Abstract
The sodium-bicarbonate cotransporter (NBCe1) has three primary variants: NBCe1-A, -B and -C. NBCe1-A is expressed in renal proximal tubules in the cortical labyrinth, where it is essential for reclaiming filtered bicarbonate, such that NBCe1-A knockout mice are congenitally acidemic. NBCe1-B and -C variants are expressed in chemosensitive regions of the brainstem, while NBCe1-B is also expressed in renal proximal tubules located in the outer medulla. Although mice lacking NBCe1-B/C (KOb/c) exhibit a normal plasma pH at baseline, the distribution of NBCe1-B/C indicates that these variants could play a role in both the rapid respiratory and slower renal responses to metabolic acidosis (MAc). Therefore, in this study we used an integrative physiologic approach to investigate the response of KOb/c mice to MAc. By means of unanesthetized whole-body plethysmography and blood-gas analysis, we demonstrate that the respiratory response to MAc (increase in minute volume, decrease in pCO2) is impaired in KOb/c mice leading to a greater severity of acidemia after 1 day of MAc. Despite this respiratory impairment, the recovery of plasma pH after 3-days of MAc remained intact in KOb/c mice. Using data gathered from mice housed in metabolic cages we demonstrate a greater elevation of renal ammonium excretion and greater downregulation of the ammonia recycling enzyme glutamine synthetase in KOb/c mice on day 2 of MAc, consistent with greater renal acid-excretion. We conclude that KOb/c mice are ultimately able to defend plasma pH during MAc, but that the integrated response is disturbed such that the burden of work shifts from the respiratory system to the kidneys, delaying the recovery of pH.
1 Introduction
Regulation of pH at the level of the cell, organ, and whole organism is an essential component of health. Acidemia has been implicated in osteopenia and osteoporosis (Weger et al., 2000), decreased insulin release and sensitivity (Farwell and Taylor, 2008), vascular-endothelial dysfunction (Wesson et al., 2011), progression of chronic kidney disease to end-stage renal disease (Shah et al., 2009; Phisitkul et al., 2010), cardiac arrhythmias (Orchard and Cingolani, 1994), and heart failure (Urso et al., 2015). The maintenance of a normal plasma pH (7.35–7.45) requires contributions from multiple organ-systems, creating a complex feedback network. In particular, the lungs and kidneys function together to maintain the ratio of the partial pressure of carbon dioxide (pCO2) to the plasma bicarbonate concentration ([HCO3−]), as governed by the classic Henderson-Hasselbalch equation ().
During metabolic acidosis (MAc [HCO3−] <22 mEq/L), chemoreceptors in the brain and periphery (i.e., aortic and carotid bodies) stimulate increases in lung ventilation in order to reduce pCO2 and mitigate the fall in plasma pH (O’Regan and Majcherczyk, 1982; Schuitmaker et al., 1987). The kidneys respond to MAc primarily through the metabolic process ammoniagenesis, which results in de novo production of equimolar HCO3− and ammonium (NH4+); HCO3− is transported into circulation and NH4+ is excreted in the urine (Weiner and Verlander, 2019). Upregulation of ammoniagenesis requires the coordinated expression changes of enzymes involved in the metabolism of glutamine to NH4+ and HCO3−. Two of these enzymes include phosphoenolpyruvate carboxykinase (PEPCK), and glutamine synthetase (GS). PEPCK specifically catalyzes the formation of HCO3− as part of the gluconeogenesis pathway, which leads to increased net HCO3− production; thus MAc normally stimulates increased PEPCK expression (Curthoys and Gstraunthaler, 2001). On the other hand, glutamine synthetase (GS) is involved with the recycling of NH4+ by catalyzing the addition of NH4+ to glutamate forming glutamine, and thus MAc normally decreases GS expression in order to increase net NH4+ excretion (Conjard et al., 2003). While both distal and proximal tubule (PT) segments participate in ammoniagenesis, only PT ammoniagenesis contributes to the overall increase in NH4+ excretion seen during MAc (Good and Burg, 1984).
Recent work has advanced our understanding of the molecular mechanisms underlying these organ responses. Of increasing interest is the role of the Na+-HCO3− co-transporter (NBCe1), encoded by the SLC4A4 gene. Mutations in SLC4A4 cause proximal renal tubular acidosis: HCO3− wasting acidemia with a variety of extra-renal sequelae such as loss of vision, growth abnormalities, and intellectual disability (Igarashi et al., 1999; Salerno et al., 2019). NBCe1 has three primary protein variants (NBCe1-A, -B, and -C), each with a different expression pattern through the body (Brady et al., 2020). In the kidneys, NBCe1-A is exclusively expressed in PTs of the cortical labyrinth where it plays an essential role in both the reabsorption of filtered HCO3− (Burnham et al., 1997; Romero et al., 1997; 1998) and the ammoniagenic response (Lee et al., 2018). Hence, NBCe1-A-knockout (KO) mice are spontaneously acidemic, as is a proband with an NBCe1-A-specific nonsense mutation (Igarashi et al., 2001; Lee et al., 2018). NBCe1-B is more widely expressed, and differs from NBCe1-A in that an 85 amino acid auto-inhibitory sequence replaces a 41 amino acid auto-stimulatory sequence (McAlear et al., 2006). In the kidneys, NBCe1-B is expressed in PTs of the outer segment of the outer medulla (OSOM) where NBCe1-A is absent (Fang et al., 2018). Moreover, NBCe1-B is transcribed from an acid-sensitive promoter, which suggests renal NBCe1-B may have a role in the kidneys response to acidosis (Snead et al., 2011; Fang et al., 2018). However, in contrast to spontaneously acidemic NBCe1-A-KO mice, NBCe1-B/C-KO (KOb/c) mice exhibit normal blood pH (Salerno et al., 2019). NBCe1-C is largely identical to NBCe1-B except that a 46 amino acid carboxy-terminal appendage is replaced by a 61 amino acid sequence of unknown physiological consequence (Bevensee et al., 2000). Both NBCe1-B and NBCe1-C are expressed in neurons (predominantly NBCe1-B) and astrocytes (predominantly NBCe1-C) in the brain; although this expression pattern is reversed in cultured cells and may even be species dependent (Majumdar et al., 2008; Virreira et al., 2019). Therefore, in the context of the brain we do not distinguish between–B and–C variants, and refer to them as ‘NBCe1-B/C’ in this text.
There are eight central chemoreceptor sites, located within the brainstem, cerebellum, midbrain, and hypothalamus [reviewed in (Nattie and Li, 2012)]. Relevant to this study, NBCe1-B/C was demonstrated to contribute to the cellular mechanism underlying the chemosensitivity of astrocytes located on the ventral surface of the brainstem medulla (Turovsky et al., 2016), which are adjacent to neuronal cell bodies that comprise the retrotrapezoid nucleus (RTN) (Erlichman et al., 2004; Gourine et al., 2010; Kasymov et al., 2013; Sheikhbahaei et al., 2018). The RTN is considered the prototypical respiratory chemoreceptor for detecting changes in pH/pCO2 and mediating changes in ventilation (Guyenet et al., 2019). While not considered a primary contributor to the generation of baseline respiratory patterns, the RTN rather modifies breathing in response to changes in pH (such as MAc) and/or pCO2 (Burke et al., 2015; Souza et al., 2018). The molecular mechanism underlying RTN chemosensitivity is still controversial; however, one hypothesis is centered on an NBCe1-B/C-mediated mechanism in which chemosensitive astrocytes respond to increased acidity/pCO2 by releasing ATP, which triggers action potentials in adjacent RTN neurons resulting in increased ventilation (Gourine et al., 2010; Turovsky et al., 2016). Nevertheless, evidence that loss of NBCe1-B/C attenuates central chemoreception in vivo is lacking.
The fact that NBCe1-B/C, appears positioned to contribute to both renal (NBCe1-B) and respiratory (NBCe1-B/C) responses to MAc, suggests that NBCe1-B could be a fundamental component of the cellular machinery underlying the integrated physiologic response to acid-base disturbance. Thus, the overarching goal of this study was to establish the role of NBCe1-B/C in control of whole-body acid-base balance. First, we validate a novel, commercially available, NBCe1-B/C specific antibody, which is used throughout the study in the context of both the brain and the kidney. Second, we describe the abundance responses of both NBCe1-A and NBCe1-B in kidney during MAc. Third, we describe the effect of NBCe1-B/C loss on the respiratory and renal responses during MAc using the KOb/c mouse model (Salerno et al., 2019). Lastly, we examine the abundance response during MAc of PEPCK and GS in PTs of WT and KOb/c mice.
2 Materials and methods
2.1 Ethical statement
All procedures involving animals were approved by and performed in accordance with the rules and recommendations of the Institutional Animal Care and Use Committee of the University at Buffalo.
2.2 Mice
The generation and genotyping of the KOb/c mouse on a C57BL/6J background have been previously reported (Salerno et al., 2019). For this study, heterozygous parents were produced by backcrossing heterozygous mice with verified C57BL/6J wild-type mice (Jackson Laboratory, Bar Harbor, ME). Heterozygous progeny (F6 to F17 generation, making them at least 99% genetically identical) were crossed to produce experimental WT and KOb/c mice for this study. As previously reported, KOb/c mice exhibit increased mortality [50% at 5 weeks (Salerno et al., 2019)] so we were constrained to working with mice between 4–5 weeks of age in order to maximize the likelihood of survival during study, while still using mice past the age of full structural and functional kidney development (Satlin et al., 2003; Seely, 2017).
2.3 Metabolic studies and induction of metabolic acidosis
WT and KOb/c mice between 4-5-weeks old were housed in metabolic chambers (Tecniplast, 3600M021) and given standard powered rodent chow (Teklad 8604). After a 1-day acclimation period with plain tap water, experimental groups were subjected to 1–3 days (duration depending on the experiment) of control or MAc-challenged conditions. MAc was induced by adding 0.28 M ammonium chloride (NH4Cl) + 0.5% sucrose (for palatability) in drinking water (tap water). Control groups were given drinking water containing only 0.5% sucrose for the same 1–3-day duration. NH4Cl administration is a common method for induction of MAc and enhancement of ammoniagenesis in both humans and animals (Rector et al., 1955; Amlal et al., 2004; Alam et al., 2020). All mice had free access to powdered standard rodent chow for the duration of the experiment. During the acclimation period, body weight, food intake, and fluid intake were monitored. During the experimental period, urine and fecal excretion were also monitored, and urine was collected each day under mineral oil (to prevent evaporation). Urine samples were spun at 10,000 RCF for 5 min to remove any solid particles and frozen at −80°C until urinalysis. Since repeated measures of metabolic and urinary parameters were possible in mice subjected to experiments of 2-, and 3-day durations before sacrifice for plasma electrolyte analysis, this led to a larger sample size for these parameters for day 1, compared to day 2 or day 3. Sample sizes for mice kept under 1, 2, or 3 days of control or MAc-challenged conditions are shown in Table 1, which relates to the data presented in Table 2 and Figure 7.
TABLE 1
| Group | Day 1 | Day 2 | Day 3 |
|---|---|---|---|
| Control WT | n = 16M/14F | n = 11M/9F | n = 8M/6F |
| Control KOb/c | n = 15M/11F | n = 11M/7F | n = 7M/4F |
| MAc WT | n = 17M/19F | n = 11M/13F | n = 6M/9F |
| MAc KOb/c | n = 16M/13F | n = 11M/8F | n = 6M/4F |
| Sample sizes given as n = male/female and relates to data presented in Table 2 and Figure 7 | |||
Sample size for metabolic cage experiments.
TABLE 2
| Parameter | WT | KOb/c | p-value |
|---|---|---|---|
| Control conditions | |||
| Body weight (g) | 15.5 ± 0.2 (64) | 13.9 ± 0.3 (55) | <0.001* |
| Daily food intake (g/day) | 4.2 ± 0.1 (64) | 3.7 ± 0.1 (55) | <0.001* |
| Daily food intake (g/day/body weight) | 0.270 ± 0.004 (64) | 0.271 ± 0.004 (55) | 0.643 |
| Daily fluid intake - 0.5% sucrose (mL/day) | 6.1 ± 0.1 (64) | 5.6 ± 0.1 (55) | 0.022* |
| Daily fluid intake - 0.5% sucrose (mL/day/body weight) | 0.39 ± 0.01 (64) | 0.41 ± 0.01 (55) | 0.229 |
| Plasma [Na+], mEq/L | 145.3 ± 0.5 (27) | 144.0 ± 0.3 (24) | 0.006* |
| Plasma [Cl−], mEq/L | 109.9 ± 0.6 (26) | 106.8 ± 0.4 (24) | <0.001* |
| BUN, mg/dL | 31 ± 1 (27) | 24 ± 1 (23) | <0.001* |
| MAc conditions | |||
| Body weight (g) | 14.6 ± 0.2 (75) | 13.3 ± 0.3 (58) | 0.003* |
| Daily food intake (g/day) | 3.2 ± 0.1 (75) | 2.9 ± 0.1 (58) | <0.001* |
| Daily food intake (g/day/body weight) | 0.223 ± 0.004 (75) | 0.219 ± 0.003 (58) | 0.081 |
| Daily fluid intake - 0.28M NH4Cl + 0.5% sucrose (mL/day) | 5.1 ± 0.1 (75) | 4.9 ± 0.3 (58) | 0.083 |
| Daily fluid intake - 0.28M NH4Cl + 0.5% sucrose (mL/day/body weight) | 0.35 ± 0.01 (75) | 0.37 ± 0.01 (58) | 0.965 |
| Plasma [Na+], mEq/L | 149.1 ± 0.5 (32) | 148.7 ± 0.3 (26) | 0.657 |
| Plasma [Cl−], mEq/L | 120.7 ± 0.7 (32) | 117.5 ± 1.2 (25) | <0.001* |
| BUN, mg/dL | 40 ± 1 (32) | 35 ± 2 (26) | 0.001* |
Metabolic and electrolyte status of WT and KOb/c mice over 1–3 days of control or MAc conditions.
Values represent mean ± SEM, from all experiments where animals were kept under 1, 2, or 3-days of control or metabolic acidosis (MAc) conditions. Numbers in parentheses are the numbers of animals in each group. See Table 1 for per-day sample sizes. p-values calculated by 2-way ANOVA.
2.4 Plethysmography
The breathing activity of unrestrained mice was measured without anesthesia as described previously (Morse et al., 2012). Individual animals were kept in a plexiglass plethysmography chamber connected to an empty reference chamber for buffering changes in atmospheric pressure (PLY4213, Buxco Research Systems, Wilmington, NC). The plethysmograph was connected to a Rodent Bias Flow Supply (BFL0250) to draw expired CO2 out of the chamber and provide a constant flow of room air at a flow rate of 2.5 L/min. Signals were collected with a barometric pressure sensor attached to a port on the reference chamber. The sensor was connected to a MAX 1500 preamplifier, and signals were visualized and collected using BioSystem XA software. The chamber and software were calibrated for mice at the beginning of each experiment using an injection of 1 mL of air through the base port of the chamber. To limit interference, exclusion parameters were set as follows: Max expiration time–0.3 s, Min Tidal volume–0.02 mL, Min Inspiration time–0.03 s. Recordings were taken once mice settled into a period of quiet breathing, after a minimum 30-min acclimation period. Each recording consisted of 15 min, during which tidal volume, frequency, and minute volume were averaged over 5 s intervals. Periods of activity or sniffing were noted and excluded from analysis. Tidal volume and minute volume were normalized to body-weight. Baseline parameters were gathered by averaging data from 2 consecutive days of mice housed in unchallenged conditions, prior to each mouse being given a 3-day MAc challenge.
2.5 Blood gas measurements
To obtain repeated daily blood pCO2 and pH measurements in mice without anesthesia, mice were restrained using 50 mL conical tube, modified by cutting a breathing hole at the conical end and a hole for tail access through the screw cap. After allowing 5 min for the mice to acclimate, an incision was made in the lateral tail vein using a 18G needle. 6–10 µL of blood was drawn from the incision using a P10 pipette and immediately transferred to a 1.5 mL Eppendorf containing 25 µL of prewarmed (37°C) mineral oil to prevent degassing of the blood sample. pCO2 was immediately measured using a micro-carbon dioxide electrode (MI-720; Microelectrodes Inc, Bedford NH), that had been calibrated in 1L CO2/HCO3−-containing solutions gassed to 3% (22.8 mmHg), 5% (38 mmHg), or 8% (60.8 mmHg) CO2 concentrations at pH 7.4 and maintained at 37°C (in mM: 5 HEPES, 10 glucose, 5 KCl, 0.8 MgCl2, 1.35 CaCl2, [127, 119, or 106] NaCl, [13, 21, or 34] NaHCO3; the varying NaCl and NaHCO3 concentrations represent those used for the 3%, 5%, and 8% CO2 solutions, respectively). Following measurement of pCO2, pH was immediately measured using a micro-pH electrode (Orion 9810BN, Thermo Fisher Scientific). Calculation of [HCO3−] was derived from the Henderson-Hasselbach equation (). Specifically [HCO3−] = 0.03 x (pCO2 in mmHg) x 10(pH–6.125).
2.6 Blood electrolyte measurements
Mice were anesthetized with isoflurane (5%, inhaled) and blood drawn by cardiac puncture was immediately transferred into a blood metabolite test card and analyzed using an Epoc reader according to the manufacturer’s instructions (both Siemens Medical Solutions United States Inc., Malvern, PA).
2.7 Urinalysis
24-h urine collections obtained from mice housed in metabolic cages for 1–3 days (see ‘Metabolic Studies’ above) were used to assess daily NH4+ excretion, daily TA excretion, and daily urine pH. Since mice were sacrificed after each experimental duration for electrolyte analysis, there are larger sample sizes for day 1 than for day 2 or day 3 within the urinalysis data set (Figure 7). Urine NH4+ concentrations were assessed using a commercially available kit (AA0100, Sigma-Aldrich, St. Louis, MI) that was modified for use in 96-well plates, with samples diluted 1:100 and ran in triplicate. Daily NH4+ excretion rates were calculated using 24-h urine NH4+ concentrations and volumes. Titratable acid (TA) content was measured as described previously (Chan, 1972; Lee et al., 2009). Briefly, 25 µL of 0.1 M HCl was added to 25 µL of urine, boiled for 2 min, and let cooled for 1 min. The volume of 0.4 M NaOH needed to bring the sample pH to 7.4 was quantified. Samples of distilled (DI) water were run in parallel. The total number of moles needed to bring samples to pH 7.4, less the moles needed to bring the DI water to pH 7.4, was multiplied by 24-h urine volumes to yield daily TA excretion. Urine pH was measured using a micro-pH electrode (Orion 9810BN, Thermo Fisher Scientific).
2.8 Antibodies
The Total-NBCe1 antibody (affinity for all NBCe1 protein variants) was purchased from Elabscience Biotechnology, Inc. (E-AB-14348, Houston TX; raised in rabbit), and has been previously validated (Salerno et al., 2019). The Total-NBCe1 antibody was used at a 1:1,000 concentration for Western blot. The NBCe1-A specific antibody generously gifted by Dr. Michael Romero (Mayo Clinic, Rochester MN; raised in chicken) has been previously validated (Lee et al., 2018), and was used at a 1:1,000 concentration for Western blot. The NBCe1-B/-C antibody was purchased from Santa Cruz Biotechnology, Inc. (sc-515543, Dallas TX; raised in mouse), and was used at a 1:1,000 concentration for Western blot and 1:100 dilution for immunohistochemistry (IHC). The NBCe1-B/C antibody was raised against an epitope that corresponds to the first 41 amino acids of the unique amino-terminal sequence of NBCe1-B/C (MEDEAVLDRGASFLKHVCDEEEVEGHHTIYIGVHVPKSYRR). The Phox2B antibody was purchased from Thermo Fisher (PA5-115754; raised in rabbit), and was used at a 1:500 concentration for IHC. The glutamine synthetase (GS) antibody was purchased from Abcam (ab73593; raised in rabbit), and was used at a 1:20,000 concentration for IHC. The phosphoenolpyruvate carboxykinase (PEPCK) antibody was purchased from Cayman Chemicals (10004943; raised in rabbit), and was used at a 1:10,000 dilution for IHC.
The secondary HRP-conjugated anti-chicken immunoglobulin antibody was purchased from Thermo Fischer Scientific (A16054; raised in goat), and used at a 1:2,000 dilution for Western blot and 1:1,000 dilution for IHC. The secondary HRP-conjugated anti-mouse immunoglobulin antibody was purchased from MP Biomedicals (55563, Solon OH; raised in goat), and used at a 1:2,000 dilution for both Western blot and 1:1,000 dilution for IHC. The secondary HRP-conjugated anti-rabbit immunoglobulin antibody was purchased from MP Biomedicals (55685, Solon OH; raised in goat), and used at a 1:1,000 dilution for IHC.
2.9 Oocyte preparation
Oocytes were extracted from female Xenopus laevis frogs (Xenopus Express, Brooksville, FL) as described elsewhere (Musa-Aziz et al., 2010). In brief, ovaries of anesthetized frogs (0.2% tricaine) were surgically removed and washed in Ca2+-free “NRS” buffer (in mM: 82 NaCl, 2 KCl, 20 MgCl2, 5 HEPES, adjusted to pH 7.45 with NaOH). Frogs were then euthanized via exsanguination. Oocytes were extracted from ovaries by digestion in NRS buffer plus 2 mg/mL type-IA collagenase (C2674: Sigma-Aldrich, St. Louis, MO) for 15–35 min, and washed in NRS buffer, followed by ND96 solution, and finally with OR3 medium. OR3 medium contains 14 g/L of Leibovitz’s L-15 medium (10–045-CV, Thermo Fisher Scientific), 100 U/mL penicillin, 100 μg/mL streptomycin, 5 mM HEPES, and adjusted to pH 7.5 using NaOH. The osmolality of OR3, measured using a Vapro vapor pressure osmometer (Wescor, Logan, UT), was adjusted to 195 ± 5 mOsmol/kg osmolality with H2O.
The construction of the plasmids for expression of WT human NBCe1-A or NBCe1-B in Xenopus oocytes has been described previously (Lee et al., 2011; Myers et al., 2016b). Each construct included a carboxy-terminal enhanced green fluorescent protein (EGFP) tag (NBCe1-A-EGFP.pGH19 and NBCe1-B-EGFP.pGH19) used to confirm expression in oocytes before homogenization. Plasmids were transformed into E. coli and cultured overnight. After isolation, plasmids were linearized using NotI, followed by purification using the MinElute PCR Purification Kit (28004, Qiagen). Linearized DNA was transcribed to capped cRNA using the T7 mMessage mMachine Transcription kit (Invitrogen, Carlsbad, CA). cRNA was further purified with the RNeasy MinElute Cleanup kit (74204, Qiagen) before quantification using a Nanodrop 2000 (Thermo Fisher Scientific). A 25 nL bolus of cRNA (or water for negative control) was injected into oocytes using a Nanoject III programmable nanoliter injector (Drummond Scientific Co., Broomall, PA).
2.10 Western blotting
Xenopus oocytes: Oocytes were prepared as previously described (Myers et al., 2016a). In brief, cells were incubated for 3 days in OR3 medium to allow for protein expression and cells were homogenized in TBS buffer containing 1% Triton X-100 and Complete Protease Inhibitor Cocktail. Yolk platelets and other insoluble components were pelleted by low-speed centrifugation: 850x RCF for 5 min. The supernatant was mixed with gel-loading buffer and the equivalent of ¼ an oocyte was loaded into each well for Western blotting.
Mouse kidneys: Excised kidneys were placed into of ice-cold homogenization buffer (HB; in mM: 100 NaCl, 25 HEPES, 250 sucrose, pH 7.4) plus cOmplete Protease Inhibitor Cocktail (Pierce A32963, Thermo Fisher Scientific). For separation of cortical and medullary protein samples, the cortex and medulla of freshly excised kidneys were separated under a dissecting microscope, guided by the contrast in color of the two zones, prior to homogenization. Whole kidney, cortical, or medullary membrane protein homogenates were prepared from dissected tissue using fractional centrifugation techniques. Briefly, tissue was homogenized with a handheld homogenizer (D1000, Benchmark Scientific, Edison, NJ), resuspended in 5 mL of HB, and spun at 1075 RCF for 15 min with the resulting supernatant retained. Membrane fragments were precipitated from the supernatant by ultracenxtrifugation using a Beckman Optima L-70 Ultracentrifuge (Beckman Coulter Inc., Indianapolis, IN) at 204,300x RCF for 45 min. The resulting pellet was resuspended in 300 µL HB. Homogenate protein concentrations were determined using the BCA colorimetric assay (Pierce 23227, Thermo Fisher Scientific), modified for microplate conditions. Immediately before gel loading, samples were pre-treated with a 0.1 M dithiothreitol (DTT) solution and denatured with LDS (Invitrogen NP0007, Thermo Fisher Scientific). DTT treatment is necessary to remove interfering endogenous mouse immunoglobulin for NBCe1-B probed kidney blots since the secondary antibody recognizes mouse immunoglobulin which, when intact, interferes with the measurement of NBCe1-B abundance (Brady; unpublished observations). DTT reduces the disulfide bonds of intact immunoglobulin resulting in lower molecular weight subunits that do not interfere with the NBCe1 band (Ahmad-Zadeh et al., 1971). DTT treatment is also known to dissociate NBCe1 dimers (Kao et al., 2008), resulting in only bands representing NBCe1 monomer abundance. Protein (10 µg/lane, unless specified) was resolved on a 3%–8% Tris-Acetate gel (Invitrogen EA0378BOX, Thermo Fisher Scientific) and transferred onto a PVDF membrane (Invitrogen LC 2005, Thermo Fisher Scientific). For studies of NBCe1-A and NBCe1-B abundance, age- and sex-matched littermates were paired between control and experimental groups, and each sample was run in duplicate on the same gel as its pair. To confirm even protein loading, prior to antibody application, each blot was treated with the reversible Memcode total-protein stain and blots with clearly unequal loading were discarded (Pierce 24585, Thermo Fisher Scientific). Additionally, Memcode stained blots were imaged using the visible light setting of a myECL imager (Thermo Fisher Scientific), and used to normalize differences in protein between lanes (Janes, 2015). After the total protein was imaged and the stain was erased, the PVDF membrane was incubated overnight in Tris-buffered saline (TBS; in mM: 10 HCl, 150 NaCl) containing 0.1% Tween-20 (0.1% TBS-T) and 4% milk powder at 4°C. The next day, the membrane was probed with primary antibody diluted in 2% milk powder prepared in 0.1% TBS-T, followed by an HRP-conjugated secondary antibody diluted similarly. Immunoreactive protein bands were visualized and imaged using ECL2 reagent (Pierce 32106, Thermo Fisher Scientific) and the chemiluminescent signal was imaged using the myECL imager after confirming the absence of pixel saturation. Densitometry was performed using FIJI software on both total-protein stained and antibody probed blots (Schindelin et al., 2012; Janes, 2015). The images of the total-protein stained blots were background subtracted using the FIJI rolling ball subtraction algorithm with a 100-pixel radius. Total-protein was quantified using densitometry of the entire lane profile plotted from rectangles drawn around each lane of the blot. Individual band densitometry results from the antibody-probed blots were normalized to their respective total-protein results and these normalized ratios were subjected to statistical analysis.
2.11 Histological tissue section preparation
Kidneys and brainstems were excised post-euthanasia and immediately placed in 4%-paraformaldehyde for 24-h at 4°C (kidneys cut transversely in half). Tissue was then stored in a 70% ethanol solution at 4°C until embedding. Before paraffin embedding of the brain, a transverse cut was made at the level of the rostral medulla/caudal pons, suggested as the optimal location for obtaining sections containing the RTN (Lavezzi et al., 2019). Tissue was embedded in paraffin blocks using standard embedding procedures. Briefly, tissue was dehydrated through incubations in 80% and 95% ethanol, 45 min each, and followed by 3 changes of 100% ethanol, 1 h each. Tissue was cleared through 2 changes of xylene, 1 h each, and placed in molten paraffin overnight (H-PF, General Data, Cincinnati, OH). Tissue was then embedded, cut side down, in paraffin blocks. Tissue was sectioned at a thickness of 5 μm, mounted on frosted slides, and dried at 37°C overnight.
2.12 Immunohistochemistry and histological staining
Standard immunoperoxidase procedures were used for chromogenic immunostaining. Briefly, sections were deparaffinized in xylene, rehydrated in decreasing ethanol concentrations, and rinsed in cool tap water. Sections were incubated in a Tris/EDTA solution (in mM: 10 Tris-base, 1 EDTA; pH 9–9.1) at 95°C for 40 min and let cooled at room temperature for 20 min. Endogenous peroxidase activity was blocked using Peroxidase Suppressor (35000, Thermo Fisher Scientific) for 10 min. Sections were rinsed 2x for 3 min in TBS with 0.05% Tween 20 (0.05% TBS-T). The sections were blocked with Rodent Block M (for NBCe1-B and Phox2B staining; Biocare Medical, Pacheco, CA) or 10% normal goat serum (for PEPCK and GS staining; Thermo Fisher Scientific) for 30 min. For PEPCK and GS staining, sections were additionally permeabilized in 0.5% Triton X-100 prepared in TBS for 15 min. Sections were incubated overnight in a humidified chamber at 4°C with primary antibody dilutions prepared in a TBS solution with 5% BSA (5% TBS-BSA). The next day, sections were washed 3x 5-min with 0.05% TBS-T. Sections were incubated with HRP-conjugated secondary antibody diluted in 5% TBS-BSA for 1 h at room temperature, and again washed 3x 5-min with 0.05% TBS-T. Sections were then exposed to diaminobenzidine (DAB) for 10 min. To counterstain nuclei, sections were rinsed with DI water and stained with hematoxylin (Abcam; hematoxylin ab220365) for 1 min and rinsed with DI water. All sections were dehydrated with graded ethanol solutions and xylene, and mounted for light microscopy. Comparisons of labeling were made only between sections from the same immunohistochemistry experiment, treated with identical reagents. In some replicates, sections were included that were only treated with primary or secondary antibodies as internal controls. Images were taken with a Leica DM 6B upright microscope with identical capture settings between slides from the same experiment. For analysis of NBCe1-B/C expression intensity in brainstem IHC images in Figure 2, images were converted to 8-bit greyscale images and inverted, and the average pixel intensity was measured within a region of interest (ROI) containing the tissue section using FIJI. Similar measurements were made for a background ROI, which was subtracted from the tissue section ROI measurement. For quantification of PEPCK and GS expression in Figures 8, 9, high magnified images were taken across the cortical and OSOM regions (5-images per region). Individual PTs were manually traced (identified by the presence of a prominent apical brush border; in contrast, distal tubules have sparse microvilli, which makes the lumen appear to be wider), and images were converted to 8-bit greyscale images and inverted. A 30–255-bit threshold was applied to all images in order to limit inclusion of background pixels, and the mean pixel intensity of selected tubules was measured. The average pixel intensity across all 5 images within the cortical or OSOM regions was normalized to the average in the WT cortex.
2.13 Statistical analysis
Results are presented as mean ± SEM, with n referring to the number of animals studied. In all analyses the threshold of p < 0.05 was used to determine statistical significance. Normality of data was tested in GraphPad (v9.0) using the D'Agostino-Pearson omnibus test and statistical comparisons between two groups (i.e., WT and KOb/c mice) with normal distributions were performed using Student’s two-tailed unpaired t-test. Non-normal distributions were only observed in the control NH4+ excretion data set (Figure 7A, left) and thus for these comparisons only, the Mann-Whitney test (2-tailed, unpaired) was used. p-values were Bonferroni corrected for multiple comparisons when appropriate. For plethysmography and blood gas experiments (Figures 5, 6), in which repeated measures in individual mice were possible, repeated measures ANOVA (RM-ANOVA) was used to assess the response of WT and KOb/c groups to MAc, while comparisons between WT and KOb/c mice at each timepoint was assessed using Student’s unpaired two-tailed t-test. Since in these experiments the percent change from baseline was also calculated, animals with outliers (defined as+/-2 SD from the mean) in the baseline (timepoint “0”) data set only, were excluded from analysis; which equated to 1 animal from the plethysmography data set, 1 animal from the pCO2 data set, and 2 animals from the plasma pH data set being excluded. Conversely, assessment of plasma electrolytes required sacrificing mice after 1-, 2-, or 3-days of control or MAc-challenged conditions; thus each day represents a different cohort of mice. However, in these same experiments, metabolic and urinary acid-excretion parameters were recorded daily, leading to sequentially larger sample sizes for day 1, then day 2 or day 3. Thus, comparison between WT and KOb/c metabolic and urinary acid-parameters over the 3-day experimental time course were assessed by 2-way ANOVA, using genotype and time as independent variables, with the main effect of genotype specifically reported (“G”, Table 2 and Figure 7). For urinary parameters in Figure 7, the genotype x time (“G*T”) interaction effect is also reported and comparison of WT and KOb/c responses were assessed at each timepoint using Student’s unpaired two-tailed t-test. Both male and female mice were used non-discriminately throughout the study based on availability at the time of each experiment. Inclusion of sex as an independent factor in ANOVA was used to assess for a significant effect of sex; if a significant sex interaction was found this is reported specifically. All analyses were performed in Prism GraphPad version 9 or IBM SPSS. Figures were prepared using Microsoft PowerPoint, Microsoft Excel, BioRender.com, and Prism GraphPad version 9.
3 Results
3.1 Validation of an NBCe1-B/C specific antibody
Protein homogenates prepared from NBCe1-A-EGFP cRNA-, NBCe1-B-EGFP cRNA-, or water- injected oocytes were loaded on a single gel, in triplicate. After protein transfer, the PVDF membrane was cut into thirds, and antibodies (Abs) specific to Total-NBCe1 (affinity for all NBCe1 variants), NBCe1-A, or NBCe1-B/C were used to individually probe the three membrane sections (Figure 1A). The anti-Total-NBCe1-Ab-probed blots reported bands that are consistent with the molecular weights of NBCe1-EGFP monomers and dimers (Parker et al., 2012) in both the NBCe1-A-EGFP and NBCe1-B-EGFP-loaded lanes (Figure 1A, left). The anti-NBCe1-A and anti-NBCe1-B/C-Ab-probed blots only reported bands in the lanes loaded with NBCe1-A-EGFP or NBCe1-B-EGFP protein, respectively (Figure 1A, center and right).
FIGURE 1
To assess the validity of the NBCe1-B/C specific antibody in mouse kidney preparations (where NBCe1-A and NBCe1-B are expressed, but NBCe1-C is not), we probed for NBCe1-B in WT and KOb/c kidney protein homogenates treated with 0.1M dithiothreitol (DTT; see ‘Methods–Western blotting’ for rationale; Figure 1B). We detect immunoreactivity consistent with monomeric NBCe1-B in homogenates from WT but not from KOb/c mice. Thus the antibody is appropriate for specific detection of NBCe1-B in the kidney.
3.2 Expression of NBCe1-B/C in the brainstem of WT and KOb/c mice
Before testing the hypothesis that NBCe1-B/C has a role in the respiratory response to acidosis we first confirmed the loss of NBCe1-B/C in the brainstem medulla of KOb/c mice. Sections were cut from the rostral medulla of the brainstem, starting from the dotted line illustrated in Figure 2A and moving rostrally, which is suggested to be the optimal sampling location for sampling the RTN (Lavezzi et al., 2019). The images in Figure 2B demonstrate Phox2B expression (yellow arrowheads), a transcription factor expressed in RTN neurons (Stornetta et al., 2006; Dubreuil et al., 2008; Ruffault et al., 2015), in both WT (top) and KOb/c (bottom) medullary brainstem sections. Thus, Phox2B- expressing neurons appear intact in the brainstem medulla of KOb/c mice. Figure 2C shows representative images of medullary brainstem sections from WT (top) and KOb/c (bottom) mice probed with the NBCe1-B/C antibody, showing absence of NBCe1-B/C immunoreactivity in brainstem medulla of KOb/c mice. Figure 2D summarizes the results of three experimental replicates in which the intensity of NBCe1-B/C immunolabel was quantified in identically treated/imaged WT and KOb/c sections, with the percent of NBCe1-B/C expression in KOb/c sections calculated relative to WT. Similar calculations were made for negative control sections in which either the primary antibody or the secondary antibody was excluded (−1° and −2°, respectively; images not shown). The chromogenic signal intensity in KOb/c sections treated with the NBCe1-B/C antibody was significantly less than in WT sections (p = 0.015, Bonferroni corrected), and was not significantly different from either of the negative controls, confirming the absence of majority NBCe1-B/C expression in the brainstem of KOb/c mice.
FIGURE 2
3.3 Expression of kidney NBCe1-A and NBCe1-B under control and MAc-challenged conditions
The original characterization of NBCe1-B expression in the kidney was in the context of the congenitally acidemic NBCe1-A KO mouse, and since NBCe1-B expression is controlled by an acid-sensitive promoter (Snead et al., 2011), the NBCe1-B expression described in NBCe1-A KO mice may not be representative of expression in WT mice. Therefore, we aimed to determine the expression pattern and abundance response of NBCe1-B in WT mice at baseline and during MAc. We also investigated the abundance response of NBCe1-A during MAc in both WT and KOb/c mice.
Using the NBCe1-A and NBCe1-B/C specific antibodies described in Figure 1, we first assessed the abundance of NBCe1-A and NBCe1-B in WT cortical (cor) and medullary (med) protein preparations by Western blot (Figures 3A, B). Although the NBCe1-B/C specific antibody could also recognize NBCe1-C, only NBCe1-B is expressed in the kidney (Fang et al., 2018). Since these preparations contained less protein compared to whole kidney lysates, in this experiment two µg of protein was loaded per lane. The Memcode total protein stain was used to normalize protein loading/transfer among lanes (data not shown). We found, as expected, that NBCe1-A abundance is significantly greater in the cortex than medulla (p = 0.002; Figure 3C, left). On the other hand, NBCe1-B abundance was not significantly different between the cortex and medulla (Figure 3C, right). To determine the specific location of NBCe1-B expression in WT kidneys we used immunohistochemistry (Figures 3D–F, n = 3 replicates for each). In kidney sections from control WT mice, we observed NBCe1-B immunoreactivity on the basolateral membrane of PTs located in cortical medullary rays, as well as in PTs of the OSOM (Figure 3D; yellow outlined arrowheads indicate representative tubules that have positive basolateral immunoreactivity). After 3-days of MAc, we qualitatively observed a greater intensity of basolateral NBCe1-B staining in the PTs of the cortical medullary ray and OSOM (Figure 3E). As a control, basolateral NBCe1-B immunoreactivity was absent in KOb/c mice even after 3 days of MAc (Figure 3F, n = 3 replicates). Together, these data indicate that NBCe1-B in WT mice is expressed primarily in the PTs of the cortical medullary ray and OSOM, with no obvious expression detectable in PTs of the cortical labyrinth, even after 3-days of MAc-challenged conditions.
FIGURE 3
Next, we assessed the change in protein abundance of both NBCe1-A and NBCe1-B variants in the kidneys of WT mice, as well as the change in NBCe1-A kidney abundance in KOb/c mice, during MAc. In these experiments, sex-matched littermates were paired, with one subjected to control conditions (con) and the other to MAc-challenged conditions for 1 or 3 days. For Western blotting, 10 µg of kidney lysate protein was loaded per lane. Prior to antibody application each blot was treated with the reversible Memcode total-protein stain in order to provide an index for normalizing protein loading/transfer among lanes (data not shown). The WT membrane was then cut, and probed with either the NBCe1-A or NBCe1-B specific antibody, while the KOb/c membrane was probed with just the NBCe1-A specific antibody. Figure 4A shows a representative Western blot from a 3-day experiment demonstrating NBCe1 monomer immunoreactivity. NBCe1 abundance (from Western blot) was normalized to total-protein abundance (from Memcode stain) and the ratio of this normalized abundance was calculated between paired MAc-challenged and control littermates; thus, each point in Figure 4B represents a single MAc/control pair (i.e., control = 1, represented by the dotted line in Figure 4B). In WT mice, after 1 or 3 days of MAc, NBCe1-A abundance was not significantly different from control (Figure 4B). On the other hand, in the same WT mice, NBCe1-B abundance was significantly increased after both 1- and 3-days of MAc (1-day ratio, p = 0.033; 3-day ratio, p < 0.001; Figure 4B). Finally, similar to WT mice, there was no significant change in NBCe1-A abundance in KOb/c mice after 1- or 3-days of MAc (Figure 4B). Overall, this data indicates that NBCe1-B is expressed in the PTs of the medullary and OSOM in WT mice and that the abundance of NBCe1-B, but not NBCe1-A, increases during MAc.
FIGURE 4
3.4 Respiratory response of KOb/c mice during MAc
Next, we assessed the ventilation of WT and KOb/c mice prior to, and during each day of, a 3-day MAc-challenge using unrestrained whole-body plethysmography. Ventilation parameters (minute volume, tidal volume, and frequency) of WT and KOb/c mice were assessed for 2 days under unchallenged conditions and averaged to establish a baseline (Figures 5A–F, timepoint “0”), followed by repeated measures after each 24-h period of a 3-day MAc-challenge (Figures 5A–F, timepoints “1–3”). Minute volume and tidal volume were corrected for body-weight in individual mice. Figures 5A,C,E show the average values for WT and KOb/c groups at each timepoint. At baseline, KOb/c mice had a significantly higher minute volume than WT (p = 0.019; Figure 5A, timepoint 0) due to a significantly greater baseline tidal volume (p = 0.038; Figure 5C, timepoint 0), while there was no significant difference in baseline frequency (Figure 5E, timepoint 0). There were no significant differences in the values of these parameters for the duration of the 3-day MAc-challenge (Figures 3A,C,E, timepoints 1–3).
FIGURE 5
Since there were significant baseline differences in ventilation parameters between WT and KOb/c mice, we assessed the respiratory response of WT and KOb/c mice to MAc by calculating the percent change from baseline of each ventilatory parameter during the 3-day MAc-challenge (Figures 3B,D,F). MAc had a significant effect on WT minute volume (p < 0.001 by RM-ANOVA; Figure 3B) but had no significant effect on KOb/c minute volume (p = 0.227 by RM-ANOVA; Figure 3B). Furthermore, after the first day of MAc, pairwise comparisons demonstrate a significantly greater percent increase in minute volume in WT mice compared to KOb/c mice (p = 0.026; Figure 5B, timepoint 1). MAc had a significant effect on tidal volume in both WT and KOb/c mice (WT: p < 0.001, KOb/c: p = 0.007 by RM-ANOVA; Figure 5D), however WT mice had a significantly greater percent increase in tidal volume compared to KOb/c mice after the first day of MAc (p = 0.010; Figure 5D, timepoint 1). Lastly, MAc had a significant effect on respiratory frequency in both WT and KOb/c mice (WT: p < 0.001, KOb/c: p = 0.007 by RM-ANOVA; Figure 5F), but there were no significant differences in the percent change in frequency between WT and KOb/c mice at any timepoint (Figure 5F). Overall, the absence of an increase in minute volume and diminished increase in tidal volume after 1 day of MAc in KOb/c mice is consistent with the hypothesis that the respiratory response to MAc is impaired in KOb/c mice.
3.5 Acid-base status of KOb/c mice during MAc
To determine the effect of NBCe1-B/C loss on the defense of acid-base status during MAc, we assessed the pCO2, pH, and [HCO3−] of WT and KOb/c mice at baseline (Figures 6A–F, timepoint “0”) followed by repeated measures after each 24-h period of a 3-day MAc-challenge (Figures 6A–F, timepoints “1–3”). Figures 6A,C,E show the average values for WT and KOb/c groups at each timepoint. At baseline, KOb/c mice had a significantly lower pCO2 than WT mice (p = 0.046; Figure 6A, timepoint 0), but had no significant difference from WT in baseline pH or baseline [HCO3−] (Figures 6C, E; timepoint 0). During the 3-day MAc-challenge, there were no significant differences between WT and KOb/c pCO2 or [HCO3−] at any timepoint (Figures 6A–E, timepoints 1–3), however KOb/c pH was significantly lower than WT after the first day of MAc (p = 0.038; Figure 6C, timepoint 1).
FIGURE 6
Since there was a baseline difference in pCO2 between WT and KOb/c mice, we assessed the recovery of acid-base status in WT and KOb/c mice during MAc by calculating the percent change from baseline in each parameter during the 3-day MAc-challenge (Figures 6B,D,F). For plasma pH, we transformed all values to hydrogen ion concentration ([H+]) in order to directly calculate the percent change in acidity from baseline (Figure 6D). MAc had a significant effect on pCO2 in WT mice (p = 0.011 by RM-ANOVA; Figure 6B) but had no effect on pCO2 in KOb/c mice (p = 0.889 by RM-ANOVA; Figure 6B). Furthermore, after 1-day of MAc, pairwise comparisons demonstrate a significantly greater percent decrease in pCO2 in WT mice compared to KOb/c mice (p = 0.029; Figure 6B, timepoint 1). MAc had a significant effect on [H+] in both WT and KOb/c mice (WT: p = 0.039, KOb/c: p < 0.001 by RM-ANOVA; Figure 6D), however the increase in [H+] after the first day of MAc was significantly greater in KOb/c mice than in WT mice (p = 0.005; Figure 6D, timepoint 1). Lastly, MAc had a significant effect on [HCO3−] in both WT and KOb/c mice (WT: p < 0.001, KOb/c: p < 0.001 by RM-ANOVA; Figure 6F), and there were no significant differences in the percent change from baseline [HCO3−] between WT and KOb/c mice at any timepoint (Figure 6F). In summary, the lack of a decrease in pCO2 in KOb/c mice appears to underlie a greater fall in plasma pH after 1-day of MAc but does not inhibit the recovery of pH after 2- and 3-days of MAc.
3.6 Renal response of KOb/c mice during MAc
Since we observed a recovery of plasma pH in KOb/c mice to a level similar to that in WT mice, despite KOb/c mice having an impaired respiratory response (Figure 5) and more severe acidemia (Figure 6) after 1 day of MAc, we hypothesized that renal acid-excretion is enhanced in KOb/c mice during the MAc-challenge. To test this hypothesis, we subjected WT and KOb/c mice to control or MAc-challenged conditions for 1, 2, or 3 days while housed in metabolic cages and assessed daily 24-h urine collections for NH4+ excretion, titratable acid (TA) excretion, and pH. Additionally, mice were sacrificed after each timepoint via cardiac puncture for assessment of electrolytes. As expected, mice subjected to MAc-challenged conditions exhibited significantly greater NH4+ and TA excretion, and significantly lower urinary pH than animals of the same genotype under control conditions (p < 0.001 for all three parameters in both genotypes by ANOVA). Acid-excretion parameters were compared between WT and KOb/c groups using 2-way ANOVA with genotype and time as independent variables. A significant main effect of genotype (“G”) indicates a significant difference between overall group means (i.e., average daily NH4+ excretion between WT and KOb/c mice) and a significant genotype x time (“G*T”) interaction effect indicates that the difference between genotypes depends on time. Thus, pairwise comparisons between WT and KOb/c groups were assessed at each timepoint; for transparency, the significance of pairwise comparisons are reported for all parameters regardless of G*T significance.
Under control conditions, there was no significant difference between WT and KOb/c daily average NH4+ excretion (Figure 7A, control). Under MAc-conditions, there was a significant genotype x time (G*T) interaction effect (p = 0.049 ANOVA), indicating a possible difference in the time course of WT and KOb/c NH4+ excretion. Indeed, on day 2 of MAc, KOb/c mice excreted significantly more NH4+ than WT mice (p = 0.018; Figure 7A, MAc, timepoint 2). To determine if this peak in KOb/c NH4+ excretion over day 2 was a result of increased NH4+ excretion in individual mice, we calculated the change in NH4+ excretion that occurred in each animal between days 1 and 2 (ΔNH4+ day1-2, Figure 7B). Under control conditions there was no significant difference in ΔNH4+ day1-2 (Figure 7B, control). However, under MAc conditions, KOb/c mice had a significantly greater ΔNH4+ day1-2 than WT mice (p = 0.046; Figure 7B, MAc).
FIGURE 7
Along with increased NH4+ excretion, increased TA excretion and urine acidification are also expected during MAc; thus, we similarly assessed TA excretion and urine pH in WT and KOb/c mice (Figures 7C–F). Under control and MAc conditions, the daily average TA excretion was significantly less in KOb/c mice than WT mice (G: p < 0.001 and p = 0.026; Figure 7C). However, the change in TA excretion between days 1 and 2 (ΔTA day1-2) was not significantly different between WT and KOb/c mice under control conditions or MAc-conditions (Figure 7D, control and MAc). Average daily urine pH was significantly greater in KOb/c mice than WT mice while under control conditions (G: p < 0.001; Figure 7E, control). However, during MAc, there was no significant difference between the average urine pH of WT and KOb/c mice. Lastly, the change in urine pH between days 1 and 2 (Δurine pH day1-2) was not significantly different between WT and KOb/c mice under control conditions or MAc-conditions (Figure 7F, control and MAc).
Table 2 displays relevant metabolic and electrolyte daily averages measured in WT and KOb/c mice during the 1–3-days of control (0.5% sucrose added to drinking water) or MAc (0.28M NH4Cl + 0.5% sucrose added to drinking water) challenged conditions. To summarize these results, KOb/c mice were significantly smaller by body-weight, and ate and drank less compared to their WT counterparts. However, when food and fluid intake were normalized to bodyweight these differences in intake became non-significant. Under control conditions, KOb/c mice had a significantly lower [Na+] [Cl−], and BUN. During MAc [Cl−] and BUN both remained significantly lower in KOb/c mice compared to WT, while there was no significant difference in [Na+]. Overall, these results make it unlikely that differences in fluid intake, food intake, hydration status, or metabolism of NH4Cl, account for the observed differences in renal acid-excretion.
Since both male and female mice were used in these experiments, we assessed for differences in all parameters by including sex as an independent factor in ANOVA. Notably, only NH4+ excretion under the MAc condition was found to have a significant sex interaction (genotype x time x sex: p = 0.047). Analysis of the sex-split data set suggests that male KOb/c mice are the primary drivers of the increase in NH4+ excretion observed in KOb/c mice on day 2 of MAc (Day 2 [males]–WT: 216 ± 30 µmol/day, KOb/c: 411 ± 65 µmol/day, p = 0.001, n = 11 per group; Day 2 [females]–WT: 157 ± 22 µmol/day, KOb/c: 120 ± 29 µmol/day, p = 0.460, n = 13 and 7, respectively). Possible explanations for this sex difference are discussed below (see ‘Discussion’ section); however, since characterization of sex-specific differences was not a primary aim of this study and we did not observe any significant sex-interactions in any other parameters, data from male and female mice were kept pooled for reporting in Figure 7. Altogether, these data suggest that NH4+ excretion, but not TA excretion or urine acidification, is enhanced in KOb/c mice over day 2 of MAc.
3.7 Effect of NBCe1-B loss on ammonia metabolism
Results of recent studies in NBCe1-A KO mice and combined NBCe1-A/B kidney specific KO mice have indicated that both NBCe1-A and NBCe1-B are important for the normal upregulation of ammoniagenesis during MAc (Lee et al., 2018; 2022). Thus, we were surprised to observe an increase (rather than decrease) in NH4+ excretion in KOb/c mice during MAc (Figure 7). To this end, we hypothesized that in KOb/c mice, ammoniagenesis is enhanced in PTs of the cortical labyrinth, where only NBCe1-A and not NBCe1-B is expressed (Figure 3). To test this hypothesis, we compared the expression of PEPCK and GS between WT and KOb/c PTs located in the cortical labyrinth and OSOM after 2-days of MAc-challenged conditions. MAc normally stimulates an increase in PEPCK expression and a decrease in GS expression. We found no significant difference between WT and KOb/c PEPCK expression in the cortex or in the OSOM (cortex, p = 0.743; OSOM, p = 0.112; Figures 8A–C), indicating PEPCK expression is stimulated to a similar extent in WT and KOb/c mice. Conversely, GS expression in the cortex was significantly lower in KOb/c mice than WT mice (p = 0.016), while there was no significant difference between WT and KOb/c GS expression in the OSOM (p = 0.550; Figures 9A–C). This result indicates that the decrease in GS expression expected during MAc is enhanced in PTs of the cortical labyrinth of KOb/c mice, overall supporting the hypothesis that ammoniagenesis is stimulated to a greater extent in KOb/c mice.
FIGURE 8
FIGURE 9
4 Discussion
This study provides novel information regarding the molecular mechanisms underlying the renal and respiratory responses to acidosis. In summary: we investigated NBCe1-B expression in the WT kidney, finding NBCe1-B to be expressed in PTs of the cortical medullary ray and OSOM, but not in PTs of the cortical labyrinth (where NBCe1-A is specifically expressed). Moreover, in response to MAc, NBCe1-B abundance significantly increased in the WT kidney, while there was no change in NBCe1-A abundance in either WT or KOb/c kidneys. We further demonstrate the absence of NBCe1-B/C expression in the brainstem of KOb/c mice. Consequently, during MAc, KOb/c mice do not exhibit the expected increase in minute ventilation and have a more severe decrease in plasma pH than WT mice as they are unable to blow off CO2. Surprisingly, KOb/c mice ultimately recovered their plasma pH to the same level as WT mice, suggesting that the renal response is compensating for the impaired respiratory response during MAc, even in the absence of renal NBCe1-B. Indeed, we observed enhanced urinary NH4+ excretion in KOb/c mice during MAc; a result that is seemingly at odds with results of recent studies indicating that loss of NBCe1-B, at least in the context of the severe acidosis imposed by concurrent NBCe1-A loss, further impairs ammoniagenesis during MAc (Lee et al., 2022). To this end, in the kidneys of KOb/c mice we observed significantly less GS expression in PTs located in the cortical labyrinth, supporting our hypothesis that renal ammoniagenesis is enhanced in KOb/c mice during MAc.
Historically, NBCe1-A was considered the only renal NBCe1 variant. However, it was recently discovered that NBCe1-B is also expressed in the kidney, albeit at lower abundance than NBCe1-A (Fang et al., 2018). Specifically, NBCe1-B kidney expression was determined in NBCe1-A KO mice (Romero et al., 2014; Lee et al., 2018); with total-NBCe1-immunoreactivity (representing NBCe1-B in the context of NBCe1-A KO) demonstrated in some PTs of the cortical labyrinth, and more robustly in PTs located in both the medullary ray in the cortex and the OSOM (Fang et al., 2018). However, because NBCe1-B transcripts are expressed from an acid-induced promoter (Snead et al., 2011) and because NBCe1-A KO mice are congenitally acidemic, it is unclear whether the renal expression of NBCe1-B in NBCe1-A KO mice is representative of that in WT mice. Therefore, using a novel, commercially available, NBCe1-B/C specific antibody, here we demonstrate positive NBCe1-B immunoreactivity in WT kidney PTs located in the cortical medullary ray and OSOM. However, we did not observe NBCe1-B immunoreactivity in PTs of the cortical labyrinth. Thus, NBCe1-B expression in PTs of the cortical labyrinth may be a unique feature of the NBCe1-A specific KO mouse, attributable to the severe and chronic spontaneous MAc characteristic of NBCe1-A KO mice. Nonetheless, in-line with previous reports (Fang et al., 2018) we observed a significant increase in renal NBCe1-B expression during MAc, while no such acid-sensitivity was observed for NBCe1-A expression. Importantly, the lack of increased NBCe1-A expression does not preclude the possibility that MAc stimulated a per molecule increase in NBCe1-A activity in PTs of KOb/c mice. It is well established that NBCe1-A activity increases in response to MAc without a change in abundance [reviewed in (Parker and Boron, 2013)]; thus, since our evidence suggests an enhanced ammoniagenic response in KOb/c PTs of the cortical labyrinth, PTs where NBCe1-A is expressed, this supports the hypothesis MAc stimulates NBCe1-A activity through a post-translational mechanism (Alsufayan et al., 2021).
The second key finding of this study is the lack of a respiratory response and elevated pCO2 in KOb/c mice during MAc, which supports in vitro data suggesting that an NBCe1-B/C mediated mechanism underlies the chemosensitivity of the RTN (Turovsky et al., 2016). While the molecular mechanisms underlying the chemosensitivity of the RTN are still controversial, one hypothesis posits that a decrease in pHi of astrocytes activates NBCe1-B/C and the influx of Na+ reverses Na+/Ca2+ exchange (NCX), triggering Ca2+-dependent ATP release (Turovsky et al., 2016). ATP then activates adjacent RTN neurons through P2Y-receptor purinergic signaling (Gourine et al., 2010; Turovsky et al., 2016; Guyenet et al., 2019). In line with this hypothesis, here we demonstrate that KOb/c mice do not exhibit the same increase in minute volume or tidal volume in response to MAc as WT mice, which to our knowledge is the first in vivo report of an impaired respiratory response to MAc attributable to NBCe1-B/C loss. We cannot discount the possibility that CO2 responsiveness is disturbed at other chemosensitive sites in KOb/c mice, contributing to the observed phenotype. Little is known about the molecular mechanisms of pH regulation in these regions, although pH regulation in chemosensitive neurons of the medullary raphe and locus coeruleus is linked to acid extrusion mediated by Na+/H+ exchangers or bicarbonate transporters other than NBCe1 (Kersh et al., 2009; Coley et al., 2013).
Although minute volume did not significantly change from baseline in KOb/c mice, a significant increase in tidal volume was still observed (albeit significantly less than the WT tidal volume response), which suggests the ventilatory response to MAc is partially intact. This may be a result of other chemosensitive nuclei within the central respiratory network, as well as from contributions of peripheral chemoreceptors such as the aortic and carotid bodies (Guyenet and Bayliss, 2015). We also observed a decrease in frequency in both WT and KOb/c mice during MAc that was unexpected since an increase in both tidal volume and frequency might be expected to underlie an increase in minute volume. This could partially be explained by the fact that metabolic inputs, such as acidemia, preferentially affect tidal volume, as has been shown in both human and animal studies (Borison et al., 1977; Javaheri et al., 1982; Nicolò et al., 2017; 2018; Tipton et al., 2017). Lastly, we observed a small, but significant, difference in baseline minute volume, with KOb/c mice exhibiting a higher minute volume, which coincided with a significantly lower baseline pCO2. At this time, we cannot explain this baseline difference in ventilation, although we note that NBCe1-B/C is broadly expressed in histologic sections from the brainstem medulla of WT mice (Figure 2) and thus may contribute to regions beyond the RTN, including those involved with controlling baseline ventilation.
Despite these baseline differences, our data indicate that the impaired respiratory response to MAc underlies the more severe acidemia observed in KOb/c mice after the first day of MAc-challenged conditions (Figure 6E, timepoint 1). Surprisingly however, after 2 and 3 days of MAc-challenged conditions, the plasma pH of KOb/c mice was not significantly different from WT, which suggests compensation by the kidney in defense of overall plasma pH. Additionally, the recovery of plasma pH in both WT and KOb/c mice likely explains the pattern of ventilation observed over the 3-day MAc-challenge; that is since the respiratory response is proportional to the severity of acidemia, as pH recovers the magnitude of the ventilatory response returns towards baseline. This integrated response is more easily described through the use of a Davenport diagram in which all three acid-base parameters (pH, pCO2, and HCO3−) can be displayed (Figure 10). The grey bars in Figure 10 represent the pCO2 isobars for pCO2 levels of 35, 40, and 45 mmHg, respectively, which illustrate all the possible combinations of plasma pH and [HCO3−] for the given pCO2 level according to the Henderson-Hasselbalch relationship. By adding in the measured acid-base parameters from WT (filled circles) and KOb/c (open circles) mice during the 3-day MAc-challenge (taken from Figure 6; numbers in data points represent experimental timepoints) and fitting exponential trendlines to these data, one can appreciate that the WT trendline crosses all three isobars. This represents the intact ability of WT mice to adjust their pCO2 based on the severity of acidosis via the respiratory response to MAc. In contrast, the KOb/c trendline closely follows the 35 mmHg pCO2 isobar, indicative of an impaired respiratory response in KOb/c mice during MAc. Nonetheless, the ability to recover pH remains largely intact in KOb/c mice, which we attribute to the production and absorption of additional HCO3− by the kidney.
FIGURE 10
Kidney ammoniagenesis accounts for the majority of HCO3− production during MAc (Weiner and Verlander, 2019), and indeed KOb/c mice exhibited enhanced NH4+ excretion during the MAc-challenge (Figure 7B). Considering that the respiratory response to MAc occurs on the order of seconds to minutes, while the kidney response takes hours to days to develop (Adrogué and Madias, 2010), we believe this enhancement of NH4+ excretion likely represents renal compensation for the impaired respiratory response. The link between the impaired respiratory response and the enhanced renal response appears to be pH; that is, after the first day of MAc, KOb/c mice exhibited a more severe acidemia than WT mice (Figure 6E, timepoint 1), which likely stimulated renal NH4+ excretion over day 2 (Figures 7A, B). Once KOb/c plasma pH recovered to the same level as WT, which occurred by the end of day 2, the ammoniagenic requirement was only to match the daily consumption of HCO3− due to the daily intake of NH4Cl, which likely explains why we observed a return to WT levels of NH4+ excretion in KOb/c mice on day 3. Finally, we cannot completely discount the possibility that the lack of a decrease in pCO2 from baseline in KOb/c mice contributed to the enhancement of renal ammoniagenesis independently from pH, since CO2 alone has been demonstrated to stimulate renal acid excretion and PT HCO3− reabsorption (Madias et al., 1977; Zhao et al., 2003; Zhou et al., 2005).
There were no significant differences in overall TA excretion or urinary acidification between genotypes during the 3-day MAc-challenge, indicating urinary acidification mechanisms are intact in KOb/c mice. However, under control conditions KOb/c mice exhibited significantly lower TA excretion and significantly higher urinary pH. TA excretion partially depends on urinary pH (Mioni and Mioni, 2014). Hence, lower TA excretion may be a symptom of the more alkaline urine pH. The elevation in urine pH could be indicative of HCO3− wasting in KOb/c mice at baseline; however, this is likely to be a mild occurrence as we observed no significant difference in baseline plasma [HCO3−]. An explanation for these seemingly contradictory findings is that the small quantity of urinary HCO3− necessary to account for the observed difference in urine pH, likely would not cause a detectable difference in plasma [HCO3−]. We also note the presence of an apparent sex-difference in NH4+ excretion, in which the enhanced NH4+ excretion during MAc appears to be driven by KOb/c males. No other sex-differences were observed throughout the study, and we currently do not have an explanation for this potential sex-difference in NH4+ excretion. Although, previous studies have demonstrated sex-differences in ammoniagenesis. Specifically, in response to MAc, NH4+ excretion increased to a greater extent in WT males than females (Harris et al., 2018; 2019). Furthermore, in male mice, PT size and density in the cortex is greater than in females; whereas in female mice, intercalated cells are larger and there is a higher density of collecting ducts than in males (Harris et al., 2019). Together, these anatomical differences support the possibility of a greater ammoniagenic response in males.
Irrespective of the potential sex-difference, we were surprised to observe increased NH4+ excretion in KOb/c mice compared to WT mice (rather than decreased), since several recent findings by others have suggested a role for NBCe1-B in ammoniagenesis (Fang et al., 2018; Lee et al., 2018; 2022). Moreover, the data presented here demonstrating that NBCe1-B abundance increases during MAc (Figure 4) further supports a role for NBCe1-B in the renal response to MAc. Nevertheless, it appears the stimulatory condition imposed by the impaired respiratory response of KOb/c mice overshadows any defect in ammoniagenesis due to NBCe1-B loss. We believe this is largely attributable to enhancement of ammoniagenesis in PTs located in the cortical labyrinth; PTs in which NBCe1-A is specifically expressed (Schmitt et al., 1999; Maunsbach et al., 2000). This hypothesis is supported by our observations of no difference in PEPCK expression and significantly less GS expression in KOb/cversus WT cortical PTs. PEPCK is involved with catalyzing the formation of HCO3− from α-ketoglutarate (the end-product of glutamine deamination) such that MAc normally stimulates increased PEPCK expression (Curthoys and Gstraunthaler, 2001). GS is involved with the recycling of NH4+ by catalyzing the formation of glutamine from glutamate, hence MAc usually stimulates a decrease in GS expression (Conjard et al., 2003). Therefore, the lower expression of GS in PTs of the KOb/c renal cortex supports our hypothesis that ammoniagenesis is enhanced in the NBCe1-A expressing cortical PTs of KOb/c mice, likely overshadowing any impairment in OSOM ammoniagenesis resulting from the absence of NBCe1-B. Nevertheless, we cannot entirely discount the possibility that stimulation of other components of renal ammonium handling, such as the Rhesus glycoproteins, Rh B and Rh C Glycoproteins (Bishop et al., 2010; Weiner and Verlander, 2014), could contribute to the observed enhancement of NH4+ excretion.
The proposed effect of NBCe1-B/C absence on the integrated physiologic response to MAc is illustrated in Figure 11. In summary, these investigations of the KOb/c response to MAc adds to the growing body of literature regarding the role of NBCe1 variants in acid-base physiology. Here we found that NBCe1-B is expressed in the WT kidney at baseline and increases in response to MAc, supporting the hypothesis that NBCe1-B contributes to renal regulation of plasma pH. However, the global loss of NBCe1-B in KOb/c mice, with the resulting impaired respiratory response to MAc, precludes any definitive conclusion as to the role of kidney NBCe1-B during acidosis. Nevertheless, this study provides critical new insight into the necessary role of NBCe1-B/C in the respiratory response to MAc, and demonstrates the complexity of the mechanisms regulating acid-base homeostasis.
FIGURE 11
Statements
Data availability statement
The raw data supporting the conclusion of this article will be made available by the authors, without undue reservation.
Ethics statement
The animal study was reviewed and approved by Institutional Animal Care and Use Committee of the University at Buffalo.
Author contributions
MP and CB designed the study. CB, CZ, and AM carried out experiments. CB and MP analyzed the data, designed figures, and drafted the paper. All authors contributed to the article and approved the submitted version.
Funding
This work was supported by an F30 grant from the National Institute of Diabetes and Digestive and Kidney Diseases (F30DK126330, CB), a Stephen Besch Scholarship (CB), and an R01 grant from the National Institutes of Health National Eye Institute (EY028580, MP).
Acknowledgments
We are grateful for the assistance of Wade Sigurdson in the Confocal Microscope and Flow Cytometry Facility at JSMBS, Marilyn Morris and Tianjing Ren in the University at Buffalo’s School of Pharmacy and Pharmaceutical Sciences, and the veterinary staff of the Laboratory Animal Facility at JSMBS. We also thank Bianca Quade at the University at Buffalo for helpful discussions.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
References
1
AdroguéH. J.MadiasN. E. (2010). Secondary responses to altered acid-base status: The rules of engagement. J. Am. Soc. Nephrol.21, 920–923. 10.1681/ASN.2009121211
2
Ahmad-ZadehC.PiguetJ. D.ColliL. (1971). Molecular weight estimation of immunoglobulin subunits of polyacrylamide gel. Immunology21, 1065–1071.
3
AlamP.AmlalS.ThakarC. V.AmlalH. (2020). Acetazolamide causes renal HCO3− wasting but inhibits ammoniagenesis and prevents the correction of metabolic acidosis by the kidney. Am. J. Physiology-Renal Physiology319, F366-F379–F379. 10.1152/ajprenal.00501.2019
4
AlsufayanT. A.MyersE. J.QuadeB. N.BradyC. T.MarshallA.HaqueN.et al (2021). Revisiting the role of Ser982 phosphorylation in stoichiometry shift of the electrogenic Na+/qHCO3-; cotransporter NBCe1. Int. J. Mol. Sci.22, 12817. 10.3390/ijms222312817
5
AmlalH.SheriffS.SoleimaniM. (2004). Upregulation of collecting duct aquaporin-2 by metabolic acidosis: Role of vasopressin. Am. J. Physiology-Cell Physiology286, C1019–C1030. 10.1152/ajpcell.00394.2003
6
BevenseeM. O.SchmittB. M.ChoiI.RomeroM. F.BoronW. F. (2000). An electrogenic Na+-HCO3− cotransporter (NBC) with a novel COOH-terminus, cloned from rat brain. Am. J. Physiology-Cell Physiology278, C1200–C1211. 10.1152/ajpcell.2000.278.6.C1200
7
BishopJ. M.VerlanderJ. W.LeeH.-W.NelsonR. D.WeinerA. J.HandlogtenM. E.et al (2010). Role of the Rhesus glycoprotein, Rh B glycoprotein, in renal ammonia excretion. Am. J. Physiology-Renal Physiology299, F1065–F1077. 10.1152/ajprenal.00277.2010
8
BorisonH. L.HurstJ. H.McCarthyL. E.RosensteinR. (1977). Arterial hydrogen ion versus CO2 on depth and rate of breathing in decerebrate cats. Respir. Physiol.30, 311–325. 10.1016/0034-5687(77)90038-x
9
BradyC. T.DugandžićA.ParkerM. D.RomeroM. F. (2020). “NBCe1: An electrogenic Na+ bicarbonate cotransporter,”. Epithelia,” in studies of epithelial transporters and ion channels: Ion channels and transporters of epithelia in Health and disease - vol. 3 Physiology in Health and disease. Editors HamiltonK. L.DevorD. C. (Cham: Springer International Publishing), 93–123. 10.1007/978-3-030-55454-5_4
10
BurkeP. G.KanbarR.BastingT. M.HodgesW. M.ViarK. E.StornettaR. L.et al (2015). State-dependent control of breathing by the retrotrapezoid nucleus. J. Physiol.593, 2909–2926. 10.1113/JP270053
11
BurnhamC. E.AmlalH.WangZ.ShullG. E.SoleimaniM. (1997). Cloning and functional expression of a human kidney Na+:HCO3− cotransporter. J. Biol. Chem.272, 19111–19114. 10.1074/jbc.272.31.19111
12
ChanJ. C. (1972). The rapid determination of urinary titratable acid and ammonium and evaluation of freezing as a method of preservation. Clin. Biochem.5, 94–98. 10.1016/s0009-9120(72)80014-6
13
ColeyA. A.RuffinV. A.MossF. J.HopferU.BoronW. F. (2013). Immunocytochemical identification of electroneutral Na+-coupled HCO3- transporters in freshly dissociated mouse medullary raphé neurons. Neuroscience246, 451–467. 10.1016/j.neuroscience.2013.02.064
14
ConjardA.KomatyO.DelageH.BoghossianM.MartinM.FerrierB.et al (2003). Inhibition of glutamine synthetase in the mouse kidney: A novel mechanism of adaptation to metabolic acidosis. J. Biol. Chem.278, 38159–38166. 10.1074/jbc.M302885200
15
CurthoysN. P.GstraunthalerG. (2001). Mechanism of increased renal gene expression during metabolic acidosis. Am. J. Physiol. Ren. Physiol.281, F381–F390. 10.1152/ajprenal.2001.281.3.F381
16
DubreuilV.RamanantsoaN.TrochetD.VaubourgV.AmielJ.GallegoJ.et al (2008). A human mutation in Phox2b causes lack of CO2 chemosensitivity, fatal central apnea, and specific loss of parafacial neurons. PNAS105, 1067–1072. 10.1073/pnas.0709115105
17
ErlichmanJ. S.CookA.SchwabM. C.BuddT. W.LeiterJ. C. (2004). Heterogeneous patterns of pH regulation in glial cells in the dorsal and ventral medulla. Am. J. Physiology-Regulatory, Integr. Comp. Physiology286, R289–R302. 10.1152/ajpregu.00245.2003
18
FangL.LeeH.-W.ChenC.HarrisA. N.RomeroM. F.VerlanderJ. W.et al (2018). Expression of the B splice variant of NBCe1 (SLC4A4) in the mouse kidney. Am. J. Physiology-Renal Physiology315, F417-F428–F428. 10.1152/ajprenal.00515.2017
19
FarwellW. R.TaylorE. N. (2008). Serum bicarbonate, anion gap and insulin resistance in the national Health and nutrition examination survey. Diabet. Med.25, 798–804. 10.1111/j.1464-5491.2008.02471.x
20
GoodD. W.BurgM. B. (1984). Ammonia production by individual segments of the rat nephron. J. Clin. Investig.73, 602–610. 10.1172/JCI111250
21
GourineA. V.KasymovV.MarinaN.TangF.FigueiredoM. F.LaneS.et al (2010). Astrocytes control breathing through pH-dependent release of ATP. Science329, 571–575. 10.1126/science.1190721
22
GuyenetP. G.BaylissD. A. (2015). Neural control of breathing and CO2 homeostasis. Neuron87, 946–961. 10.1016/j.neuron.2015.08.001
23
GuyenetP. G.StornettaR. L.SouzaG. M. P. R.AbbottS. B. G.ShiY.BaylissD. A. (2019). The retrotrapezoid nucleus: Central chemoreceptor and regulator of breathing automaticity. Trends Neurosci.42, 807–824. 10.1016/j.tins.2019.09.002
24
HarrisA. N.LeeH.-W.FangL.VerlanderJ. W.WeinerI. D. (2019). Differences in acidosis-stimulated renal ammonia metabolism in the male and female kidney. Am. J. Physiology-Renal Physiology317, F890-F905–F905. 10.1152/ajprenal.00244.2019
25
HarrisA. N.LeeH.-W.OsisG.FangL.WebsterK. L.VerlanderJ. W.et al (2018). Differences in renal ammonia metabolism in male and female kidney. Am. J. Physiology-Renal Physiology315, F211-F222–F222. 10.1152/ajprenal.00084.2018
26
IgarashiT.InatomiJ.SekineT.ChaS. H.KanaiY.KunimiM.et al (1999). Mutations in SLC4A4 cause permanent isolated proximal renal tubular acidosis with ocular abnormalities. Nat. Genet.23, 264–266. 10.1038/15440
27
IgarashiT.InatomiJ.SekineT.SekiG.ShimadzuM.TozawaF.et al (2001). Novel nonsense mutation in the Na+/HCO3- cotransporter gene (SLC4A4) in a patient with permanent isolated proximal renal tubular acidosis and bilateral glaucoma. J. Am. Soc. Nephrol.12, 713–718. 10.1681/ASN.V124713
28
JanesK. A. (2015). An analysis of critical factors for quantitative immunoblotting. Sci. Signal.8, rs2. 10.1126/scisignal.2005966
29
JavaheriS.ShoreN. S.RoseB.KazemiH. (1982). Compensatory hypoventilation in metabolic alkalosis. Chest81, 296–301. 10.1378/chest.81.3.296
30
KaoL.SassaniP.AzimovR.PushkinA.AbuladzeN.Peti-PeterdiJ.et al (2008). Oligomeric structure and minimal functional unit of the electrogenic sodium bicarbonate cotransporter NBCe1-A. J. Biol. Chem.283, 26782–26794. 10.1074/jbc.M804006200
31
KasymovV.LarinaO.CastaldoC.MarinaN.PatrushevM.KasparovS.et al (2013). Differential sensitivity of brainstem versus cortical astrocytes to changes in pH reveals functional regional specialization of astroglia. J. Neurosci.33, 435–441. 10.1523/JNEUROSCI.2813-12.2013
32
KershA. E.HartzlerL. K.HavlinK.HubbellB. B.NanagasV.KalraA.et al (2009). pH regulating transporters in neurons from various chemosensitive brainstem regions in neonatal rats. Am. J. Physiology-Regulatory, Integr. Comp. Physiology297, R1409–R1420. 10.1152/ajpregu.91038.2008
33
LavezziA. M.PoloniatoA.RovelliR.LorioliL.IasiG. A.PusiolT.et al (2019). Massive amniotic fluid aspiration in a case of sudden neonatal death with severe hypoplasia of the retrotrapezoid/parafacial respiratory group. Front. Pediatr.7, 116. 10.3389/fped.2019.00116
34
LeeH.-W.OsisG.HarrisA. N.FangL.RomeroM. F.HandlogtenM. E.et al (2018). NBCe1-A regulates proximal tubule ammonia metabolism under basal conditions and in response to metabolic acidosis. J. Am. Soc. Nephrol.29, 1182–1197. 10.1681/ASN.2017080935
35
LeeH.-W.VerlanderJ. W.BishopJ. M.IgarashiP.HandlogtenM. E.WeinerI. D. (2009). Collecting duct-specific Rh C glycoprotein deletion alters basal and acidosis-stimulated renal ammonia excretion. Am. J. Physiol. Ren. Physiol.296, F1364–F1375. 10.1152/ajprenal.90667.2008
36
LeeH.-W.VerlanderJ. W.ShullG. E.HarrisA. N.WeinerI. D. (2022). Acid-base effects of combined renal deletion of NBCe1-A and NBCe1-B. Am. J. Physiology-Renal Physiology322, F208–F224. ajprenal.00358. 10.1152/ajprenal.00358.2021
37
LeeS.-K.BoronW. F.ParkerM. D. (2011). Relief of autoinhibition of the electrogenic Na-HCO3 cotransporter NBCe1-B: Role of IRBIT vs. amino-terminal truncation. Am. J. Physiology-Cell Physiology302, C518–C526. 10.1152/ajpcell.00352.2011
38
MadiasN. E.SchwartzW. B.CohenJ. J. (1977). The maladaptive renal response to secondary hypocapnia during chronic HCl acidosis in the dog. J. Clin. Investig.60, 1393–1401. 10.1172/JCI108900
39
MajumdarD.MaunsbachA. B.ShackaJ. J.WilliamsJ. B.BergerU. V.SchultzK. P.et al (2008). Localization of electrogenic Na/bicarbonate cotransporter NBCe1 variants in rat brain. Neuroscience155, 818–832. 10.1016/j.neuroscience.2008.05.037
40
MaunsbachA. B.VorumH.KwonT.-H.NielsenS.SimonsenB.ChoiI.et al (2000). Immunoelectron microscopic localization of the electrogenic Na/HCO3 cotransporter in rat and Ambystoma kidney. J. Am. Soc. Nephrol.11, 2179–2189. 10.1681/ASN.V11122179
41
McAlearS. D.LiuX.WilliamsJ. B.McNicholas-BevenseeC. M.BevenseeM. O. (2006). Electrogenic Na/HCO3 cotransporter (NBCe1) variants expressed in Xenopus oocytes: Functional comparison and roles of the amino and carboxy termini. J. General Physiology127, 639–658. 10.1085/jgp.200609520
42
MioniR.MioniG. (2014). Titratable acidity: A pitts concept revisited. Scand. J. Clin. Laboratory Investigation74, 408–413. 10.3109/00365513.2014.900188
43
MorseB. L.VijayN.MorrisM. E. (2012). γ-Hydroxybutyrate (GHB)-Induced respiratory depression: Combined receptor-transporter inhibition therapy for treatment in GHB overdose. Mol. Pharmacol.82, 226–235. 10.1124/mol.112.078154
44
Musa-AzizR.BoronW. F.ParkerM. D. (2010). Using fluorometry and ion-sensitive microelectrodes to study the functional expression of heterologously-expressed ion channels and transporters in Xenopus oocytes. Methods51, 134–145. 10.1016/j.ymeth.2009.12.012
45
MyersE. J.MarshallA.JenningsM. L.ParkerM. D. (2016a). Mouse Slc4a11 expressed in Xenopus oocytes is an ideally selective H +/OH − conductance pathway that is stimulated by rises in intracellular and extracellular pH. Am. J. Physiology-Cell Physiology311, C945-C959–C959. 10.1152/ajpcell.00259.2016
46
MyersE. J.YuanL.FelmleeM. A.LinY.JiangY.PeiY.et al (2016b). A novel mutant Na+/HCO3− cotransporter NBCe1 in a case of compound-heterozygous inheritance of proximal renal tubular acidosis. J. Physiol.594, 6267–6286. 10.1113/JP272252
47
NattieE.LiA. (2012). Central chemoreceptors: Locations and functions. Compr. Physiol.2, 221–254. 10.1002/cphy.c100083
48
NicolòA.GirardiM.BazzucchiI.FeliciF.SacchettiM. (2018). Respiratory frequency and tidal volume during exercise: Differential control and unbalanced interdependence. Physiol. Rep.6, e13908. 10.14814/phy2.13908
49
NicolòA.GirardiM.SacchettiM. (2017). Control of the depth and rate of breathing: Metabolic vs. non-metabolic inputs. J. Physiology595, 6363–6364. 10.1113/JP275013
50
OrchardC. H.CingolaniH. E. (1994). Acidosis and arrhythmias in cardiac muscle. Cardiovasc Res.28, 1312–1319. 10.1093/cvr/28.9.1312
51
O’ReganR. G.MajcherczykS. (1982). Role of peripheral chemoreceptors and central chemosensitivity in the regulation of respiration and circulation. J. Exp. Biol.100, 23–40. 10.1242/jeb.100.1.23
52
ParkerM. D.BoronW. F. (2013). The divergence, actions, roles, and relatives of sodium-coupled bicarbonate transporters. Physiol. Rev.93, 803–959. 10.1152/physrev.00023.2012
53
ParkerM. D.QinX.WilliamsonR. C.ToyeA. M.BoronW. F. (2012). HCO 3− -independent conductance with a mutant Na+/HCO3− cotransporter (SLC4A4) in a case of proximal renal tubular acidosis with hypokalaemic paralysis: NBCe1-A mutant A799V. J. Physiology590, 2009–2034. 10.1113/jphysiol.2011.224733
54
PhisitkulS.KhannaA.SimoniJ.BroglioK.SheatherS.Hasan RajabM.et al (2010). Amelioration of metabolic acidosis in patients with low GFR reduced kidney endothelin production and kidney injury, and better preserved GFR. Kidney Int.77, 617–623. 10.1038/ki.2009.519
55
RectorF. C.SeldinD. W.CopenhaverJ. H. (1955). The mechanism of ammonia excretion during ammonium chloride acidosis. J. Clin. Investig.34, 20–26. 10.1172/JCI103058
56
RomeroM. F.FongP.BergerU. V.HedigerM. A.BoronW. F. (1998). Cloning and functional expression of rNBC, an electrogenic Na+-HCO3− cotransporter from rat kidney. Am. J. Physiology-Renal Physiology274, F425–F432. 10.1152/ajprenal.1998.274.2.F425
57
RomeroM. F.HedigerM. A.BoulpaepE. L.BoronW. F. (1997). Expression cloning and characterization of a renal electrogenic Na+/HCO3− cotransporter. Nature387, 409–413. 10.1038/387409a0
58
RomeroM. F.HolmesH. L.ChowdhuryU. R.HannC. R.ChangM.FautschM. P.et al (2014). Mutants in NBCe1A isoform have elevated Intraocular Pressure. Investig. Ophthalmol. Vis. Sci.55, 2415.
59
RuffaultP.-L.D’AutréauxF.HayesJ. A.NomaksteinskyM.AutranS.FujiyamaT.et al (2015). The retrotrapezoid nucleus neurons expressing Atoh1 and Phox2b are essential for the respiratory response to CO2. eLife4, e07051. 10.7554/eLife.07051
60
SalernoE. E.PatelS. P.MarshallA.MarshallJ.AlsufayanT.MballoC. S. A.et al (2019). Extrarenal signs of proximal renal tubular acidosis persist in nonacidemic nbce1b/c-null mice. J. Am. Soc. Nephrol.30, 979–989. 10.1681/ASN.2018050545
61
SatlinL. M.WodaC. B.SchwartzG. J. (2003). “18 - development of function in the metanephric kidney,” in The kidney, eds. VizeP. D.WoolfA. S.BardJ. B. L. (San Diego: Academic Press), 267–325. 10.1016/B978-012722441-1/50020-8
62
SchindelinJ.Arganda-CarrerasI.FriseE.KaynigV.LongairM.PietzschT.et al (2012). Fiji: An open-source platform for biological-image analysis. Nat. Methods9, 676–682. 10.1038/nmeth.2019
63
SchmittB. M.BiemesderferD.RomeroM. F.BoulpaepE. L.BoronW. F. (1999). Immunolocalization of the electrogenic Na+-HCO3− cotransporter in mammalian and amphibian kidney. Am. J. Physiology-Renal Physiology276, F27–F38. 10.1152/ajprenal.1999.276.1.F27
64
SchuitmakerJ. J.BerkenboschA.DeGoedeJ.OlievierC. N. (1987). Ventilatory responses to respiratory and metabolic acid-base disturbances in cats. Respir. Physiol.67, 69–83. 10.1016/0034-5687(87)90007-7
65
SeelyJ. C. (2017). A brief review of kidney development, maturation, developmental abnormalities, and drug toxicity: Juvenile animal relevancy. J. Toxicol. Pathol.30, 125–133. 10.1293/tox.2017-0006
66
ShahS. N.AbramowitzM.HostetterT. H.MelamedM. L. (2009). Serum bicarbonate levels and the progression of kidney disease: A cohort study. Am. J. Kidney Dis.54, 270–277. 10.1053/j.ajkd.2009.02.014
67
SheikhbahaeiS.TurovskyE. A.HosfordP. S.HadjihambiA.TheparambilS. M.LiuB.et al (2018). Astrocytes modulate brainstem respiratory rhythm-generating circuits and determine exercise capacity. Nat. Commun.9, 370. 10.1038/s41467-017-02723-6
68
SneadC. M.SmithS. M.SadegheinN.LacruzR. S.HuP.KurtzI.et al (2011). Identification of a pH-responsive DNA region upstream of the transcription start site of human NBCe1-B. Eur. J. Oral Sci.119, 136–141. 10.1111/j.1600-0722.2011.00867.x
69
SouzaG. M. P. R.KanbarR.StornettaD. S.AbbottS. B. G.StornettaR. L.GuyenetP. G. (2018). Breathing regulation and blood gas homeostasis after near complete lesions of the retrotrapezoid nucleus in adult rats. J. Physiology596, 2521–2545. 10.1113/JP275866
70
StornettaR. L.MoreiraT. S.TakakuraA. C.KangB. J.ChangD. A.WestG. H.et al (2006). Expression of Phox2b by brainstem neurons involved in chemosensory integration in the adult rat. J. Neurosci.26, 10305–10314. 10.1523/JNEUROSCI.2917-06.2006
71
TiptonM. J.HarperA.PatonJ. F. R.CostelloJ. T. (2017). The human ventilatory response to stress: Rate or depth?J. Physiol.595, 5729–5752. 10.1113/JP274596
72
TurovskyE.TheparambilS. M.KasymovV.DeitmerJ. W.del ArroyoA. G.AcklandG. L.et al (2016). Mechanisms of CO2/H+ sensitivity of astrocytes. J. Neurosci.36, 10750–10758. 10.1523/JNEUROSCI.1281-16.2016
73
UrsoC.BrucculeriS.CaimiG. (2015). Acid–base and electrolyte abnormalities in heart failure: Pathophysiology and implications. Heart Fail Rev.20, 493–503. 10.1007/s10741-015-9482-y
74
VirreiraM.JinL.DjerbibS.De DekenX.MiotF.MassartC.et al (2019). Expression, localization, and regulation of the sodium bicarbonate cotransporter NBCe1 in the thyroid. Thyroid29, 290–301. 10.1089/thy.2017.0576
75
WegerW.KotankoP.WegerM.DeutschmannH.SkrabalF. (2000). Prevalence and characterization of renal tubular acidosis in patients with osteopenia and osteoporosis and in non‐porotic controls. Nephrol. Dial. Transpl.15, 975–980. 10.1093/ndt/15.7.975
76
WeinerI. D.VerlanderJ. W. (2014). Ammonia transport in the kidney by Rhesus glycoproteins. Am. J. Physiology-Renal Physiology306, F1107–F1120. 10.1152/ajprenal.00013.2014
77
WeinerI. D.VerlanderJ. W. (2019). Emerging features of ammonia metabolism and transport in acid-base balance. Seminars Nephrol.39, 394–405. 10.1016/j.semnephrol.2019.04.008
78
WessonD. E.SimoniJ.BroglioK.SheatherS. (2011). Acid retention accompanies reduced GFR in humans and increases plasma levels of endothelin and aldosterone. Am. J. Physiology-Renal Physiology300, F830–F837. 10.1152/ajprenal.00587.2010
79
ZhaoJ.ZhouY.BoronW. F. (2003). Effect of isolated removal of either basolateral HCO3- or basolateral CO2 on HCO3- reabsorption by rabbit S2 proximal tubule. Am. J. Physiology-Renal Physiology285, F359–F369. 10.1152/ajprenal.00013.2003
80
ZhouY.ZhaoJ.BouyerP.BoronW. F. (2005). Evidence from renal proximal tubules that HCO3- and solute reabsorption are acutely regulated not by pH but by basolateral HCO3- and CO2. Proc. Natl. Acad. Sci. U. S. A.102, 3875–3880. 10.1073/pnas.0500423102
Summary
Keywords
NBCe1, acid-base, acidosis, bicarbonate, transport, kidney, brainstem
Citation
Brady CT, Marshall A, Zhang C and Parker MD (2023) NBCe1-B/C-knockout mice exhibit an impaired respiratory response and an enhanced renal response to metabolic acidosis. Front. Physiol. 14:1201034. doi: 10.3389/fphys.2023.1201034
Received
05 April 2023
Accepted
07 June 2023
Published
19 June 2023
Volume
14 - 2023
Edited by
Ali A. Khraibi, Khalifa University, United Arab Emirates
Reviewed by
Nicolas Voituron, Université Sorbonne Paris Nord, France
Nazih Nakhoul, Tulane University, United States
Michael Romero, College of Medicine and Science, Mayo Clinic, United States
Updates
Copyright
© 2023 Brady, Marshall, Zhang and Parker.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Mark D. Parker, parker28@buffalo.edu
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.