 | A2ASS6 | −0.018641 | 0 | 2 | 1 | 0.675564 | Class 2 | VLLKEEQSEVVAVPTSQTSKSEKEPEAIKGV |
| S3991 | A2ASS6 | −0.0149712 | 0.0107483 | 2 | 1 | 0.999502 | Class 1 | KSTGQDVALRTEEGKSLSFPLALEEKQVLLK |
| S3870 | A2ASS6 | −0.00516502 | 0.0056415 | 3 | 1 | 0.991661 | Class 1 | EPEGVFPGASSAAQVSPVTIKPLITLTAEPK |
| S14664 | A2ASS6 | 0.0113125 | 0.0110327 | 2 | 1 | 1 | Class 1 | REIKEGKKYKFEKDGSIHRLIIKDCRLEDEC |
| S13764 | A2ASS6 | 0.200173 | 0 | 2 | 1 | 1 | Class 1 | SWFKNDQRLHTSKRVSMHDEGKTHSITFKDL |
| S3676 | A2ASS6 | 0.258327 | 0 | 4 | 1 | 0.878152 | Class 1 | EDMPLYTSVCYTIIHSPDGSGTFIVNDPQRG |
| S12678 | A2ASS6 | 0.331543 | 0.65471 | 3 | 1 | 1 | Class 1 | IEKPKLKPRPPARPPSPPKEDVKEKMFQLKA |
| T10276 | A2ASS6 | 0.395205 | 0 | 3 | 1 | 0.637793 | Class 2 | EVQKKVVTEEKIAIITQREESPPPAVPEIPK |
| S10281 | A2ASS6 | 0.719508 | 0.777963 | 3 | 1 | 0.999995 | Class 1 | VVTEEKIAIITQREESPPPAVPEIPKKKVPE |
| S12871 | A2ASS6 | 0.829341 | 1.09019 | 3 | 1 | 1 | Class 1 | AKPKGPIKGVAKKTPSPIEAERKKLRPGSGG |
| S12884 | A2ASS6 | 0.94305 | 0.52056 | 3 | 1 | 1 | Class 1 | TPSPIEAERKKLRPGSGGEKPPDEAPFTYQL |
| S12871 | A2ASS6 | 0.981417 | 0.3495 | 3 | 2 | 1 | Class 1 | AKPKGPIKGVAKKTPSPIEAERKKLRPGSGG |
| T12869 | A2ASS6 | 0.981417 | 0.3495 | 3 | 2 | 1 | Class 1 | EAAKPKGPIKGVAKKTPSPIEAERKKLRPGS |
Detected phosphosites in the elastic I band titin spring (–log 10 p-value KO/WT >0).
Table 3
| Position within titin | UniProt identifyer | Log2 ratio (KO/WT) | –Log 10 p-value KO/WT | Charge | Multiplicity | Localization probability | Classification of phosphosite | Sequence window |
|---|---|---|---|---|---|---|---|---|
| S23560 | A2ASS6 | −0.372779 | 0 | 3 | 1 | 0.692852 | Class 2 | PGPPGNPRVLDTSRSSISIAWNKPIYDGGSE |
| S18225 | A2ASS6 | −0.376743 | 0.548646 | 2 | 1 | 0.5 | Class 2 | PPGPPFPKVTDWTKSSVDLEWSPPLKDGGSK |
| S30484 | A2ASS6 | −0.380153 | 0 | 2 | 1 | 0.999969 | Class 1 | TWKLEEMRLKETDRMSIATTKDRTTLTVKDS |
| S34451 | A2ASS6 | −0.384564 | 0.573934 | 2 | 1 | 0.999956 | Class 1 | TLTVQKARVIEKAVTSPPRVKSPEPRVKSPE |
| S33933 | A2ASS6 | −0.390718 | 0.578927 | 2 | 1 | 0.999999 | Class 1 | SRSPPRFELSSLRYSSPPAHVKVEDRRRDFR |
| S34808 | A2ASS6 | −0.390976 | 0.349281 | 2 | 1 | 1 | Class 1 | IAEEVKRSAAASLEKSIVHEEVTKTSQASEE |
| S26062 | A2ASS6 | −0.391391 | 0 | 3 | 1 | 0.992938 | Class 1 | KWSVVAESKVCNAVVSGLSSGQEYQFRVKAY |
| S21726 | A2ASS6 | −0.391912 | 0.585051 | 2 | 1 | 0.999998 | Class 1 | FLTEENKWQRVMKSLSLQYSTKDLKEGKEYT |
| T27227 | A2ASS6 | −0.392365 | 0 | 3 | 1 | 0.598045 | Class 2 | QATVAWKKDGQVLRETTRVNVASSKTVTTLS |
| S34476 | A2ASS6 | −0.399261 | 0.538309 | 2 | 1 | 1 | Class 1 | RVKSPETVKSPKRVKSPEPVTSHPKAVSPTE |
| S28859 | A2ASS6 | −0.403171 | 0.471662 | 2 | 1 | 0.990318 | Class 1 | EPVVAKNAFVTPGPPSIPEVTKITKNSMTVV |
| T4070 | A2ASS6-3 | −0.408659 | 0.331878 | 3 | 1 | 0.998519 | Class 1 | RELLSFPVEIQITAATPTPEQNKECRELFEL |
| S22271 | A2ASS6 | −0.42308 | 0 | 3 | 1 | 0.944504 | Class 1 | VSVLDVPGPPGPIEISNVSAEKATLTWTPPL |
| S1196 | A2ASS6 | −0.429651 | 0.300969 | 3 | 1 | 0.887311 | Class 1 | ALVKTQQEMLYQTQMSTFIQEPKVGEIAPGF |
| S29764 | A2ASS6 | −0.433024 | 0.621301 | 2 | 1 | 0.999999 | Class 1 | FGPEYFDGLVIKSGDSLRIKALVQGRPVPRV |
| S26804 | A2ASS6 | −0.433475 | 0 | 3 | 1 | 0.524536 | Class 2 | LYPPGPPSNPKVTDTSRSSVSLAWNKPIYDG |
| S22184 | A2ASS6 | −0.435231 | 0 | 2 | 1 | 0.999983 | Class 1 | LDPTIKDGLTVKAGDSIVLSAISILGKPLPK |
| S28389 | A2ASS6 | −0.440064 | 0 | 2 | 1 | 0.999873 | Class 1 | ESVTLKWEPPKYDGGSHVTNYIVLKRETSTA |
| S19152 | A2ASS6 | −0.442809 | 0 | 2 | 1 | 0.686958 | Class 2 | RKDVATAQWSPLSTTSKKKSHMAKHLTEGNQ |
| S34292 | A2ASS6 | −0.458658 | 1.00349 | 2 | 1 | 0.997471 | Class 1 | LTKTEAYAVSSFKRTSELEAASSVREVKSQM |
| S848 | A2ASS6 | −0.472572 | 0.731925 | 2 | 1 | 0.999987 | Class 1 | ASIAGSAIATLQKELSATSSTQKITKSVKAP |
| S19518 | A2ASS6 | −0.479462 | 0 | 3 | 1 | 0.999999 | Class 1 | DITENAATVSWTLPKSDGGSPITGYYVERRE |
| T4827 | A2ASS6-3 | −0.480703 | 0 | 3 | 2 | 0.682593 | Class 2 | VRDTKHKAQLVQSDSTTSMEVEEVTFNTVYE |
| S16544 | A2ASS6 | −0.489219 | 1.48858 | 3 | 1 | 0.993809 | Class 1 | AEEEEPFSLPLTERLSINNSKQGESQLRIRD |
| S29489 | A2ASS6 | −0.490109 | 0.49045 | 2 | 1 | 0.999929 | Class 1 | GGGEITCYSIEKREASQTNWKMVCSSVARTT |
| S35097 | A2ASS6 | −0.491363 | 0.979128 | 3 | 1 | 0.972789 | Class 1 | ESFVEMSSSSFMGKSSMTQLESSTSRMLKAG |
| S29997 | A2ASS6 | −0.496859 | 0.246525 | 3 | 1 | 0.999978 | Class 1 | KKSTRWVKVISKRPISETRFKVTGLVEGNEY |
| S23358 | A2ASS6 | −0.498498 | 0.499119 | 3 | 1 | 0.855607 | Class 1 | RPGPPEGPLAVSDVTSEKCVLSWLPPLDDGG |
| S262 | A2ASS6 | −0.501588 | 0 | 2 | 1 | 1 | Class 1 | QLPHKTPPRIPPKPKSRSPTPPSIAAKAQLA |
| S30452 | A2ASS6 | −0.513035 | 0.782215 | 2 | 1 | 0.968235 | Class 1 | DLTGITNQLITCKAGSTFTIDVPISGRPAPK |
| S16548 | A2ASS6 | −0.515562 | 0.899345 | 3 | 1 | 0.999832 | Class 1 | EPFSLPLTERLSINNSKQGESQLRIRDSLRP |
| S24061 | A2ASS6 | −0.515855 | 0.613502 | 2 | 1 | 0.97456 | Class 1 | SVTLSWEPPKYDGGSSINNYIVEKRDTSTTA |
| T23053 | A2ASS6 | −0.515985 | 0.758139 | 2 | 1 | 0.999999 | Class 1 | SVVANYPFKVPGPPGTPQVTAVTKDSMTISW |
| S1120 | A2ASS6 | −0.516292 | 0.722335 | 2 | 1 | 1 | Class 1 | CQIGGNPKPHVYWKKSGVPLTTGYRYKVSYN |
| S21895 | A2ASS6 | −0.522994 | 0.473161 | 2 | 1 | 1 | Class 1 | EAMTLKWGPPKDDGGSEITNYVLEKRDSVNN |
| S34756 | A2ASS6 | −0.525721 | 0.586585 | 2 | 1 | 1 | Class 1 | VSTQKTSEVTSQKKASAQEEISQKALTSEEI |
| S21162 | A2ASS6 | −0.54349 | 0.319895 | 2 | 1 | 0.836052 | Class 1 | VNRKDSGDYTITAENSSGSKSATIKLKVLDK |
| S34778 | A2ASS6 | −0.543969 | 0.489795 | 2 | 1 | 0.999964 | Class 1 | QKALTSEEIKMSEVKSHETLAIKEEASKVLI |
| T22513 | A2ASS6 | −0.551522 | 0 | 3 | 1 | 0.958776 | Class 1 | VEHQKVGDDAWIKDTTGTALRITQFVVPDLQ |
| T24135 | A2ASS6 | −0.561529 | 0.975063 | 2 | 1 | 1 | Class 1 | PVVAQYPFKVPGPPGTPFVTLASKDSMEVQW |
| T23980 | A2ASS6 | −0.573932 | 0.604136 | 3 | 1 | 0.631224 | Class 2 | PPAVTWHKDDIPLKQTTRVNAESTENNSLLT |
| S21730 | A2ASS6 | −0.574432 | 0.464884 | 2 | 1 | 0.798102 | Class 1 | ENKWQRVMKSLSLQYSTKDLKEGKEYTFRVS |
| S23609 | A2ASS6 | −0.587423 | 0 | 2 | 1 | 0.995346 | Class 1 | VTPPAGLKATSYTITSLIENQEYKIRIYAMN |
| S4650 | A2ASS6-3 | −0.606701 | 0 | 3 | 1 | 0.981316 | Class 1 | ALFQTPSADVEEANVSETGASVENGDKTFIS |
| T25062 | A2ASS6 | −0.625343 | 0 | 3 | 1 | 0.499999 | Class 2 | KPSISWTKDGMPLKQTTRINVTDSLDLTTLS |
| T25063 | A2ASS6 | −0.625343 | 0 | 3 | 1 | 0.499999 | Class 2 | PSISWTKDGMPLKQTTRINVTDSLDLTTLSI |
| S16620 | A2ASS6 | −0.62959 | 0.594816 | 3 | 1 | 0.999999 | Class 1 | DSVLCKWEPPLDDGGSEIINYTLEKKDKTKP |
| S25817 | A2ASS6 | −0.632049 | 0.301091 | 2 | 1 | 1 | Class 1 | VKPEDKLEAPELDLDSELRKGIVVRAGGSAR |
| S34207 | A2ASS6 | −0.63678 | 0 | 2 | 1 | 0.992242 | Class 1 | AEVKWYHNGVELQESSKIHYTNTSGVLTLEI |
| S20215 | A2ASS6 | −0.644393 | 0.578427 | 2 | 1 | 0.989323 | Class 1 | EMTVVWNAPEYDGGKSITGYYLEKKEKHAVR |
| T30560 | A2ASS6 | −0.645399 | 0.70904 | 2 | 1 | 1 | Class 1 | ESCVLSWTEPKDDGGTEITNYIVEKRESGTT |
| T9146 | A2ASS6 | −0.650309 | 0.429695 | 3 | 1 | 0.616703 | Class 2 | KERLIPPSFTKKLSETVEETEGNSFKLEGRV |
| S33880 | A2ASS6 | −0.659036 | 1.33033 | 3 | 1 | 1 | Class 1 | DLYYYRRRRRSLGDMSDEELLLPIDDYLAMK |
| S21163 | A2ASS6 | −0.662774 | 0 | 2 | 1 | 0.555375 | Class 2 | NRKDSGDYTITAENSSGSKSATIKLKVLDKP |
| S32940 | A2ASS6 | −0.669661 | 0.567747 | 3 | 1 | 0.991067 | Class 1 | DSVNLTWTEPASDGGSKVTNYIVEKCATTAE |
| T27381 | A2ASS6 | −0.676248 | 0.40741 | 2 | 1 | 0.987482 | Class 1 | AVVAEYPFSPPGPPGTPKVVHATKSTMVVSW |
| S22466 | A2ASS6 | −0.68697 | 0.37929 | 3 | 1 | 0.971535 | Class 1 | NPVLMKDVAYPPGPPSNAHVTDTTKKSASLA |
| S15406 | A2ASS6 | −0.717398 | 0.426932 | 2 | 1 | 1 | Class 1 | NSIFLTWDPPKNDGGSRIKGYIVEKCPRGSD |
| S24060 | A2ASS6 | −0.726107 | 0.454637 | 2 | 1 | 0.965865 | Class 1 | DSVTLSWEPPKYDGGSSINNYIVEKRDTSTT |
| S17508 | A2ASS6 | −0.743691 | 0.827831 | 3 | 1 | 0.854636 | Class 1 | PPGPPSCPEVKDKTKSSISLAWKPPAKDGGS |
| S22646 | A2ASS6 | −0.746741 | 0 | 3 | 1 | 0.999997 | Class 1 | TGKFVMTIENPAGKKSGFVNVRVLDTPGPVL |
| Y21461 | A2ASS6 | −0.750766 | 0 | 2 | 1 | 0.997236 | Class 1 | NTEYQFRVYAVNKIGYSDPSDVPDKHCPKDI |
| S34464 | A2ASS6 | −0.758656 | 0.611225 | 2 | 1 | 1 | Class 1 | VTSPPRVKSPEPRVKSPETVKSPKRVKSPEP |
| S19128 | A2ASS6 | −0.761375 | 0.661405 | 3 | 1 | 1 | Class 1 | DSCYLTWKEPLDDGGSVVTNYVVERKDVATA |
| S17509 | A2ASS6 | −0.765849 | 0.574468 | 2 | 1 | 0.499998 | Class 2 | PGPPSCPEVKDKTKSSISLAWKPPAKDGGSP |
| S34009 | A2ASS6 | −0.77042 | 0.791858 | 2 | 1 | 1 | Class 1 | LLRPVTTTQRLSEYKSELDYMSKEEKSKKKS |
| S30820 | A2ASS6 | −0.787034 | 0 | 3 | 1 | 0.779125 | Class 1 | VLAKNAAGVISKGSESTGPVTCRDEYAPPKA |
| S34653 | A2ASS6 | −0.82199 | 0.752192 | 2 | 1 | 0.95726 | Class 1 | SSKPVIVTGLRDTTVSSDSVAKFTIKVTGEP |
| S32936 | A2ASS6 | −0.824822 | 0 | 3 | 1 | 0.909829 | Class 1 | DVSRDSVNLTWTEPASDGGSKVTNYIVEKCA |
| T16910 | A2ASS6 | −0.831267 | 0.77835 | 3 | 1 | 1 | Class 1 | LDVSVKGGIQIMAGKTLRIPAEVTGRPVPTK |
| S15236 | A2ASS6 | −0.836399 | 0.546251 | 3 | 1 | 0.997816 | Class 1 | DQVLEEGDRVKMKTISAYAELVISPSERTDK |
| S21637 | A2ASS6 | −0.851016 | 0.751694 | 2 | 1 | 0.999673 | Class 1 | WSTVTTECSKTSFRVSNLEEGKSYFFRVFAE |
| T30103 | A2ASS6 | −0.851493 | 0 | 3 | 1 | 0.499919 | Class 2 | DWHKVNTEPCVKTRYTVTDLQAGEEYKFRVS |
| S32230 | A2ASS6 | −0.864269 | 0.82444 | 2 | 1 | 0.991873 | Class 1 | DPFDKPSQPGELEILSISKDSVTLQWEKPEC |
| S34005 | A2ASS6 | −0.876525 | 0 | 3 | 1 | 0.999798 | Class 1 | EEEELLRPVTTTQRLSEYKSELDYMSKEEKS |
| S18731 | A2ASS6 | −0.87685 | 0.25695 | 3 | 1 | 0.995523 | Class 1 | EYMVISWKPPLDDGGSEITNYIIEKKELGKD |
| S4248 | A2ASS6-3 | −0.893375 | 0 | 4 | 1 | 0.967119 | Class 1 | VQGEPVRTHFYDHTVSPFAAQSNIKEYTIRE |
| T30453 | A2ASS6 | −0.895531 | 0.674399 | 3 | 1 | 0.861201 | Class 1 | LTGITNQLITCKAGSTFTIDVPISGRPAPKV |
| S1805 | A2ASS6 | −0.895653 | 0.717555 | 2 | 1 | 1 | Class 1 | GTDHTSATLIVKDEKSLVEESQLPDGKKGLQ |
| S15266 | A2ASS6 | −0.907094 | 0 | 2 | 1 | 0.977731 | Class 1 | KGIYTLTLENPVKSISGEINVNVIAPPSAPK |
| S25399 | A2ASS6 | −0.923229 | 0.531448 | 2 | 1 | 0.967678 | Class 1 | VIAKNAAGAISKPSDSTGPITAKDEVELPRI |
| S27960 | A2ASS6 | −0.925189 | 0.489628 | 2 | 1 | 0.834475 | Class 1 | RVRSLNKMGASDPSDSSDPQVAKEREEEPVF |
| S3286 | A2ASS6 | −0.938293 | 0.866542 | 2 | 1 | 0.851679 | Class 1 | RPQPKISWYKEEQLLSTGFKCKFLHDGQEYT |
| T22529 | A2ASS6 | −0.943427 | 0.67514 | 2 | 1 | 1 | Class 1 | GTALRITQFVVPDLQTKEKYNFRISAINDAG |
| S4720 | A2ASS6-3 | −0.959846 | 0 | 3 | 1 | 0.9499 | Class 1 | PRGAVHGAEVPHRRLSLSQDLPFLMTGEQQD |
| S35060 | A2ASS6 | −0.967557 | 0 | 2 | 1 | 0.845469 | Class 1 | SASKQEASFSSFSSSSASSMTEMKFASMSAQ |
| Y20757 | A2ASS6 | −0.96841 | 0.688841 | 2 | 1 | 0.999745 | Class 1 | SSVLIIKDVTRKDSGYYSLTAENSSGSDTQK |
| S25797 | A2ASS6 | −0.975471 | 0.492227 | 2 | 1 | 0.999986 | Class 1 | IRVCALNKVGLGEAASVPGTVKPEDKLEAPE |
| S23925 | A2ASS6 | −1.00025 | 0.887458 | 3 | 1 | 0.999906 | Class 1 | VSAQNEKGISDPRQLSVPVIAKDLVIPPAFK |
| S25613 | A2ASS6 | −1.02282 | 0.946511 | 2 | 1 | 1 | Class 1 | PVLMKNPFVLPGPPKSLEVTNIAKDSMTVCW |
| S29299 | A2ASS6 | −1.03903 | 0.614927 | 2 | 1 | 0.999999 | Class 1 | TDYLVERKGKGEQAWSHAGISKTCEIEIGQL |
| Y20182 | A2ASS6 | −1.04142 | 0.707871 | 3 | 1 | 1 | Class 1 | TGPPTESKPVIAKTKYDRPGRPDPPEVTKVS |
| S35104 | A2ASS6 | −1.0585 | 0 | 2 | 1 | 0.746582 | Class 2 | SSSFMGKSSMTQLESSTSRMLKAGGRGIPPK |
| S15616 | A2ASS6 | −1.06363 | 0.707178 | 2 | 1 | 0.999998 | Class 1 | GSKITNYVVERKATDSDVWHKLSSTVKDTNF |
| S20732 | A2ASS6 | −1.08258 | 0.581344 | 2 | 1 | 0.997277 | Class 1 | PICKWKKGDDEVVTSSHLAIHKADGSSVLII |
| T16946 | A2ASS6 | −1.0848 | 0 | 2 | 1 | 1 | Class 1 | EGELDKERVIIENVGTKSELIIKNALRKDHG |
| S24436 | A2ASS6 | −1.0957 | 0.769352 | 3 | 1 | 0.997797 | Class 1 | KVLDRPGPPEGPVAISGVTAEKCTLAWKPPL |
| S19776 | A2ASS6 | −1.13133 | 0 | 4 | 1 | 0.570984 | Class 2 | VRADHGKYIISAKNSSGHAQGSAIVNVLDRP |
| T30100 | A2ASS6 | −1.14081 | 0.86237 | 2 | 1 | 0.999845 | Class 1 | DLGDWHKVNTEPCVKTRYTVTDLQAGEEYKF |
| S28970 | A2ASS6 | −1.14229 | 0.390143 | 2 | 1 | 0.848484 | Class 1 | PPGPPAKIRIADSTKSSITLGWSKPVYDGGS |
| S23728 | A2ASS6 | −1.15678 | 0 | 2 | 1 | 0.680757 | Class 2 | FDSGKYILTVENSSGSKSAFVNVRVLDTPGP |
| S23604 | A2ASS6 | −1.18392 | 0 | 2 | 1 | 0.760984 | Class 1 | DEWQVVTPPAGLKATSYTITSLIENQEYKIR |
| T22805 | A2ASS6 | −1.18392 | 0.725798 | 2 | 1 | 0.948992 | Class 1 | IEAQRKGSDQWTHISTVKGLECVVRNLTEGE |
| S25730 | A2ASS6 | −1.2141 | 1.02176 | 2 | 1 | 0.999999 | Class 1 | AHVVDTTKNSITLAWSKPIYDGGSEILGYVV |
| S24155 | A2ASS6 | −1.21435 | 0.495954 | 3 | 1 | 0.938049 | Class 1 | LASKDSMEVQWHEPVSDGGSKVIGYHLERKE |
| T23603 | A2ASS6 | −1.22489 | 0.565233 | 2 | 1 | 0.891141 | Class 1 | EDEWQVVTPPAGLKATSYTITSLIENQEYKI |
| S29402 | A2ASS6 | −1.22605 | 1.20053 | 2 | 1 | 1 | Class 1 | LKDGLPLKESEYVRFSKTENKITLSIKNSKK |
| T25518 | A2ASS6 | −1.23095 | 0.735191 | 3 | 1 | 0.981598 | Class 1 | KVLDRPGPPEGPVQVTGVTAEKCTLAWSPPL |
| T19879 | A2ASS6 | −1.23865 | 1.098 | 3 | 1 | 1 | Class 1 | CAENKVGVGPTIETKTPILAINPIDRPGEPE |
| Y29398 | A2ASS6 | −1.26528 | 0.758789 | 2 | 1 | 1 | Class 1 | SISWLKDGLPLKESEYVRFSKTENKITLSIK |
| S32140 | A2ASS6 | −1.27419 | 0.799964 | 2 | 1 | 0.998818 | Class 1 | PEVLDVTKSSVSLSWSRPKDDGGSRVTGYYI |
| S28985 | A2ASS6 | −1.28346 | 0 | 2 | 1 | 0.999999 | Class 1 | SSITLGWSKPVYDGGSDVTGYVVEMKQGDEE |
| S35029 | A2ASS6 | −1.33441 | 0 | 3 | 1 | 0.960754 | Class 1 | PLVEEPPREVVLKTSSDVSLHGSVSSQSVQM |
| S34457 | A2ASS6 | −1.40297 | 0 | 2 | 2 | 1 | Class 1 | ARVIEKAVTSPPRVKSPEPRVKSPETVKSPK |
| S35096 | A2ASS6 | −1.44254 | 0.872837 | 2 | 1 | 0.869587 | Class 1 | QESFVEMSSSSFMGKSSMTQLESSTSRMLKA |
| T22515 | A2ASS6 | −1.45339 | 0 | 3 | 1 | 0.998937 | Class 1 | HQKVGDDAWIKDTTGTALRITQFVVPDLQTK |
| S25026 | A2ASS6 | −1.48484 | 0.743171 | 3 | 1 | 0.949735 | Class 1 | IAKDLVIEPDVRPAFSSYSVQVGQDLKIEVP |
| S21724 | A2ASS6 | −1.49957 | 0 | 2 | 1 | 0.965611 | Class 1 | VDFLTEENKWQRVMKSLSLQYSTKDLKEGKE |
| S27185 | A2ASS6 | −1.55785 | 0.714422 | 2 | 1 | 1 | Class 1 | QLGVPVIAKDIEIKPSVELPFNTFNVKANDQ |
| S34009 | A2ASS6 | −2.60171 | 0 | 2 | 2 | 1 | Class 1 | LLRPVTTTQRLSEYKSELDYMSKEEKSKKKS |
Downregulated titin phosphosites (log2 ratio KO/WT <−0.37).
A-band.
Table 4
| Position within titin | UniProt identifyer | Log2 ratio (KO/WT) | –Log 10 p-value KO/WT | Charge | Multiplicity | Localization probability | Classification of phosphosite | Sequence window |
|---|---|---|---|---|---|---|---|---|
| T314 | A2ASS6 | 0.386936 | 1.09573 | 2 | 1 | 0.982868 | Class 1 | TPSPVRSVSPAGRISTSPIRSVKSPLLIRKT |
| T10276 | A2ASS6 | 0.395205 | 0 | 3 | 1 | 0.637793 | Class 2 | EVQKKVVTEEKIAIITQREESPPPAVPEIPK |
| S315 | A2ASS6 | 0.40279 | 1.45166 | 2 | 1 | 0.997856 | Class 1 | PSPVRSVSPAGRISTSPIRSVKSPLLIRKTQ |
| S264 | A2ASS6 | 0.419615 | 1.33152 | 2 | 2 | 1 | Class 1 | PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ |
| S35038 | A2ASS6 | 0.429709 | 0.499475 | 2 | 1 | 0.987556 | Class 1 | VVLKTSSDVSLHGSVSSQSVQMSASKQEASF |
| S262 | A2ASS6 | 0.433659 | 0.711028 | 2 | 2 | 1 | Class 1 | QLPHKTPPRIPPKPKSRSPTPPSIAAKAQLA |
| S23788 | A2ASS6 | 0.438542 | 0 | 2 | 1 | 0.993369 | Class 1 | KNYIVEKRESTRKAYSTVATNCHKTSWKVDQ |
| S1527 | A2ASS6 | 0.44247 | 0 | 3 | 1 | 0.86319 | Class 1 | VIKEDGTQSLIIVPASPSDSGEWTVVAQNRA |
| S31025 | A2ASS6 | 0.474799 | 0 | 3 | 1 | 0.838063 | Class 1 | GLGVPVESEPIVARNSFTIPSQPGIPEEVGA |
| S834 | A2ASS6 | 0.503759 | 0.543576 | 2 | 1 | 0.99992 | Class 1 | VSKISVPKTEHGYEASIAGSAIATLQKELSA |
| S307 | A2ASS6 | 0.509144 | 3.60898 | 2 | 2 | 1 | Class 1 | VRHVRAPTPSPVRSVSPAGRISTSPIRSVKS |
| T314 | A2ASS6 | 0.608677 | 0 | 2 | 2 | 0.982868 | Class 1 | TPSPVRSVSPAGRISTSPIRSVKSPLLIRKT |
| S774 | A2ASS6 | 0.620881 | 0.40983 | 2 | 1 | 0.98142 | Class 1 | HVVPQAVKPAVIQAPSETHIKTTDQMGMHIS |
| S879 | A2ASS6 | 0.704194 | 0 | 3 | 2 | 0.998042 | Class 1 | TVKPGETRVRAEPTPSPQFPFADMPPPDTYK |
| S10281 | A2ASS6 | 0.719508 | 0.777963 | 3 | 1 | 0.999995 | Class 1 | VVTEEKIAIITQREESPPPAVPEIPKKKVPE |
| S262 | A2ASS6 | 0.720452 | 2.29218 | 2 | 3 | 1 | Class 1 | QLPHKTPPRIPPKPKSRSPTPPSIAAKAQLA |
| S264 | A2ASS6 | 0.767076 | 2.14935 | 2 | 3 | 1 | Class 1 | PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ |
| T266 | A2ASS6 | 0.767076 | 2.14935 | 2 | 3 | 1 | Class 1 | KTPPRIPPKPKSRSPTPPSIAAKAQLARQQS |
| S799 | A2ASS6 | 0.787488 | 0 | 3 | 1 | 0.834492 | Class 1 | MGMHISSQVKKTTDISTERLVHVDKRPRTAS |
| S12871 | A2ASS6 | 0.829341 | 1.09019 | 3 | 1 | 1 | Class 1 | AKPKGPIKGVAKKTPSPIEAERKKLRPGSGG |
| S12884 | A2ASS6 | 0.94305 | 0.52056 | 3 | 1 | 1 | Class 1 | TPSPIEAERKKLRPGSGGEKPPDEAPFTYQL |
| S12871 | A2ASS6 | 0.981417 | 0.3495 | 3 | 2 | 1 | Class 1 | AKPKGPIKGVAKKTPSPIEAERKKLRPGSGG |
| T12869 | A2ASS6 | 0.981417 | 0.3495 | 3 | 2 | 1 | Class 1 | EAAKPKGPIKGVAKKTPSPIEAERKKLRPGS |
| S838 | A2ASS6 | 1.20302 | 0 | 3 | 1 | 0.999952 | Class 1 | SVPKTEHGYEASIAGSAIATLQKELSATSST |
| S32133 | A2ASS6 | 1.4809 | 0.355789 | 2 | 1 | 0.791719 | Class 1 | PEPPSNPPEVLDVTKSSVSLSWSRPKDDGGS |
Upregulated titin phosphosites (log2 ratio KO/WT > 0.37).
A-band.
Table 5
| Position within titin | UniProt identifyer | Log2 ratio (KO/WT) | –Log 10 p-value KO/WT | Charge | Multiplicity | Localization probability | Classification of phosphosite | Sequence window |
|---|---|---|---|---|---|---|---|---|
| T26299 | A2ASS6 | −0.367305 | 0.338896 | 2 | 1 | 0.999988 | Class 1 | PVVVQYPFKEPGPPGTPFVTSISKDQMLVQW |
| S23354 | A2ASS6 | −0.359797 | 0 | 3 | 1 | 0.990613 | Class 1 | KVLDRPGPPEGPLAVSDVTSEKCVLSWLPPL |
| S34298 | A2ASS6 | −0.356955 | 0 | 3 | 1 | 0.609727 | Class 2 | YAVSSFKRTSELEAASSVREVKSQMTETRES |
| S34470 | A2ASS6 | −0.355278 | 0 | 2 | 1 | 1 | Class 1 | VKSPEPRVKSPETVKSPKRVKSPEPVTSHPK |
| S33875 | A2ASS6 | −0.353589 | 0.477593 | 3 | 2 | 1 | Class 1 | PSPDYDLYYYRRRRRSLGDMSDEELLLPIDD |
| S33880 | A2ASS6 | −0.353589 | 0.477593 | 3 | 2 | 1 | Class 1 | DLYYYRRRRRSLGDMSDEELLLPIDDYLAMK |
| S18562 | A2ASS6 | −0.350673 | 0.345871 | 2 | 1 | 1 | Class 1 | IGTEKFHKVTNDNLLSRKYTVKGLKEGDTYE |
| T22520 | A2ASS6 | −0.329784 | 0 | 3 | 1 | 0.995336 | Class 1 | DDAWIKDTTGTALRITQFVVPDLQTKEKYNF |
| S3977 | A2ASS6 | −0.319098 | 0.36361 | 2 | 1 | 0.840288 | Class 1 | CTEGKILMASADTLKSTGQDVALRTEEGKSL |
| S19146 | A2ASS6 | −0.318534 | 0.168528 | 2 | 1 | 0.995484 | Class 1 | TNYVVERKDVATAQWSPLSTTSKKKSHMAKH |
| T13665 | A2ASS6 | −0.316873 | 0.41921 | 2 | 1 | 1 | Class 1 | CEVSREPKTFRWLKGTQEITGDDRFELIKDG |
| S17098 | A2ASS6 | −0.305806 | 0.472482 | 2 | 1 | 0.933227 | Class 1 | PPTSPERLTYTERTKSTITLDWKEPRSDGGS |
| S24868 | A2ASS6 | −0.302999 | 0 | 2 | 1 | 0.998408 | Class 1 | KIKNYIVEKREATRKSYAAVVTNCHKNSWKI |
| S34470 | A2ASS6 | −0.302672 | 0.238728 | 2 | 2 | 1 | Class 1 | VKSPEPRVKSPETVKSPKRVKSPEPVTSHPK |
| S26806 | A2ASS6 | −0.301597 | 0 | 2 | 1 | 0.655766 | Class 2 | PPGPPSNPKVTDTSRSSVSLAWNKPIYDGGA |
| S18224 | A2ASS6 | −0.300622 | 0.391952 | 2 | 1 | 0.832005 | Class 1 | APPGPPFPKVTDWTKSSVDLEWSPPLKDGGS |
| S34464 | A2ASS6 | −0.2992 | 0.235518 | 2 | 2 | 1 | Class 1 | VTSPPRVKSPEPRVKSPETVKSPKRVKSPEP |
| S2080 | A2ASS6 | −0.298846 | 0.520376 | 2 | 1 | 1 | Class 1 | ITIPTFKPERIELSPSMEAPKIFERIQSQTV |
| S19448 | A2ASS6 | −0.273899 | 0 | 2 | 1 | 0.805061 | Class 1 | QDTRKGTWGVVSAGSSKLKLKVPHLQKGCEY |
| S13228 | A2ASS6 | −0.273069 | 0 | 2 | 1 | 0.993076 | Class 1 | DIPGEWKLKGELLRPSPTCEIKAEGGKRFLT |
| S27374 | A2ASS6 | −0.266139 | 0 | 3 | 1 | 0.820467 | Class 1 | SSYSESSAVVAEYPFSPPGPPGTPKVVHATK |
| S20517 | A2ASS6 | −0.265893 | 0 | 3 | 1 | 0.748614 | Class 2 | TSCHVSWAPPENDGGSQVTHYIVEKREAERK |
| S28343 | A2ASS6 | −0.263658 | 0 | 3 | 1 | 0.780076 | Class 1 | SVTTDAGRYEITAANSSGTTKTFINIIVLDR |
| S32318 | A2ASS6 | −0.262435 | 0.516907 | 2 | 1 | 0.999971 | Class 1 | SRPRRTAMSVKTKLTSGEAPGVRKEMADVTT |
| S3622 | A2ASS6-3 | −0.260512 | 0 | 3 | 1 | 0.962608 | Class 1 | VEEKGMVRTIHFRSASPVRRADYVYNDEWSE |
| Y21274 | A2ASS6 | −0.257528 | 0 | 3 | 1 | 1 | Class 1 | VGDPILTEPAIAKNPYDPPGRCDPPVISNIT |
| T22220 | A2ASS6 | −0.252516 | 0.8886 | 3 | 1 | 0.940036 | Class 1 | AGKDIRPSDIAQITSTPTSSMLTVKYATRKD |
| S22152 | A2ASS6 | −0.241103 | 0 | 2 | 1 | 0.761358 | Class 1 | IRAKNTAGAISAPSESTGTIICKDEYEAPTI |
| S20332 | A2ASS6 | −0.239112 | 1.58029 | 2 | 1 | 1 | Class 1 | IIGYVVEMRPKIADASPDEGWKRCNAAAQLI |
| S9201 | A2ASS6 | −0.230981 | 0 | 2 | 1 | 1 | Class 1 | IMFKNNALLLQVKRASMADAGLYTCKATNDA |
| S4098 | A2ASS6-3 | −0.229673 | 0 | 3 | 1 | 1 | Class 1 | FELEPEVTPRDQAIQSPKHKFIFSSDITNEP |
| S27782 | A2ASS6 | −0.229019 | 0 | 3 | 1 | 0.547507 | Class 2 | DPFTTPSPPTSLEITSVTKDSMTLCWSRPET |
| T27228 | A2ASS6 | −0.228542 | 0.209869 | 3 | 1 | 0.955571 | Class 1 | ATVAWKKDGQVLRETTRVNVASSKTVTTLSI |
| S20036 | A2ASS6 | −0.211545 | 0 | 2 | 1 | 0.999133 | Class 1 | EVAWTKDKDATDLTRSPRVKIDTSAESSKFS |
| S9144 | A2ASS6 | −0.203903 | 0.163212 | 2 | 1 | 1 | Class 1 | NIKERLIPPSFTKKLSETVEETEGNSFKLEG |
| S22416 | A2ASS6 | −0.192457 | 0 | 2 | 1 | 0.999998 | Class 1 | EKKGLRWVRATKTPVSDLRCKVTGLQEGNTY |
| S30939 | A2ASS6 | −0.186488 | 0 | 2 | 1 | 0.998923 | Class 1 | VKVLDSPGPCGKLTVSRVTEEKCTLAWSLPQ |
| S18535 | A2ASS6 | −0.184072 | 0 | 3 | 1 | 1 | Class 1 | NTVSLTWNPPKYDGGSEIINYVLESRLIGTE |
| T266 | A2ASS6 | −0.174257 | 0.297613 | 2 | 1 | 1 | Class 1 | KTPPRIPPKPKSRSPTPPSIAAKAQLARQQS |
| S4175 | A2ASS6 | −0.168399 | 0.396358 | 3 | 1 | 1 | Class 1 | HEEDKIDVQGGRDHLSDAQKVETVIEAEADS |
| T23981 | A2ASS6 | −0.166376 | 0 | 3 | 1 | 0.5 | Class 2 | PAVTWHKDDIPLKQTTRVNAESTENNSLLTI |
| T14268 | A2ASS6 | −0.16409 | 0.087451 | 2 | 1 | 0.99985 | Class 1 | VFTKNLANLEVSEGDTIKLVCEVSKPGAEVI |
| S1529 | A2ASS6 | −0.159512 | 0.439196 | 3 | 1 | 0.943823 | Class 1 | KEDGTQSLIIVPASPSDSGEWTVVAQNRAGK |
| S9459 | A2ASS6 | −0.158813 | 0.124587 | 3 | 1 | 1 | Class 1 | DLRAMLKKTPALKKGSGEEEEIDIMELLKNV |
| T30575 | A2ASS6 | −0.154592 | 0 | 3 | 1 | 0.788648 | Class 1 | TEITNYIVEKRESGTTAWQLINSSVKRTQIK |
| S28281 | A2ASS6 | −0.146693 | 0.305079 | 3 | 1 | 0.999999 | Class 1 | DMKNFPSHTVYVRAGSNLKVDIPISGKPLPK |
| S26695 | A2ASS6 | −0.140014 | 0.346765 | 3 | 1 | 0.797368 | Class 1 | EPVIACNPYKRPGPPSTPEASAITKDSMVLT |
| S24391 | A2ASS6 | −0.137242 | 0.088548 | 2 | 1 | 0.993652 | Class 1 | TARLEIKSTDFATSLSVKDAVRVDSGNYILK |
| T29649 | A2ASS6 | −0.134127 | 0.58377 | 3 | 1 | 0.997724 | Class 1 | PSKFTLAVSPVDPPGTPDYIDVTRETITLKW |
| T21731 | A2ASS6 | −0.127027 | 0 | 2 | 1 | 0.718367 | Class 2 | NKWQRVMKSLSLQYSTKDLKEGKEYTFRVSA |
| T33772 | A2ASS6 | −0.120166 | 0.177658 | 2 | 1 | 1 | Class 1 | RMPYEVPEPRRFKQATVEEDQRIKQFVPMSD |
| S16477 | A2ASS6 | −0.120059 | 0.290657 | 2 | 1 | 0.960016 | Class 1 | KAVDPIDAPKVILRTSLEVKRGDEIALDATI |
| T25842 | A2ASS6 | −0.117083 | 0 | 2 | 1 | 0.999999 | Class 1 | AGGSARIHIPFKGRPTPEITWSKEEGEFTDK |
| S17015 | A2ASS6 | −0.116476 | 0 | 3 | 1 | 0.999637 | Class 1 | KMCLLNWSDPADDGGSDITGFIIERKDAKMH |
| S3827 | A2ASS6-3 | −0.110284 | 0.69199 | 2 | 1 | 1 | Class 1 | SNEEVHGYKSRGICESPDKVSQVLTPYPSES |
| S34488 | A2ASS6 | −0.108085 | 0.264442 | 2 | 1 | 0.999994 | Class 1 | RVKSPEPVTSHPKAVSPTETKPTEKGQHLPV |
| S790 | A2ASS6 | −0.10482 | 0 | 3 | 1 | 0.790373 | Class 1 | ETHIKTTDQMGMHISSQVKKTTDISTERLVH |
| T26696 | A2ASS6 | −0.0857946 | 0.182593 | 3 | 1 | 0.989467 | Class 1 | PVIACNPYKRPGPPSTPEASAITKDSMVLTW |
| S1977 | A2ASS6 | −0.081692 | 0.055874 | 2 | 1 | 0.990373 | Class 1 | KLQFEVQKVDRPVDTSETKEVVKLKRAERIT |
| S19447 | A2ASS6 | −0.0663668 | 0 | 2 | 1 | 0.591546 | Class 2 | KQDTRKGTWGVVSAGSSKLKLKVPHLQKGCE |
| S13204 | A2ASS6 | −0.0662166 | 0.089154 | 2 | 1 | 0.880947 | Class 1 | LKPIEDVTIYEKESASFDAEISEEDIPGEWK |
| S25920 | A2ASS6 | −0.0488367 | 0.044418 | 3 | 1 | 1 | Class 1 | PGPPQNLAVKEVRKDSVLLVWEPPIIDGGAK |
| S22804 | A2ASS6 | −0.0380723 | 0.014722 | 2 | 1 | 0.805129 | Class 1 | VIEAQRKGSDQWTHISTVKGLECVVRNLTEG |
| S34611 | A2ASS6 | −0.0345249 | 0 | 2 | 1 | 0.68296 | Class2 | TGQSFKSIHEQVSSISETTKSVQKTAESAEA |
| S30572 | A2ASS6 | −0.0335397 | 0 | 2 | 1 | 0.832922 | Class 1 | DGGTEITNYIVEKRESGTTAWQLINSSVKRT |
| S35063 | A2ASS6 | −0.0245479 | 0 | 2 | 1 | 0.632417 | Class2 | KQEASFSSFSSSSASSMTEMKFASMSAQSMS |
| S4018 | A2ASS6 | −0.018641 | 0 | 2 | 1 | 0.675564 | Class 2 | VLLKEEQSEVVAVPTSQTSKSEKEPEAIKGV |
| S35036 | A2ASS6 | −0.0161605 | 0 | 2 | 1 | 0.952755 | Class 1 | REVVLKTSSDVSLHGSVSSQSVQMSASKQEA |
| S3991 | A2ASS6 | −0.0149712 | 0.0107483 | 2 | 1 | 0.999502 | Class 1 | KSTGQDVALRTEEGKSLSFPLALEEKQVLLK |
| S17113 | A2ASS6 | −0.01187 | 0.0154739 | 3 | 1 | 0.985972 | Class 1 | STITLDWKEPRSDGGSPIQGYIIEKRRHDKP |
| S814 | A2ASS6 | −0.0108688 | 0.0162498 | 2 | 1 | 0.999999 | Class 1 | STERLVHVDKRPRTASPHFTVSKISVPKTEH |
| S20755 | A2ASS6 | −0.0093163 | 0.0181907 | 2 | 1 | 1 | Class 1 | DGSSVLIIKDVTRKDSGYYSLTAENSSGSDT |
| S27556 | A2ASS6 | −0.0092088 | 0.0073245 | 2 | 1 | 0.999755 | Class 1 | DQRYEFRVFARNAADSVSEPSESTGPITVKD |
| S3870 | A2ASS6 | −0.0051650 | 0.0056415 | 3 | 1 | 0.991661 | Class 1 | EPEGVFPGASSAAQVSPVTIKPLITLTAEPK |
| S4672 | A2ASS6-3 | −0.0048496 | 0.0087214 | 3 | 1 | 1 | Class 1 | ENGDKTFISQLKRAASEEECLEDHEMEDGPT |
| S28731 | A2ASS6 | −0.0040724 | 0.0043022 | 2 | 1 | 0.974739 | Class 1 | LASILIKDANRLNSGSYELKLRNAMGSASAT |
| S17109 | A2ASS6 | 0.00032406 | 0 | 3 | 1 | 0.836525 | Class 1 | ERTKSTITLDWKEPRSDGGSPIQGYIIEKRR |
| S14664 | A2ASS6 | 0.0113125 | 0.0110327 | 2 | 1 | 1 | Class 1 | REIKEGKKYKFEKDGSIHRLIIKDCRLEDEC |
| T21632 | A2ASS6 | 0.0207359 | 0 | 2 | 1 | 0.819558 | Class 1 | AERKSWSTVTTECSKTSFRVSNLEEGKSYFF |
| S17316 | A2ASS6 | 0.02154 | 0 | 3 | 1 | 0.980872 | Class 1 | ESCYLTWDAPLDNGGSEITHYIIDKRDASRK |
| S34623 | A2ASS6 | 0.0307702 | 0.0977465 | 2 | 1 | 1 | Class 1 | SSISETTKSVQKTAESPEAKKQEPIAPESIS |
| S756 | A2ASS6 | 0.0341452 | 0.0943439 | 3 | 1 | 1 | Class 1 | HISTTKVPEQPRRPASEPHVVPQAVKPAVIQ |
| S34573 | A2ASS6 | 0.0437442 | 0 | 3 | 1 | 0.978092 | Class 1 | SADGTYELKIHNLSESDCGEYVCEVSGEGGT |
| S34571 | A2ASS6 | 0.120101 | 0 | 2 | 1 | 0.99376 | Class 1 | HYSADGTYELKIHNLSESDCGEYVCEVSGEG |
| T32113 | A2ASS6 | 0.130455 | 0 | 3 | 1 | 0.999962 | Class 1 | GISKPLKSEEPVIPKTPLNPPEPPSNPPEVL |
| T25315 | A2ASS6 | 0.134102 | 0 | 3 | 1 | 1 | Class 1 | NSECYVARDPCDPPGTPEAIIVKRNEITLQW |
| S2078 | A2ASS6 | 0.155502 | 0.903734 | 2 | 1 | 1 | Class 1 | GKITIPTFKPERIELSPSMEAPKIFERIQSQ |
| T21345 | A2ASS6 | 0.156475 | 0.125556 | 3 | 1 | 0.999996 | Class 1 | PVIERTLKATGLQEGTEYEFRVTAINKAGPG |
| S31438 | A2ASS6 | 0.158509 | 0 | 2 | 1 | 0.78457 | Class 1 | VPLVPTKLEVVDVTKSTVTLAWEKPLYDGGS |
| S34488 | A2ASS6 | 0.158631 | 0 | 2 | 2 | 0.999994 | Class 1 | RVKSPEPVTSHPKAVSPTETKPTEKGQHLPV |
| S34476 | A2ASS6 | 0.159999 | 0 | 2 | 2 | 1 | Class 1 | RVKSPETVKSPKRVKSPEPVTSHPKAVSPTE |
| S35128 | A2ASS6 | 0.165174 | 0.213397 | 2 | 1 | 0.999984 | Class 1 | GRGIPPKIEALPSDISIDEGKVLTVACAFTG |
| S315 | A2ASS6 | 0.166903 | 0.183848 | 2 | 2 | 0.997856 | Class 1 | PSPVRSVSPAGRISTSPIRSVKSPLLIRKTQ |
| S22797 | A2ASS6 | 0.170233 | 0.274145 | 2 | 1 | 1 | Class 1 | GSKITGYVIEAQRKGSDQWTHISTVKGLECV |
| S25870 | A2ASS6 | 0.199285 | 0 | 2 | 1 | 1 | Class 1 | TDKVQIEKGINFTQLSIDNCDRNDAGKYILK |
| S13764 | A2ASS6 | 0.200173 | 0 | 2 | 1 | 1 | Class 1 | SWFKNDQRLHTSKRVSMHDEGKTHSITFKDL |
| S814 | A2ASS6 | 0.200474 | 0.566341 | 2 | 2 | 0.999999 | Class 1 | STERLVHVDKRPRTASPHFTVSKISVPKTEH |
| S21152 | A2ASS6 | 0.207222 | 0.196717 | 2 | 1 | 1 | Class 1 | RNLCTLELFSVNRKDSGDYTITAENSSGSKS |
| S307 | A2ASS6 | 0.21303 | 0.565178 | 2 | 1 | 1 | Class 1 | VRHVRAPTPSPVRSVSPAGRISTSPIRSVKS |
| S2078 | A2ASS6 | 0.216232 | 0.446394 | 2 | 2 | 1 | Class 1 | GKITIPTFKPERIELSPSMEAPKIFERIQSQ |
| S2080 | A2ASS6 | 0.216232 | 0.446394 | 2 | 2 | 1 | Class 1 | ITIPTFKPERIELSPSMEAPKIFERIQSQTV |
| S33353 | A2ASS6 | 0.219718 | 0.237812 | 3 | 1 | 1 | Class 1 | IRSQRGVSVAKVKVASIEIGPVSGQIMHAIG |
| T812 | A2ASS6 | 0.223205 | 0.643762 | 4 | 2 | 0.999999 | Class 1 | DISTERLVHVDKRPRTASPHFTVSKISVPKT |
| Y33436 | A2ASS6 | 0.229236 | 0 | 2 | 1 | 0.996224 | Class 1 | TKFDDGTYRCKVVNDYGEDSSYAELFVKGVR |
| S264 | A2ASS6 | 0.246749 | 0.784633 | 2 | 1 | 1 | Class 1 | PHKTPPRIPPKPKSRSPTPPSIAAKAQLARQ |
| S3676 | A2ASS6 | 0.258327 | 0 | 4 | 1 | 0.878152 | Class 1 | EDMPLYTSVCYTIIHSPDGSGTFIVNDPQRG |
| S879 | A2ASS6 | 0.26138 | 0.407205 | 3 | 1 | 0.998042 | Class 1 | TVKPGETRVRAEPTPSPQFPFADMPPPDTYK |
| S1214 | A2ASS6 | 0.287447 | 0.235319 | 2 | 1 | 1 | Class 1 | IQEPKVGEIAPGFAYSEYEKEYEKEQALIRK |
| S322 | A2ASS6 | 0.325277 | 3.06343 | 2 | 1 | 1 | Class 1 | SPAGRISTSPIRSVKSPLLIRKTQTTTMATG |
| S12678 | A2ASS6 | 0.331543 | 0.65471 | 3 | 1 | 1 | Class 1 | IEKPKLKPRPPARPPSPPKEDVKEKMFQLKA |
| T266 | A2ASS6 | 0.332311 | 0.771702 | 2 | 2 | 1 | Class 1 | KTPPRIPPKPKSRSPTPPSIAAKAQLARQQS |
| S2032 | A2ASS6 | 0.353204 | 0.75905 | 2 | 1 | 1 | Class 1 | EAITAVELKSRKKDESYEELLKKTKDELLHW |
Unchanged titin phosphosites (−0.37 < log2 ratio KO/WT < 0.37).
A-band.
Titin Isoform Composition in PKD1 cKO Mice
To study whether PKD has an influence on titin isoform composition, homogenized myocardial samples of cKO and matched WT mice were separated using SDS-PAGE, the protein bands visualized by Coomassie staining and the two cardiac titin isoforms N2BA and N2B analyzed using densitometry; a representative titin gel showing these two isoforms in WT and cKO is shown in Figure 2C. On average, titin isoform composition remained unchanged in cKO vs. WT mouse hearts. For both groups, the ratio of N2B to N2BA was ~85:15% (Figure 2B). A “T2” titin degradation band was also detectable in hearts of both cKO and WT, but showed no significant change.
Site-Specific Phosphorylation at Titin-N2Bus and Titin-PEVK
To confirm titin phosphorylation sites identified by quantitative MS and to analyse site-specific titin phosphorylation, affinity-purified anti-phosphosite-specific antibodies were generated against conserved serines of human/mouse N2Bus at Ser4010/Ser3991, Ser4062/Ser4043, and Ser4099/Ser4080, as well as human/mouse PEVK at Ser11878/Ser12742 and Ser12022/Ser12884. The PVDF staining served as a protein loading control.
Using the titin anti-phospho-antibodies we found unaltered phosphorylation at the positions Ser3991 (Figure 2C) and Ser4080 (Figure 2E) but significantly increased phosphorylation at the positions Ser4043 (Figure 2D), Ser12742 (Figure 2F), and Ser12884 (Figure 2G) in cKO compared to WT hearts. Using an anti-phosphor-Ser/Thr antibody, overall-titin phosphorylation was found to be greatly decreased, by ≈25% on average, in cKO compared to WT hearts (Figure 2H).
Cardiomyocyte FPassive Is Elevated in cKO Hearts
The passive length–tension relationship of single skinned cardiomyocytes in relaxing solution was steeper in cKO than in WT hearts (Figures 3A,B). Significantly increased Fpassive levels in cKO vs. WT cells were found at sarcomere lengths (SL) of 2.1 μm or higher. Administering PKD to non-activated skinned cardiomyocytes from cKO hearts in relaxing solution significantly reduced Fpassive at SL 2.2 μm or higher, returning it to levels found in matched WT cells (Figure 3C), whereas administration of PKD to WT cardiomyocytes did not affect Fpassive.
Figure 3
In an alternative approach, demembranated cardiac fiber bundles from hearts of these mice were phosphorylated ex vivo by PKD and then titin SDS-PAGE was performed followed by Western blot analysis. Titin phosphorylation was significantly increased after PKD treatment in cKO hearts, while in WT it remained unaltered (Figure 3D).
Increased PKD and HSP27 Activity Is Associated With Increased Oxidative Stress
In HCM hearts, we found less reduced glutathione (GSH) and increased hydrogen peroxide (H2O2), both of which indicate that oxidative stress was increased in HCM hearts compared to control non-failing hearts (Figures 4A,B). Myocardial PKD content and PKD phosphorylation at phosphosite Ser916 were both significantly higher in HCM hearts compared to controls, indicating total myocardial PKD activity in HCM (Figures 4C–E). In addition, the amount of HSP27 was higher in hearts of HCM patients compared to controls (Figure 4F) and the phosphorylation of HSP27 resulted in an altered dimer phosphorylation of HSP27 in HCM compared to controls, while HSP27 monomers remained unchanged (Figures 4G–I).
Figure 4
Cardiomyocyte FPassive Is Elevated in HCM Hearts
Cardiomyocytes from human end-stage failing hearts (only from patients with hypertrophic cardiomyopathy) showed a higher cardiomyocyte Fpassive at sarcomere length 2.1 μm or higher compared to non-failing human heart samples. Administering human recombinant PKD to non-activated skinned cardiomyocytes from human HCM hearts in relaxing solution significantly reduced Fpassive at sarcomere length 2.1 μm or higher, lowering it to levels found in cells from control hearts (Figures 5A–C). In addition, upon treatment with human recombinant HSP27, Fpassive was significantly reduced at all sarcomere lengths, whereas control cardiomyocytes remained unaltered (Figures 5D,E).
Figure 5
Titin Phosphorylation in Hearts of Human HCM Patients
We found increased CaMKII phosphosites at titin positions Ser4062 and Ser12022 in HCM compared to control hearts (Figures 6A,B), which went along with increased myocardial CaMKII content and activity (Figures 6C,D). Total titin phosphorylation was significantly lower in HCM compared to non-failing hearts (Figure 6E). Using an alternative approach, we measured total titin phosphorylation in demembranated cardiac fiber bundles obtained from HCM and non-failing human hearts before and after ex vivo phosphorylation by human recombinant PKD (Figure 6E). Strong signals were seen for both isoforms N2BA and N2B after kinase treatment, and the total phosphorylation of titin was significantly increased by more than 20% in non-failing and failing HCM hearts.
Figure 6
Subcellular Localization and Overlay of PKD and HSP27 in HCM and Control Hearts
As we found a relatively high level of PKD expression in failing HCM hearts using western blot, we wished to determine the cellular distribution of PKD using confocal laser scanning and electron microscopy. The confocal images showed a clear overlay of PKD signals with sarcomeres in control and HCM hearts (Figure 7A). Phospho-HSP27 was clearly present at the periphery of the cardiomyocytes in HCM compared to control hearts, whereas in control hearts, phospho-HSP27 was distributed throughout the cardiomyocyte (Figure 7B). 2D intensity histograms show two channels and the level of overlapping. For a high overlapping level, the histogram pixels tend to concentrate more along the y = x line. 2D intensity histogram analysis showed a more intense presence of PKD in HCM but distribution was not significantly different, while phospho-HSP27 in HCM hearts compared to controls showed less correlation with α-actinin as more pixels concentrate at the axis of the histogram, the less correlation can be expected (Figures 7C,D). In keeping with these findings, electron microscopy confirmed the higher level of PKD in myocardium HCM compared to control hearts (Figures 8A,B). Using electron microscopy, HSP27 showed a strongly altered localization away from the Z-disk and A-band in HCM, whereas HSP27 was located preferentially at the Z-disk and A-band in controls (Figures 8C,D).
Figure 7
Figure 8
Discussion
PKD has emerged as a key regulator of excitation-contraction coupling and cardiac hypertrophic signaling. Cardiac-specific PKD1-cKO mice show resistance to cardiac hypertrophy and fibrosis in response to pressure overload and angiotensin II treatment (Fielitz et al., ). Overexpression of constitutively active PKD1 in mouse hearts leads to dilated cardiomyopathy, and an increase in PKD1 expression and activity is seen in failing hearts of rats (Harrison et al., ), rabbits and humans (Bossuyt et al., ). These findings indicate the importance of PKD1 in regulating cardiac pathophysiology and the potential of the kinase as a therapeutic target in cardiovascular disease (Nichols et al., ). As PKD1 showed some beneficial effects on cardiomyocyte function (Haworth et al., ; Cuello et al., ), we wanted to know if PKD is also involved in the phosphorylation of titin. We demonstrated that titin is an important substrate of PKD. In a quantitative MS screen using PKD1-cKO hearts and the SILAC mouse heart, we found that titin was among the cardiac proteins most highly affected by PKD1 deletion. Overall, titin phosphorylation was significantly reduced in cKO compared to WT hearts. Many of the phosphosites found in titin are located within the Z-disk, A-band, or M-band sections of the molecule, where they could be involved in regulating protein–protein interactions or mechanical signaling (Figure 9). In addition, we identified many phosphosites within the I-band titin region (proximal Ig region, N2-Bus and PEVK region) present in the N2BA and N2B cardiac titin isoforms (Figure 9). Furthermore, we showed that PKD reduces cardiomyocyte stiffness in PKD1 cKO mice and in failing hearts of human HCM patients. As PKD1 activation and increased PKD1 phosphorylation is observed in the hypertrophic heart from mice that have undergone tac surgery and as PKD plays an important role in the development of cardiac hypertrophy as shown via inhibition of hypertrophy in isolated neonatal cardiomyocytes from Wistar rats with PKD deletion (Zhao et al., 2017, ), we used human HCM tissues to validate how important is PKD in human heart failure with hypertrophy. We found disturbed titin phosphorylation in human HCM hearts, possibly contributing to the mechanical dysfunction. This was associated with increased PKD and CaMKII content and activity in these hearts. Moreover, we detected an increased amount and phosphorylation of HSP27, a substrate of PKD, in human HCM hearts. Changes in PKD, CaMKII and HSP27 were associated with increased oxidative stress parameters. Our work reveals a previously unknown role of PKD in regulating diastolic passive properties of healthy and diseased hearts, and its association with oxidative stress and changes affecting HSP27.
Figure 9
Titin Is a Substrate of PKD
Changes in titin stiffness due to isoform switching or post-translational modifications such as phosphorylation and oxidation have been reported in a variety of species. Previous studies showed that heart failure is associated with a chronic deficit in global titin phosphorylation (Bishu et al., ; Falcao-Pires et al., ; Hamdani et al., ,). Titin is phosphorylated by PKA at the N2B spring element, which results in a reduction of cardiomyocyte Fpassive (Yamasaki et al., ; Kruger and Linke, ). In addition, titin is phosphorylated by PKG at the N2Bus (Kruger et al., ; Kotter et al., ), a modification that also reduces cardiomyocyte Fpassive (Borbely et al., ; Hamdani et al., , ). Following short-term cGMP-enhancing treatment with sildenafil and B-type natriuretic peptide (BNP) in an animal model of heart failure with preserved ejection fraction (HFpEF) (elderly hypertensive dogs) (Bishu et al., ), PKG-mediated phosphorylation of titin resulted in acutely increased cardiac extensibility and may also positively regulate hypertrophic signaling. Our study provides the first evidence that PKD also phosphorylates titin. Notably, altered phosphorylation of titin sites was seen within the PEVK-domain, especially at the phosphosites that are also CaMKII-dependent. Perhaps this hints at a compensatory mechanism due to the loss of PKD in these mice.
Cardiomyocyte Stiffness and PKD
Cardiomyocyte Fpassive was elevated in cKO compared to WT, and incubating skinned cardiomyocytes with PKD lowered Fpassive in cKO, but did not affect WTs. Furthermore, cardiomyocyte isolated from failing HCM hearts showed increased Fpassive, which could be reduced upon treatment with PKD enzyme. Thus, PKD alters Fpassive in the same direction as PKA, PKG, ERK2, and CaMKIIδ, an effect that may depend mainly on the phosphorylation of N2Bus. The latter increases the persistence length of N2Bus and thereby reduces Fpassive (Kruger et al., ). Another possible mechanism is via phosphorylation of titin Ig domains, although this is not yet proven. To date, PKCα is the only kinase that increases cardiomyocyte stiffness via phosphorylation of the PEVK region. The mechanical effect of PKCα-mediated PEVK phosphorylation includes increased persistence length of PEVK causing increased stretch-dependent force of the titin spring, thus elevating cardiomyocyte passive tension (Hidalgo et al., ). Reduced all-titin phosphorylation contribute to the development of heart failure, against the reduced phosphorylation, increased phosphorylation has been demonstrated in heart failure, the PKCα-dependent phosphosite at S11878 within the PEVK-titin segment was hyperphosphorylated in HFpEF animal models (Hamdani et al., , ; Linke and Hamdani, ; Franssen et al., ). PKCα was shown to be increased in heart failure (Belin et al., ) and in the HFpEF dog hearts. We believe what might determine the spatial arrangement phosphorylation along the titin molecule is the distinct micro-environment of phospho-sites either surrounded by negatively charged micro-environment and phospho-sites located at hydrophobic environment and close to cysteines sites. This may induce distinct biological and mechanical responses that may have differential effects on heart muscle exposed to oxidative stress and inflammation.
In failing human hearts, the activities of PKA and PKG are typically reduced (Hamdani et al., , ; Linke and Hamdani, ; Franssen et al., ), whereas the activity and the expression of PKCα, ERK2, and CaMKIIδ are usually increased, perhaps because of the presence of hypertrophy. In human failing HCM hearts, cardiomyocyte Fpassive was increased compared to non-failing hearts, an effect that was related to increased CaMKII activity and consequently, increased phosphorylation of titin within the PEVK region at CaMKIIδ-dependent phosphosites (Bishu et al., ; Falcao-Pires et al., ; Hamdani et al., ,). Cardiomyocyte Fpassive has been found to be pathologically elevated in human HFpEF and heart failure with reduced ejection fraction (HFrEF), due to disturbed activity of PKA and PKG. While inhibition of PKCα activity has been suggested as a potential therapeutic target for hypertrophied hearts, boosting PKD enzyme activity in failing, overly stiff, hearts could be beneficial for cardiomyocyte stiffness, similar to PKA, PKG, and ERK2 (Borbely et al., ; Raskin et al., ; van Heerebeek et al., ; Hamdani et al., , ; Kotter et al., ; Linke and Hamdani, ). A reduction in PKD-mediated titin phosphorylation, in turn, would increase Fpassive and be detrimental to diastolic filling. However, a stiffer titin spring could speed up diastolic recoil and amplify some of the mechanosensory functions of titin.
The PKD Substrate HSP27
The current study also showed that HSP27 content and phosphorylation is increased in human HCM hearts, a mechanism that might work to protect cardiomyocytes from damage, as an established function of HSP27 is to prevent stress-induced protein aggregation and myocardial damage (Linke and Hamdani, ). The observed increase in HSP27 was associated with increased oxidative stress and increased content and activity of PKD, which also phosphorylates HSP27. PKD showed a polymer formation on EM, which indicates that PKD is oxidized. This may thus explain the beneficial ex-vivo effect of PKD on cardiomyocyte Fpassive and indicates that perhaps increased PKD activity observed in HCM hearts is partially due to PKD oxidation as well-suggesting that by lowering oxidation we may improve cardiomyocyte function in a manner similar to administration of endogenous PKD ex vivo. PKD is an important downstream regulator of the oxidative stress response, and increased oxidative stress leads to the activation of different PKD isoforms and subsequent phosphorylation of HSP27 (Doppler et al., ; Stetler et al., ). In our study, phosphorylation of HSP27 was increased in HCM hearts, which is in line with previous findings showing that HSP27 phosphorylation prevents apoptosis by protecting cells against heat shock, apoptosis effectors, oxidative stress, and ischemia (Martin et al., ; Benjamin and McMillan, ; Knowlton et al., ; Yoshida et al., ; Dohke et al., ; Li et al., ). HSP27 is abundant in cardiac muscle cells, commonly localized to the Z-disk and I-band regions of the sarcomere, and involved in the protection of titin and intermediate filaments (Kotter et al., ; Linke and Hamdani, ). In HCM hearts, HSP27 showed a strongly altered localization away from the Z-disk and I-band, whereas in non-failing hearts, HSP27 was preferentially localized to the Z-disk and I-band. Whether the translocation of HSP27 depends on the altered phosphorylation status of HSP27 is still controversial (Mymrikov et al., ); altered phosphorylation of HSP27 at least did not alter the binding to titin domains (Kotter et al., ; Linke and Hamdani, ). HSP27 can function as an inhibitor of cell death upon its phosphorylation and dissociation to lower-molecular-weight oligomers, while the presence of the high-molecular-weight, non-phosphorylated form of HSP27 appears to be necessary for cellular protection against cardiac ischemia/reperfusion (Golenhofen et al., , ; Kadono et al., ; Pinz et al., ). PKD specifically phosphorylates HSP27 in pancreatic cancer cells (Yuan and Rozengurt, ) and endothelial cells (Evans et al., ). Phosphorylation of Ser82 is considered to be the main “effector” step for the shift from large molecular weight multimers to differentially functional oligomers. As regards titin, HSP27 specifically protects the unfolded Ig regions, but not the intrinsically disordered segments (N2Bus and PEVK), from aggregating under acidic stress (Kotter et al., ). The protective role of small HSPs on titin extensibilitywas also evident in earlier studies in which α-B crystallin lowered the persistence length of the N2Bus segment and reduced the unfolding probability of the immunoglobulin domains flanking the N2Bus segment (Bullard et al., ). Isolated hearts lacking sHSPs (DKO) showed severe contractile dysfunction (Pinz et al., ), increased myocardial injury and resting tension (Golenhofen et al., ), accompanied by diastolic dysfunction in response to ischemia/reperfusion ex vivo (Pinz et al., ). This accords with our previous findings in isolated human cardiomyocytes in which under conditions promoting titin aggregation (pre-stretch and acidic pH), passive stiffness was high in the absence of sHSPs but normal in the presence of sHSPs (Kotter et al., ). In our present work on human HCM cardiomyocytes, HSP27 lowered Fpassive to the levels previously reported after administration of PKA and/or PKG (Borbely et al., ; Fukuda et al., ; Kruger et al., ; Falcao-Pires et al., ). In addition, Fpassive fell to the level observed after PKD administration.
Conclusion
Our findings have important therapeutic implications as they imply that drugs that balance PKD activity and restore HSP27 localization to the Z-disk and I band may show efficacy as a treatment for diastolic LV dysfunction related to high cardiomyocyte stiffness.
Statements
Data availability statement
All datasets generated for this study are included in the article/Supplementary Material.
Ethics statement
All animal procedures were performed in accordance with the guidelines of Charité Universitätsmedizin Berlin as well as Max-Delbrück Center for Molecular Medicine and were approved by the Landesamt für Gesundheit und Soziales (LaGeSo, Berlin, Germany) for the use of laboratory animals (permit number: G 0229/11) and followed the Principles of Laboratory Animal Care (NIH publication no. 86-23, revised 1985) as well as the current version of German Law on the Protection of Animals. The studies involving human participants were reviewed and approved by (St Vincent's Hospital of Sydney, Australia, Human Research Ethics Committee; File number: H03/118; Title: Molecular Analysis of Human Heart Failure. The patients/participants provided their written informed consent to participate in this study.
Author contributions
MH has generated all mass spectrometry and biochemistry data, analyzed all data, and has written the manuscript. DK has generated the confocal images and written the manuscript. ML has made the electron microscopy. SH and MK helped and supervised the mass spectrometry. ÁK performed mechanic experiments. ZP contributed to mechanics and rewrote the manuscript. KJ helped with re-analyzing the biochemistry data and rewrote the manuscript. PH provided the tissues. CD provided the human HCM biopsies. PR re-analyzed some data. AM re-analyzed the data and rewrote the manuscript. JF provided the Prkd1 mice and rewrote the manuscript. WL supervised and rewrote the manuscript. NH supervised, re-analyzed all data, performed mechanics, and wrote the manuscript.
Funding
This work was supported by DFG (HA 7512/2-1) and FoRUM- Projekt (F765-13, F808N-14, and F882R-2017).
Acknowledgments
We gratefully acknowledge the technical assistance of Anja Vöge and Frauke De Pasquale. Also we acknowledge support by the DFG Open Access Publication Funds of the Ruhr-Universität Bochum.
Conflict of interest
SH was employed by the company Sanofi-Aventis Deutschland GmbH Industriepark Höchst. The remaining authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fphys.2020.00240/full#supplementary-material
References
1
AgahR.FrenkelP. A.FrenchB. A.MichaelL. H.OverbeekP. A.SchneiderM. D. (1997). Gene recombination in postmitotic cells. targeted expression of cre recombinase provokes cardiac-restricted, site-specific rearrangement in adult ventricular muscle in vivo. J. Clin. Invest.100, 169–179.
2
AitaY.KurebayashiN.HiroseS.MaturanaA. D. (2011). Protein kinase D regulates the human cardiac L-type voltage-gated calcium channel through serine 1884. FEBS Lett.585, 3903–6. 10.1016/j.febslet.2011.11.011
3
AvkiranM.RowlandA. J.CuelloF.HaworthR. S. (2008). Protein kinase d in the cardiovascular system: emerging roles in health and disease. Circ. Res.102, 157–63. 10.1161/CIRCRESAHA.107.168211
4
BelinR. J.SumandeaM. P.AllenE. J.SchoenfeltK.WangH.SolaroR. J.et al. (2007). Augmented protein kinase C-α-induced myofilament protein phosphorylation contributes to myofilament dysfunction in experimental congestive heart failure. Circ. Res.101, 195–204. 10.1161/CIRCRESAHA.107.148288
5
BenjaminI. J.McMillanD. R. (1998). Stress (heat shock) proteins: molecular chaperones in cardiovascular biology and disease. Circ. Res.83, 117–132. 10.1161/01.res.83.2.117
6
BishuK.HamdaniN.MohammedS. F.KrugerM.OhtaniT.OgutO.et al. (2011). Sildenafil and B-type natriuretic peptide acutely phosphorylate titin and improve diastolic distensibility in vivo. Circulation124, 2882–2891. 10.1161/CIRCULATIONAHA.111.048520
7
BorbelyA.Falcao-PiresI.van HeerebeekL.HamdaniN.EdesI.GavinaC.et al. (2009). Hypophosphorylation of the stiff N2B titin isoform raises cardiomyocyte resting tension in failing human myocardium. Circ. Res.104, 780–786. 10.1161/CIRCRESAHA.108.193326
8
BorbelyA.van der VeldenJ.PappZ.BronzwaerJ. G.EdesI.StienenG. J.et al. (2005). Cardiomyocyte stiffness in diastolic heart failure. Circulation111, 774–781. 10.1161/01.CIR.0000155257.33485.6D
9
BossuytJ.HelmstadterK.WuX.Clements-JeweryH.HaworthR. S.AvkiranM.et al. (2008). Ca2+/calmodulin-dependent protein kinase IIdelta and protein kinase D overexpression reinforce the histone deacetylase 5 redistribution in heart failure. Circ. Res.102, 695–702. 10.1161/CIRCRESAHA.107.169755
10
BullardB.FergusonC.MinajevaA.LeakeM. C.GautelM.LabeitD.et al. (2004). Association of the chaperone alphaB-crystallin with titin in heart muscle. J. Biol. Chem.279, 7917–7924. 10.1074/jbc.M307473200
11
CuelloF.BardswellS. C.HaworthR. S.YinX.LutzS.WielandT.et al. (2007). Protein kinase D selectively targets cardiac troponin i and regulates myofilament Ca2+ sensitivity in ventricular myocytes. Circ. Res.100, 864–873. 10.1161/01.RES.0000260809.15393.fa
12
DirkxE.CazorlaO.SchwenkR. W.Lorenzen-SchmidtI.SadayappanS.Van LintJ.et al. (2012). Protein kinase D increases maximal Ca2+-activated tension of cardiomyocyte contraction by phosphorylation of cMyBP-C-Ser315. Am. J. Physiol. Heart Circ. Physiol.303, H323–H331. 10.1152/ajpheart.00749.2011
13
DohkeT.WadaA.IsonoT.FujiiM.YamamotoT.TsutamotoT.et al. (2006). Proteomic analysis reveals significant alternations of cardiac small heat shock protein expression in congestive heart failure. J. Card. Fail.12, 77–84. 10.1016/j.cardfail.2005.07.006
14
DopplerH.StorzP.LiJ.CombM. J.TokerA. (2005). A phosphorylation state-specific antibody recognizes Hsp27, a novel substrate of protein kinase D. J. Biol. Chem.280, 15013–15019. 10.1074/jbc.C400575200
15
EvansI. M.BrittonG.ZacharyI. C. (2008). Vascular endothelial growth factor induces heat shock protein (HSP) 27 serine 82 phosphorylation and endothelial tubulogenesis via protein kinase D and independent of p38 kinase. Cell. Signal.20, 1375–1384. 10.1016/j.cellsig.2008.03.002
16
Falcao-PiresI.HamdaniN.BorbelyA.GavinaC.SchalkwijkC. G.van der VeldenJ.et al. (2011). Diabetes mellitus worsens diastolic left ventricular dysfunction in aortic stenosis through altered myocardial structure and cardiomyocyte stiffness. Circulation124, 1151–1159. 10.1161/CIRCULATIONAHA.111.025270
17
FielitzJ.KimM. S.SheltonJ. M.QiX.HillJ. A.RichardsonJ. A.et al. (2008). Requirement of protein kinase D1 for pathological cardiac remodeling. Proc. Natl. Acad. Sci. U.S.A.105, 3059–3063. 10.1073/pnas.0712265105.
18
FranssenC.ChenS.UngerA.KorkmazH. I.De KeulenaerG. W.TschopeC.et al. (2016). Myocardial microvascular inflammatory endothelial activation in heart failure with preserved ejection fraction. JACC Heart Fail.4, 312–324. 10.1016/j.jchf.2015.10.007
19
FukudaN.WuY.NairP.GranzierH. L. (2005). Phosphorylation of titin modulates passive stiffness of cardiac muscle in a titin isoform-dependent manner. J. Gen. Physiol.125, 257–271. 10.1085/jgp.200409177
20
GolenhofenN.ArbeiterA.KoobR.DrenckhahnD. (2002). Ischemia-induced association of the stress protein alpha B-crystallin with I-band portion of cardiac titin. J. Mol. Cell. Cardiol.34, 309–319. 10.1006/jmcc.2001.1513
21
GolenhofenN.RedelA.WawrousekE. F.DrenckhahnD. (2006). Ischemia-induced increase of stiffness of alphaB-crystallin/HSPB2-deficient myocardium. Pflugers Arch.451, 518–525. 10.1007/s00424-005-1488-1
22
HamdaniN.BishuK. G.von Frieling-SalewskyM.RedfieldM. M.LinkeW. A. (2013a). Deranged myofilament phosphorylation and function in experimental heart failure with preserved ejection fraction. Cardiovasc. Res.97, 464–471. 10.1093/cvr/cvs353
23
HamdaniN.HerventA.-S.VandekerckhoveL.MatheeussenV.DemolderM.BaertsL.et al. (2014). Left ventricular diastolic dysfunction and myocardial stiffness in diabetic mice is attenuated by inhibition of dipeptidyl peptidase 4. Cardiovasc. Res.104, 423–431. 10.1093/cvr/cvu223
24
HamdaniN.KrysiakJ.KreusserM. M.NeefS.Dos RemediosC. G.MaierL. S.et al. (2013b). Crucial role for Ca2(+)/calmodulin-dependent protein kinase-II in regulating diastolic stress of normal and failing hearts via titin phosphorylation. Circ. Res.112, 664–674. 10.1161/CIRCRESAHA.111.300105
25
HarrisonB. C.KimM. S.van RooijE.PlatoC. F.PapstP. J.VegaR. B.et al. (2006). Regulation of cardiac stress signaling by protein kinase d1. Mol. Cell. Biol.26, 3875–3888. 10.1128/MCB.26.10.3875-3888.2006
26
HaworthR. S.CuelloF.HerronT. J.FranzenG.KentishJ. C.GautelM.et al. (2004). Protein kinase D is a novel mediator of cardiac troponin i phosphorylation and regulates myofilament function. Circ. Res.95, 1091–1099. 10.1161/01.RES.0000149299.34793.3c
27
HayashiA.SekiN.HattoriA.KozumaS.SaitoT. (1999). PKCnu, a new member of the protein kinase C family, composes a fourth subfamily with PKCmu. Biochim. Biophys. Acta1450, 99–106. 10.1016/s0167-4889(99)00040-3
28
HidalgoC.HudsonB.BogomolovasJ.ZhuY.AndersonB.GreaserM.et al. (2009). PKC phosphorylation of titin's PEVK element: a novel and conserved pathway for modulating myocardial stiffness. Circ. Res.105, 631–638. 10.1161/CIRCRESAHA.109.198465
29
JohannesF. J.PrestleJ.EisS.OberhagemannP.PfizenmaierK. (1994). PKCu is a novel, atypical member of the protein kinase C family. J. Biol. Chem.269, 6140–6148
30
KadonoT.ZhangX. Q.SrinivasanS.IshidaH.BarryW. H.BenjaminI. J. (2006). CRYAB and HSPB2 deficiency increases myocyte mitochondrial permeability transition and mitochondrial calcium uptake. J. Mol. Cell. Cardiol.40, 783–789. 10.1016/j.yjmcc.2006.03.003
31
KimM. S.FielitzJ.McAnallyJ.SheltonJ. M.LemonD. D.McKinseyT. A.et al. (2008). Protein kinase D1 stimulates MEF2 activity in skeletal muscle and enhances muscle performance. Mol. Cell. Biol.28, 3600–3609. 10.1128/MCB.00189-08
32
KnowltonA. A.KapadiaS.Torre-AmioneG.DurandJ. B.BiesR.YoungJ.et al. (1998). Differential expression of heat shock proteins in normal and failing human hearts. J. Mol. Cell. Cardiol.30, 811–818. 10.1006/jmcc.1998.0646
33
KostenkoS.MoensU. (2009). Heat shock protein 27 phosphorylation: kinases, phosphatases, functions and pathology. Cell. Mol. Life Sci.66, 3289–3307. 10.1007/s00018-009-0086-3
34
KotterS.GoutL.Von Frieling-SalewskyM.MullerA. E.HellingS.MarcusK.et al. (2013). Differential changes in titin domain phosphorylation increase myofilament stiffness in failing human hearts. Cardiovasc. Res.99, 648–656. 10.1093/cvr/cvt144
35
KotterS.UngerA.HamdaniN.LangP.VorgerdM.Nagel-StegerL.et al. (2014). Human myocytes are protected from titin aggregation-induced stiffening by small heat shock proteins. J. Cell. Biol.204, 187–202. 10.1083/jcb.201306077
36
KrugerM.KotterS.GrutznerA.LangP.AndresenC.RedfieldM. M.et al. (2009). Protein kinase G modulates human myocardial passive stiffness by phosphorylation of the titin springs. Circ. Res.104, 87–94. 10.1161/CIRCRESAHA.108.184408
37
KrugerM.LinkeW. A. (2006). Protein kinase-A phosphorylates titin in human heart muscle and reduces myofibrillar passive tension. J. Muscle Res. Cell Motil.27, 435–444. 10.1007/s10974-006-9090-5
38
KrugerM.MoserM.UssarS.ThievessenI.LuberC. A.FornerF.et al. (2008). SILAC mouse for quantitative proteomics uncovers kindlin-3 as an essential factor for red blood cell function. Cell134, 353–364. 10.1016/j.cell.2008.05.033
39
LiZ.LiuX.ZhaoZ.LiuW. (2012). [Heat shock protein 27 enhances the inhibitory effect of influenza A virus NS1 on the expression of interferon-beta]. Sheng Wu Gong Cheng Xue Bao28, 1205–1215.
40
LinkeW. A.HamdaniN. (2014). Gigantic business: titin properties and function through thick and thin. Circ. Res.114, 1052–1068. 10.1161/CIRCRESAHA.114.301286
41
MartinJ. L.MestrilR.Hilal-DandanR.BruntonL. L.DillmannW. H. (1997). Small heat shock proteins and protection against ischemic injury in cardiac myocytes. Circulation96, 4343–4348. 10.1161/01.cir.96.12.4343
42
MymrikovE. V.Seit-NebiA. S.GusevN. B. (2011). Large potentials of small heat shock proteins. Physiol. Rev.91, 1123–1159. 10.1152/physrev.00023.2010
43
NicholsC. B.ChangC. W.FerreroM.WoodB. M.SteinM. L.FergusonA. J.et al. (2014). beta-adrenergic signaling inhibits Gq-dependent protein kinase D activation by preventing protein kinase D translocation. Circ. Res.114, 1398–1409. 10.1161/CIRCRESAHA.114.303870
44
PinzI.RobbinsJ.RajasekaranN. S.BenjaminI. J.IngwallJ. S. (2008). Unmasking different mechanical and energetic roles for the small heat shock proteins CryAB and HSPB2 using genetically modified mouse hearts. FASEB J.22, 84–92. 10.1096/fj.07-8130com
45
RaskinA.LangeS.BanaresK.LyonR. C.ZiesenissA.LeeL. K.et al. (2012). A novel mechanism involving four-and-a-half LIM domain protein-1 and extracellular signal-regulated kinase-2 regulates titin phosphorylation and mechanics. J. Biol. Chem.287, 29273–29284. 10.1074/jbc.M112.372839
46
SinY. Y.BaillieG. S. (2012). Protein kinase D in the hypertrophy pathway. Biochem. Soc. Trans.40, 287–289. 10.1042/BST20110626
47
StetlerR. A.GaoY.ZhangL.WengZ.ZhangF.HuX.et al. (2012). Phosphorylation of HSP27 by protein kinase D is essential for mediating neuroprotection against ischemic neuronal injury. J. Neurosci.32, 2667–2682. 10.1523/JNEUROSCI.5169-11.2012
48
SturanyS.van LintJ.MullerF.WildaM.HameisterH.HockerM.et al. (2001). Molecular cloning and characterization of the human protein kinase D2. a novel member of the protein kinase D family of serine threonine kinases. J. Biol. Chem.276, 3310–3318. 10.1074/jbc.M008719200
49
ValverdeA. M.Sinnett-SmithJ.Van LintJ.RozengurtE. (1994). Molecular cloning and characterization of protein kinase D: a target for diacylglycerol and phorbol esters with a distinctive catalytic domain. Proc. Natl. Acad. Sci. U.S.A.91, 8572–8576. 10.1073/pnas.91.18.8572
50
van HeerebeekL.HamdaniN.Falcao-PiresI.Leite-MoreiraA. F.BegienemanM. P.BronzwaerJ. G.et al. (2012). Low myocardial protein kinase G activity in heart failure with preserved ejection fraction. Circulation126, 830–839. 10.1161/CIRCULATIONAHA.111.076075
51
Van LintJ. V.Sinnett-SmithJ.RozengurtE. (1995). Expression and characterization of PKD, a phorbol ester and diacylglycerol-stimulated serine protein kinase. J. Biol. Chem.270, 1455–1461. 10.1074/jbc.270.3.1455
52
VegaR. B.HarrisonB. C.MeadowsE.RobertsC. R.PapstP. J.OlsonE. N.et al. (2004). Protein kinases C and D mediate agonist-dependent cardiac hypertrophy through nuclear export of histone deacetylase 5. Mol. Cell. Biol.24, 8374–8385. 10.1128/MCB.24.19.8374-8385.2004
53
YamasakiR.WuY.McNabbM.GreaserM.LabeitS.GranzierH. (2002). Protein kinase A phosphorylates titin's cardiac-specific N2B domain and reduces passive tension in rat cardiac myocytes. Circ. Res.90, 1181–1188. 10.1161/01.res.0000021115.24712.99
54
YoshidaN.KristiansenA.LibermanM. C. (1999). Heat stress and protection from permanent acoustic injury in mice. J. Neurosci.19, 10116–10124.
55
YuanJ.RozengurtE. (2008). PKD, PKD2, and p38 MAPK mediate Hsp27 serine-82 phosphorylation induced by neurotensin in pancreatic cancer PANC-1 cells. J. Cell. Biochem.103, 648–662. 10.1002/jcb.21439
56
ZhaoD.GaoY.WangW.PeiH.XuC.ZhaoZ. (2019). PKD deletion promotes autophagy and inhibits hypertrophy in cardiomyocyte. Exp. Cell Res.386:111742. 10.1016/j.yexcr.2019.111742
57
ZhaoD.WangW.WangH.PengH.LiuX.GuoW.et al. (2017). PKD knockdown inhibits pressure overload-induced cardiac hypertrophy by promoting autophagy via AKT/mTOR pathway. Int. J. Biol. Sci.13, 276–285. 10.7150/ijbs.17617
Summary
Keywords
titin, HCM, PKD, Hsp27, stiffness
Citation
Herwig M, Kolijn D, Lódi M, Hölper S, Kovács Á, Papp Z, Jaquet K, Haldenwang P, Dos Remedios C, Reusch PH, Mügge A, Krüger M, Fielitz J, Linke WA and Hamdani N (2020) Modulation of Titin-Based Stiffness in Hypertrophic Cardiomyopathy via Protein Kinase D. Front. Physiol. 11:240. doi: 10.3389/fphys.2020.00240
Received
19 December 2019
Accepted
02 March 2020
Published
15 April 2020
Volume
11 - 2020
Edited by
Sachio Morimoto, International University of Health and Welfare (IUHW), Japan
Reviewed by
Miklos Kellermayer, Semmelweis University, Hungary; Joseph D. Powers, University of California, San Diego, United States
Updates
Copyright
© 2020 Herwig, Kolijn, Lódi, Hölper, Kovács, Papp, Jaquet, Haldenwang, Dos Remedios, Reusch, Mügge, Krüger, Fielitz, Linke and Hamdani.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Nazha Hamdani nazha.hamdani@rub.de
This article was submitted to Striated Muscle Physiology, a section of the journal Frontiers in Physiology
†These authors have contributed equally to this work
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.