Impact Factor 3.661 | CiteScore 4.4
More on impact ›

ORIGINAL RESEARCH article

Front. Mar. Sci., 27 November 2020 | https://doi.org/10.3389/fmars.2020.584482

The Antimicrobial Peptide Cecropin AD Supplement Alleviated Soybean Meal-Induced Intestinal Inflammation, Barrier Damage, and Microbial Dysbiosis in Juvenile Turbot, Scophthalmus maximus

Jihong Dai1, Weihao Ou1, Guijuan Yu1, Qinghui Ai1, Wenbing Zhang1, Kangsen Mai1,2 and Yanjiao Zhang1,2*
  • 1The Key Laboratory of Aquaculture Nutrition and Feed (Ministry of Agriculture) & The Key Laboratory of Mariculture (Ministry of Education), Ocean University of China, Qingdao, China
  • 2Laboratory for Marine Fisheries Science and Food Production Processes, Qingdao National Laboratory for Marine Science and Technology, Qingdao, China

This study aimed to investigate the benefit of dietary cecropin AD (CAD) on the intestinal health of turbot (Scophthalmus maximus) fed diets with a high level of soybean meal. A 12-week feeding trial was conducted with four isonitrogenous and isolipidic diets: a fishmeal-based diet (FM), a diet replacing 40% fish meal protein of FM diet with soybean meal protein (SBM), and the SBM diet supplemented with 0.5 g/kg (C1) and 1.0 g/kg (C2) CAD, respectively. The results of histology of distal intestine (DI) showed that turbots fed the SBM diet exhibited distinct symptoms of enteritis. However, fish fed diets with CAD supplementation kept the normal appearance of the DI which was similar to that in FM group. Compared with the SBM group, diet with CAD supplementation significantly decreased the gene expression of intestinal pro-inflammatory cytokines tumor necrosis factor-α (tnf-α), interleukin-1β (il-1β), interferon-gamma (ifn-γ), and nuclear factor-kappa B p65 (nf-κb p65), while up-regulated the gene expression of intestinal tight junction proteins claudin-3, claudin-4, occludin, and zonula occludens-1 (zo-1). Besides, diet C1 shaped the intestinal microbiota profile toward an anti-inflammatory phenotype represented by the increased abundance of Blutia, Firmicutes/Bacteroides ratio, and decreased Prevotellaceae. In conclusion, dietary CAD could positively modulate the intestinal health of turbot from the impairment induced by soybean meal, which expands its application to help fish better adapt to the increasing plant protein level in aquafeed.

Introduction

Soybean meal has been widely used in aquafeed to solve the contradiction between the soaring requirement and the lacking supply of fishmeal. However, dietary inclusion of soybean meal often leads to soybean meal-induced enteritis (SBMIE) in marine fish, resulting in inferior health conditions and poor growth performance (Baeverfjord and Krogdahl, 1996; Krogdahl et al., 2003; Chen et al., 2018a; Liu et al., 2018). The SBMIE in fish is commonly featured by overexpressed pro-inflammatory cytokines, disruption of barrier function, microbial dysbiosis, as well as evident pathological changes (Baeverfjord and Krogdahl, 1996; Mansfield et al., 2010; Reveco et al., 2014; Zhou et al., 2018; Liu et al., 2019). As an indispensable component of intestinal barrier, tight junction (TJ) complex in terms of morphology and gene expression analysis has been extensively investigated in fish suffering from SBMIE (Merrifield et al., 2009; Liu et al., 2019; Zhao et al., 2019), as a healthy TJ plays pivotal roles in resisting the invasion of harmful substances (DeMeo et al., 2002) and preventing intestinal inflammation from prolongation and aggravation (Su et al., 2013). Meanwhile, a healthy gut also depends on the balance of microbial ecosystem, which acts as a defensive barrier combined with the role in aiding digestive function and development of intestine (Luis Balcázar et al., 2006). Given that intestinal microbial composition and barrier function can be effectively modified by dietary ingredients, and their significance in maintenance of intestinal homeostasis (Clements et al., 2014; Li et al., 2017; Zhou et al., 2018), many nutritional strategies such as functional amino acid/protein, probiotics, prebiotics, and organic acid have been exploited to relief fish SBMIE (Sealey et al., 2009; Refstie et al., 2010; Ulloa et al., 2016; Chen et al., 2018b; Liu et al., 2018; Zhao et al., 2019).

Antimicrobial peptides (AMP) are important components of innate immune defense with broad-spectrum antibiotic activity and immunomodulatory activities (Reddy et al., 2004; Hancock et al., 2016), hence various kinds of AMPs have been investigated to improve immune response and enhance disease resistance in fish (Zhou et al., 2008; Dong et al., 2015; Lin et al., 2015; Su et al., 2019; Li et al., 2020). Cecropin AD (CAD) is an artificial cationic amphipathic AMP possessing great potential for commercial application as a functional additive due to its relatively stable bioactivity, broad-spectrum antimicrobial property, and easily acquisition as a well-designed Bacillus subtilis expression system has been established (Chen et al., 2009). Studies have shed light on the effectiveness of CAD in reducing intestinal aerobic bacteria and potential pathogens in piglets and broilers (Wen and He, 2012; Wu et al., 2012). Moreover, some cecropin family peptides exert great anti-inflammatory activity in mammal immune cells (Kim et al., 2011; Lee et al., 2015; Wu et al., 2015) and promote the expression of TJ proteins in porcine jejunum epithelial cells (Zhai et al., 2018). More recently, our previous study proved that dietary CAD reduced the abundance of intestinal Bacteroides while increased Lactococcus lactis, highlighting its role as an intestinal immunoenhancer in turbot (Scophthalmus maximus) fed a diet whose composition resembled commercial formulation (Dai et al., 2020). Therefore, the present study was designed to clarify the beneficial effects of dietary CAD to protect the intestine health from the soybean meal-induced intestinal inflammation, barrier damage, and microbial dysbiosis in turbot, which is an extensively cultured marine carnivorous fish in the world.

Materials and Methods

Ethical Clarification

All sampling protocols, as well as fish rearing practices, were reviewed and approved by the Animal Care and Use Committee of Ocean University of China.

Experimental Diets

A total of four isonitrogenous and isolipidic experimental diets were formulated to contain 52% crude protein and 12% crude lipid: fishmeal-based diet (FM); FM with 40% fish meal protein replaced by soybean meal protein (SBM); SBM+0.5 g/kg CAD (C1) and SBM+1.0 g/kg CAD (C2) (Table 1). The CAD used in this study was developed by the National Feed Technology Development Research Center and purchased from Peking Sinagri Yin Thai Bio-Technology (Beijing, China). The amino acid sequence composition of CAD is KWKLFKKIEKVGQRVRDAVISAGPAVATVAQATALAK with biomass of 3.8 KDa. A Bacillus subtilis expression system was used for the mass-production of CAD. Briefly, the CAD gene was fused with a small ubiquitin-like modifier gene and a signal peptide of SacB. B. subtilis expression system was constructed based on B. subtilis cells genetically modified by introducing an operon comprising a promoter, the SUMO protease gene, and a signal peptide of amyQ (Chen et al., 2009). The process of diet making followed our previous study (Dai et al., 2020).

TABLE 1
www.frontiersin.org

Table 1. Formulations and chemical analyses of the experimental diets (% DM).

Fish Husbandry

Apparently healthy juvenile turbots were obtained from a commercial fish farm in Penglai (Shandong, China). Fish were fed the FM diet for 14 days to adapt to the experimental conditions before the initiation of the feeding trial. At the start of the experiment, 4 groups of turbot with similar sizes (initial mean weight 8.47 ± 0.04 g) were randomly distributed to 12 fiberglass tanks (200L, 30 fish/tank). Each diet was randomly fed to three replicate groups of turbot to apparent satiation twice daily (08:00 and 17:00). Uneaten pellets were collected by siphonage, then dried and weighed for the calculation of feed intake. The tanks were supplied with seawater collected from the adjacent coast after sedimentation and sand filtration, with water flow rate at about 3L/min; a temperature between 15°C and 17°C; salinity, 35%; pH ranged from 7.5 to 8.0; dissolved oxygen over 6 mg L−1. The fish were kept into a flow-through water system supplied with continuous aeration.

Sample Collection

On the day 84, all the fish were fasted for 24 h for the measuring of biomass in each tank. On the day 85, all turbots were fed 5 h previous to sampling. All turbots were fed 5 h previous to sampling to ensure the intestine was filled with contents. The contents were collected but not for use in the present study. Distal intestine (DI) of 3 fish per tank were dissected and rinsed with phosphate-buffered saline (PBS) to get rid of the contents before immersing in liquid nitrogen and storing at −80°C for gene expression analysis. For the analysis of intestinal microflora, the abdomen surface of fish was cleansed with 70% ethanol. Afterward, the hindguts of other 3 fish each tank were collected with a sterile dissecting instrument near an alcohol lamp. The digesta samples were collected aseptically by squeezing the contents out of the DI into sterile containers and transferred into storage at −80°C. Then the remaining DI tissues were rinsed 3 times softly for 1 min in PBS to remove the contents before transferred to 2 mL sterile Axygen tubes and immediately frozen in liquid nitrogen. On the day 86, Three fish per tank were randomly picked for the analysis of proximate composition. For the intestinal histological examination, short segments (about 1 cm in length) of DI from other 3 randomly selected fish were dissected and fixed in the 4% paraformaldehyde (Solarbio, China).

Chemical Analysis

The proximate composition of feed ingredients, diets and fish body were determined according to the standard methods (AOAC, 1995). Dry matter was measured by drying samples at 105°C to a constant weight; crude protein by the Kjeldahl method (2300-Autoanalyzer, FOSS Tecator, Höganäs, Sweden); crude lipid by the Soxhlet method (B-811, BUCHI, Flawil, Switzerland); ash by combustion to a constant weight at 550°C.

Histological Analysis

After fixation in the 4% paraformaldehyde for 24 h, DI samples were dehydrated in ethanol, equilibrated in xylene, and embedded in paraffin according to standard histological techniques. Then the sections of 7 μm were cut with a rotary microtome (Lecia Jung RM 2016, Germany) and stained with the hematoxylin-eosin method. The examination was conducted with a light microscope (DP 72, Olympus, Tokyo, Japan) equipped with a camera (E 600, Nikon, Tokyo, Japan) and an image acquisition software (CellSens Standard, Olympus, Tokyo, Japan) following the criteria suggested by krogdahl (Krogdahl et al., 2003): length and fusion of mucosal folds, cellular infiltration, and width of the lamina propria and submucosa, enterocyte vacuolization, and nucleus position within the enterocytes. The perimeter ratio (arbitrary units AU) between the internal and external perimeter was determined using the Image-Pro Plus® software (Media Cybernetics, Silver Spring, MD, United States) according to the method of Dimitroglou (Dimitroglou et al., 2009), a schematic drawing showing the parts served to calculate the intestinal PR value was described in our previous study (Dai et al., 2018). A higher PR value indicates a larger absorptive surface area resulting from increased length of villi height and/or a number of mucosal folding.

Quantitative RT-PCR Analysis

Total RNA was extracted from DI using Trizol reagent (Takara, Beijing) and electrophoresed on a 1.2% agarose gel to evaluate the integrity, with RNA concentration assessed using NanoDrop® ND-1000 spectrophotometer (Thermo Scientific, Waltham, MA, United States). The first cDNA strand was synthesized by reversely transcribing purified 1 μg total RNA using PrimeScript RT reagent Kit with gDNA Eraser (RR047A; Takara Biotech) according to the manufacturer's indication. The real-time qPCR (rt-qPCR) assays were performed in a total volume of 25 μL consisted of 1 μL of 200 ng/μL complementary cDNA product, 1 μL of each specific primer (10 μM), 12.5 μL of TYBR Green PCR Master Mix [c® Premix Ex Taq™ (Tli RNase H Plus)] (Takara, Japan), 9.5 μL of diethylpyrocarbonate-treated water (Sigma-Aldrich). The reaction conditions of qPCR amplification were employed as following conditions: 95°C for 2 min and then 40 cycles of 95°C for 10 s, 60°C for 20 s, and 72°C for 20 s. A melting curve analysis was performed after each amplification phase to confirm that any product detected was specific to the desired amplicon. Fold changes were calculated after normalization to reference gene β-actin using relative quantitative method (2−ΔΔCT). Primer sequences are listed in Table 2.

TABLE 2
www.frontiersin.org

Table 2. Primers used for real-time PCR analysis.

Intestinal Microbiota Profiling

Total bacteria DNA was extracted from the DI mucosa layer of one fish on a super clean bench around alcohol flame using a QiAamp DNA stool Mini Kit (Qiagen, Germany). 16S rRNA gene amplicon sequencing libraries of the V4 hypervariable region were prepared with quality checked on the Qubit@ 2.0 Fluorometer (Thermo Scientific), and pools of amplicons were sequenced at Novogene Technology Co., Ltd. (Tianjin, China) on an Ion S5TM XL platform. After data filtration and chimera removal, clean reads were then imported into Uparse software (Uparse v 7,0,1001). The reads were then clustered to operational taxonomic units (OTUs) based on 97% sequence similarity cut off value. Alpha diversity including Shannon and observed species was calculated with QIIME (v1.7.0) and displayed with R software (v 2.15.3). Principal Coordinate Analysis (PCoA) displayed by WGCNA package, stat packages, and ggplot2 package in R software (Version 2.15.3) was performed to get principal coordinates and visualize from complex, multidimensional data. Linear discriminant analysis effect size (LEfSe) analysis was performed on the bacterial taxa relative abundance values to determine the presence of bacterial taxa with statistically significant changes in abundance in the intestinal microbiome from different treatment groups.

Calculations and Statistical Analysis

The following variables were calculated:

Weight gain (%) = 100 × (final weight - initial weight) / initial weight.

Specific growth rate (SGR, % day-1) = 100 × (Ln final weight–Ln initial weight)/days.

Feed efficiency (FE) = (final weight – initial weight) / feed consumed.

Feed intake (FI, % day-1) =100 × feed intake / [(initial weight + final weight)/2]/days.

SPSS version 22.0 for OS X was used for statistics analysis. Data except for microbiota analysis were subjected to homogeneity test before one-way analysis of variance (ANOVA). Differences between means were determined using Tukey's multiple-comparison test. Significance of results was determined when P < 0.05, and the results are presented as means ± SEM. Comparisons of 2 means were performed by using two-tail Student's t-test.

Result

Growth Performance and Body Composition

After the 12-week feeding trial, significantly enhanced weight gain and specific growth rate (SGR) were observed in FM and C1 groups compared with the SBM group (P < 0.05). The feed efficiency (FE) in fish fed diet C1 was higher than that in fish fed diet SBM, showing no significant difference with the FM group (P > 0.05) (Table 3). Whole-body composition was not affected by CAD supplementation as no treatment-related difference of crude protein, lipid, moisture, and ash were observed among all diet groups (Table 4).

TABLE 3
www.frontiersin.org

Table 3. Effects of dietary supplementation of CAD on growth performance and feed utilization of turbot1.

TABLE 4
www.frontiersin.org

Table 4. Effects of dietary supplementation of CAD on whole-body composition of turbota.

Intestinal Morphology

Dietary CAD improved the villi morphology of the distal intestine (DI) both in quantity and the quality (Figure 1). The increased intestinal perimeter ratio was observed in the CAD-supplemented group compared with the SBM group (Figure 2). From the zoomed-in images, the broaden of lamina propia and infiltration of eosinophilic granulocyte were clearly observed in the SBM group, while the lamina propia slightly widened and fewer eosinophilic granulocytes accumulated in the DI in the C1 and C2 groups (Figure 1).

FIGURE 1
www.frontiersin.org

Figure 1. Effects of dietary supplementation of CAD on morphology in the distal intestine (DI) of turbot. Scale bar of images at low power, 200 μm; Scale bar of enlarged images, 50 μm. The red circle denotes the dilation of the lamina propria with the infiltration of eosinophilic granulocyte.

FIGURE 2
www.frontiersin.org

Figure 2. Effects of dietary supplementation of CAD on perimeter ratio in the DI of turbot. Arbitrary unit. Error bars of columns indicate standard error of means (n = 9) and different letters among columns denote significant differences as evaluated by Tukey's HSD test.

Quantitative RT-PCR Analysis of Inflammatory cytokines in DI

Compared with the FM group, the SBM diet significantly increased gene expression levels of nf-κb p65, ifn-γ, tnf-α, and il1-β in DI. However, compared with diet SBM, the gene expression level of these pro-inflammatory genes significantly lowered in turbot fed the diet C1 (P < 0.05). The gene expression levels of nf-κb p65 and ifn-γ decreased remarkably in the C2 group (P < 0.05). No diet-related differences were observed in the gene expression levels of transforming growth factor-β (tgf-β), interleukin-8 (il-8), and interleukin-22 (il-22) among all diet groups (P > 0.05; Figure 3).

FIGURE 3
www.frontiersin.org

Figure 3. Effects of CAD supplementations on the gene expression level of inflammatory cytokines in the DI of juvenile turbot. Data were expressed as means ± standard errors of means (n = 9). Bars not sharing the same letters denote significant (P < 0.05) differences in gene expression level.

Quantitative RT-PCR Analysis of Tight Junction Proteins in the DI

Compared with the FM group, the turbot subjected to SBM treatment showed significantly decreased intestinal gene expression level of occludin, claudin-3, claudin-4, and zo-1 (P < 0.05). The supplementation of CAD in SBM increased the gene expression level of occludin, claudin-3, claudin-4, and zo-1 compared with the SBM group and exhibited no significant differences with the FM group. There are no remarkable changes in the gene expression level of tricellulin and claudin-7 among all dietary treatments (P > 0.05; Figure 4).

FIGURE 4
www.frontiersin.org

Figure 4. Effects of CAD supplementations on the gene expression level of tight junction protein in the DI of juvenile turbot. Data were expressed as means ± standard errors of means (n = 9). Bars not sharing the same letters denote significant (P < 0.05) differences in gene expression level.

Intestinal Microbiota Composition

A total of 973,130 raw single-end reads was generated from 12 samples, resulting in the identification of 5,840 OTUs according to 97% sequence similarity. The rarefaction curves reached the plateau, indicating adequate sequencing depth for all the samples (Figure 5). At the phylum level, Firmicutes, Bacteroidetes, and Proteobacteria were detected as the predominant bacterial phyla in the DI of turbot from all groups. At the genus level, Mycoplasms, unidentified Clostridiales, Bacteroides, Lactobacillus, Faecalibacterium, Rhodococcus, Subdoligranulum, unidentified Ruminococcaceae, unidentified Cyanobacteria, and Bacillus composed the top ten dominant genera of intestinal microbiota communities (Figure 6). Bacteria diversity (Shannon index) did not differ among all treatments. However, fish in the SBM group showed a trend toward higher bacterial richness (observed species) compared with fish in the FM group, while dietary CAD decreased the number of observed species compared with the SBM group (Figure 7). Unweighted unifrac-based principal coordinate analysis (PCoA) showed evident clustering of intestinal microbiota samples according to different basic diet composition. FM and SBM groups differed significantly in principal coordinate 1 (PC1) (P = 0.015), while the intestinal microbiota of SBM, C1, and C2 was not significantly different from each other (Figure 8). As revealed by LEfSe analysis, the relative abundance of Firmicutes and Blautia were significantly higher in group FM compared with the SBM group (Figure 9). Turbot fed C1 diet significantly decreased the abundance of Proteobacteria and increased Firmicutes/Bacteroidetes ratio compared with the SBM diet (P = 0.05; Figures 9, 10).

FIGURE 5
www.frontiersin.org

Figure 5. Rarefied curves for the number of observed species in the DI of turbot.

FIGURE 6
www.frontiersin.org

Figure 6. Top 10 most abundant taxa at phylum (I) and genus level (II) in the DI of turbot.

FIGURE 7
www.frontiersin.org

Figure 7. α-diversity represented by observed species (I) and Shannon diversity (II) in the DI of turbot.

FIGURE 8
www.frontiersin.org

Figure 8. Unweighted unifrac-based principal coordinate analysis (PCoA) analysis in the DI of turbot. Small dots represent individual samples.

FIGURE 9
www.frontiersin.org

Figure 9. The Linear Discriminant Analysis (LDA score >4) of microbiota communities in the DI of turbot. (I) FM vs. SBM; (II) SBM vs. C1; (III) SBM vs. C2.

FIGURE 10
www.frontiersin.org

Figure 10. The Firmicutes/Bacteroides ratio compared the SBM group to the C1 group in the DI of turbot. “P = 0.05” indicates a significant difference.

Discussion

The present study showed that dietary CAD markedly alleviated the symptom of the soybean meal-induced enteritis (SBMIE) in turbot, which was evidenced by the decreased eosinophilic granulocytes count in lamina propria and the reduced gene expression of pro-inflammatory cytokines. In line with our study, intake of porcine β-Defensin 2 attenuated the DSS-induced colitis by inhibiting the production of inflammatory mediators and preserving the integrity of colon in mice (Han et al., 2015), and Cathelicidin-WA was capable of attenuating intestinal inflammation and diarrhea in weaned diarrheal piglets (Yi et al., 2016). Moreover, it is fairly well elucidated that the development of SBMIE in turbot is in connection with the activation of nf-κb (Chen et al., 2018a; Liu et al., 2018), which in multiple ways regulates the production of various inflammatory cytokines via acting as the transcription factor binding sites (Liu et al., 2003; Sahlmann et al., 2013). In this study, the significantly decreased intestinal gene expression level of nf-κb p65 in fish fed CAD diet indicated that CAD probably blocked the nf-κb-triggered overexpression of intestinal inflammatory cytokines, which is supported by the evidences that cecropin family peptides efficiently inhibit LPS or pathogens-induced expression level of nf-κb in mouse peritoneal macrophages (Wu et al., 2015; Wei et al., 2018).

The present results concerning the perimeter ratio of intestinal villi suggested that CAD contributed to a better preserved morphological structure in turbot, implying an improved absorbency of nutrients either by an increased intestinal villi length and/or amount of mucosal folding (Dimitroglou et al., 2009). As an important component of the intestinal epithelium, tight junction (TJ) located most apical mucosa acting as a selective physical barrier to defend against numerous harmful substances (Tsukita et al., 2001). Dietary CAD increased the gene expression level of intestinal claudin-3, claudin-4, zo-1, and occludin in turbot, which is in line with the previous study showing that the Cathelicidin-BF increased mRNA level of zo-1, occludin, and claudin-1 in the colon of mice with colitis induced by DSS (Zhang et al., 2015). Likewise, human defensin 5 was able to block the ethyl alcohol and colitis-induced disruption of colonic TJ complexes in mice (Shukla et al., 2018). Since the destroy in intestinal TJ function would lead to a paracellular influx of luminal antigens, which is a crucial pathogenic factor in initiation and exacerbation of intestinal inflammation (Groschwitz and Hogan, 2009), it is proposed that the reduced intestinal inflammation in turbot fed dietary CAD may be partly due to the improved of barrier function, although the mechanism remains to be fully defined and understood.

Diets play a key role in shaping intestinal microbiota composition, which in turn well-reflects host intestinal health status (Brown et al., 2012; Pop, 2012). In the present study, the number of observed species in the SBM group was significantly increased compared with the FM group, which was in agreement with the studies in rainbow trout (Oncorhynchus mykiss) (Desai et al., 2012) and Atlantic salmon (Salmo salar) (Anne Marie et al., 2007). However, this number was strongly decreased by dietary CAD compared with the SBM group, which is in accordance with our previous finding that a diet with high supplementation of CAD significantly decreased the α-diversity of intestinal microbiota in turbot (Dai et al., 2020). The descended number of observed species clearly reflect the effective antimicrobial property of CAD in fish intestine just as it has been found to decrease the total aerobic bacterial counts in the jejunal and caecal digesta in broilers (Wen and He, 2012) and piglets (Wu et al., 2012). In terms of intestinal microbiota composition, Proteobacteria, Bacteroidetes, and Firmicutes constitute the three major members of bacteria at the phylum level in all treatment groups. This result was in agreement with the previous findings in turbot whose intestinal microbiome was unveiled by bacterial Next-Generation Sequencing (Li et al., 2017; Dai et al., 2018, 2020; Yang et al., 2018). However, a significant decrease in the relative abundance of Firmicutes was observed in SBM group compared with FM group, which was mainly attributed to losses of Blautia, while no such a difference was found between C1 and FM group, suggesting the relative abundance of Blautia was profitably increased by dietary CAD. Blautia is well-recognized as part of the butyrate-producing bacteria genus of the intestinal microbiota (Biddle et al., 2013; De Filippis et al., 2016), and some of Blautia species were able to reduce the ratio of pro- to anti-inflammatory cytokines ratio in human mononuclear cells (Benítez-Páez et al., 2020). Therefore, it is possible that the thriving of Blautia by diet C1 might facilitate the inflammation regulation. Besides, diet C1 markedly increased Firmicutes/Bacteroidetes ratio, which is an indicator closely associated with human intestinal health, significantly decreasing among people with various gut disorders such as irritable bowel syndrome and inflammatory bowel diseases (Tamboli et al., 2004; Collins, 2014). Additionally, there is an obvious reduction in members of family Prevotellaceae in the C1 group compared with the SBM group. Prevotellaceae has been reported as a prominent representation in samples from IBD patients (Kleessen et al., 2002; Lucke et al., 2006), which may disrupt the mucosal barrier function by producing sulfatases that actively degrade mucus oligosaccharide (Wright et al., 2000). Taken together, these results point to a bacterial component as being responsible for an inflammatory phenotype in SBMIE in turbot, while the shaping of microbiota composition by dietary CAD probably posed a positive effect on intestinal inflammation status.

Collectively, diet with CAD supplementation could effectively mitigate the intestinal enteritis of turbot induced by SBM, which was evidenced by inhibiting the overexpression of intestinal pro-inflammatory cytokines, enhancing the intestinal mucosal barriers, as well as improving the intestinal microbiota profiles. The improved intestinal health eventually provides the increased feed efficiency and a better growth performance of turbot. This study indicated that CAD could serve as an effective additive to promote intestinal health in turbot fed high levels of soybean meal.

Data Availability Statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found below: https://bigd.big.ac.cn/, CRA002769.

Ethics Statement

The animal study was reviewed and approved by Animal Care and Use Committee of Ocean University of China.

Author Contributions

YZ and JD designed the experiments. JD, WO, and GY contributed to performing the experiment and the data analysis. JD and YZ wrote the paper. YZ, QA, WZ, and KM contributed to revise the manuscript. All authors contributed to the article and approved the submitted version.

Funding

This research was financially supported by National Key R&D Program of China (Grant No. 2019YFD0900104), National Natural Science Foundation of China (Grant No. 31872577 and 41576137), and China Agriculture Researches System (Grant No. CARS 47-G10).

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Abbreviations

CAD, cecropin AD; FE, feed efficiency; FI, feed intake; SGR, specific growth rate; FM, fishmeal; SBM, soybean meal; tgf-β, transforming growth factor-β; tnf-α, tumor necrosis factor-α; il-1β, interleukin-1β; nf-κb p65, nuclear factor-kappa B p65; zo-1, zonula occludens-1; ifn-γ, interferon-gamma; il-8, interleukin-8; il-22, interleukin-22; SBMIE, soybean meal-induced enteritis; TJ, tight junction; AMP, antimicrobial peptide; OTU, operational taxonomic unit; PCoA, principle coordinate analysis; DI, distal intestine; LEfSe, linear discriminant analysis effect size.

References

Anne Marie, B. M., Penn, M. H., Patricia Mora, S., Ståle, R., Sigmund, S., Thor, L., et al. (2007). Effects of dietary soyabean meal, inulin and oxytetracycline on intestinal microbiota and epithelial cell stress, apoptosis and proliferation in the teleost Atlantic salmon (Salmo salar L.). Br. J. Nutr. 97, 699–713. doi: 10.1017/S0007114507381397

PubMed Abstract | CrossRef Full Text | Google Scholar

AOAC (1995). Official Methods of Analysis of Association of Official Analytical Chemists International. Arlington, VA: AOAC.

Google Scholar

Baeverfjord, G., and Krogdahl, Å. (1996). Development and regression of soybean meal induced enteritis in Atlantic salmon, Salmo salar L., distal intestine: a comparison with the intestines of fasted fish. J. Fish Dis. 19, 375–387. doi: 10.1046/j.1365-2761.1996.d01-92.x

CrossRef Full Text | Google Scholar

Benítez-Páez, A., del Pugar, E. M. G., López-Almela, I., Moya-Pérez, Á., Codoñer-Franch, P., and Sanz, Y. (2020). Depletion of Blautia species in the microbiota of obese children eelates to intestinal inflammation and metabolic phenotype worsening. mSystems 5:e00587-19. doi: 10.1128/mSystems.00857-19

PubMed Abstract | CrossRef Full Text | Google Scholar

Biddle, A., Stewart, L., Blanchard, J., and Leschine, S. (2013). Untangling the genetic basis of fibrolytic specialization by Lachnospiraceae and Ruminococcaceae in diverse gut communities. Diversity 5, 627–640. doi: 10.3390/d5030627

CrossRef Full Text | Google Scholar

Brown, K., DeCoffe, D., Molcan, E., and Gibson, D. L. (2012). Diet-induced dysbiosis of the intestinal microbiota and the effects on immunity and disease. Nutrients 4, 1095–1119. doi: 10.3390/nu4081095

PubMed Abstract | CrossRef Full Text | Google Scholar

Chen, X., Zhu, F., Cao, Y., and Qiao, S. (2009). Novel expression vector for secretion of cecropin AD in Bacillus subtilis with enhanced antimicrobial activity. Antimicrob. Agents Chemother. 53, 3683–3689. doi: 10.1128/AAC.00251-09

PubMed Abstract | CrossRef Full Text | Google Scholar

Chen, Z., Liu, Y., Li, Y., Yang, P., Hu, H., Yu, G., et al. (2018a). Dietary arginine supplementation mitigates the soybean meal induced enteropathy in juvenile turbot, Scophthalmus maximus L. Aquac. Res. 49, 1535–1545. doi: 10.1111/are.13608

CrossRef Full Text | Google Scholar

Chen, Z., Zhao, S., Liu, Y., Yang, P., Ai, Q., Zhang, W., et al. (2018b). Dietary citric acid supplementation alleviates soybean meal-induced intestinal oxidative damage and micro-ecological imbalance in juvenile turbot, Scophthalmus maximus L. Aquac. Res. 49, 3804–3816. doi: 10.1111/are.13847

CrossRef Full Text | Google Scholar

Clements, K. D., Angert, E. R., Montgomery, W. L., and Choat, J. H. (2014). Intestinal microbiota in fishes: what's known and what's not. Mol. Ecol. 23, 1891–1898. doi: 10.1111/mec.12699

CrossRef Full Text | Google Scholar

Collins, S. M. (2014). A role for the gut microbiota in IBS. Nat. Rev. Gastroenterol. Hepatol. 11, 497–505. doi: 10.1038/nrgastro.2014.40

PubMed Abstract | CrossRef Full Text | Google Scholar

Dai, J., Li, Y., Yang, P., Liu, Y., Chen, Z., Ou, W., et al. (2018). Citric acid as a functional supplement in diets for juvenile turbot, Scophthalmus maximus L.: effects on phosphorus discharge, growth performance, and intestinal health. Aquaculture 495, 643–653. doi: 10.1016/j.aquaculture.2018.04.004

CrossRef Full Text | Google Scholar

Dai, J., Zheng, J., Ou, W., Xu, W., Ai, Q., Zhang, W., et al. (2020). The effect of dietary cecropin AD on intestinal health, immune response and disease resistance of juvenile turbot (Scophthalmus maximus L.). Fish Shellfish Immunol. 100, 117–125. doi: 10.1016/j.fsi.2020.02.052

PubMed Abstract | CrossRef Full Text | Google Scholar

De Filippis, F., Pellegrini, N., Vannini, L., Jeffery, I. B., La Storia, A., Laghi, L., et al. (2016). High-level adherence to a Mediterranean diet beneficially impacts the gut microbiota and associated metabolome. Gut 65, 1812–1821. doi: 10.1136/gutjnl-2015-309957

PubMed Abstract | CrossRef Full Text | Google Scholar

DeMeo, M. T., Mutlu, E. A., Keshavarzian, A., and Tobin, M. C. (2002). Intestinal permeation and gastrointestinal disease. J. Clin. Gastroenterol. 34, 385–396. doi: 10.1097/00004836-200204000-00003

PubMed Abstract | CrossRef Full Text | Google Scholar

Desai, A. R., Links, M. G., Collins, S. A., Mansfield, G. S., Drew, M. D., Van Kessel, A. G., et al. (2012). Effects of plant-based diets on the distal gut microbiome of rainbow trout (Oncorhynchus mykiss). Aquaculture 350, 134–142. doi: 10.1016/j.aquaculture.2012.04.005

CrossRef Full Text | Google Scholar

Dimitroglou, A., Merrifield, D., Moate, R., Davies, S., Spring, P., Sweetman, J., et al. (2009). Dietary mannan oligosaccharide supplementation modulates intestinal microbial ecology and improves gut morphology of rainbow trout, Oncorhynchus mykiss (Walbaum). J. Anim. Sci. 87, 3226–3234. doi: 10.2527/jas.2008-1428

PubMed Abstract | CrossRef Full Text | Google Scholar

Dong, X.-Q., Zhang, D.-M., Chen, Y.-K., Wang, Q.-J., and Yang, Y.-Y. (2015). Effects of antimicrobial peptides (AMPs) on blood biochemical parameters, antioxidase activity, and immune function in the common carp (Cyprinus carpio). Fish Shellfish Immunol. 47, 429–434. doi: 10.1016/j.fsi.2015.09.030

PubMed Abstract | CrossRef Full Text | Google Scholar

Groschwitz, K. R., and Hogan, S. P. (2009). Intestinal barrier function: molecular regulation and disease pathogenesis. J. Allergy Clin. Immunol. 124, 3–20. doi: 10.1016/j.jaci.2009.05.038

PubMed Abstract | CrossRef Full Text | Google Scholar

Han, F., Zhang, H., Xia, X., Xiong, H., Song, D., Zong, X., et al. (2015). Porcine β-defensin 2 attenuates inflammation and mucosal lesions in dextran sodium sulfate–induced colitis. J. Immunol. 194, 1882–1893. doi: 10.4049/jimmunol.1402300

PubMed Abstract | CrossRef Full Text | Google Scholar

Hancock, R. E. W., Haney, E. F., and Gill, E. E. (2016). The immunology of host defence peptides: beyond antimicrobial activity. Nat. Rev. Immunol. 16, 321–334. doi: 10.1038/nri.2016.29

PubMed Abstract | CrossRef Full Text | Google Scholar

Kim, J.-K., Lee, E., Shin, S., Jeong, K.-W., Lee, J.-Y., Bae, S.-Y., et al. (2011). Structure and function of papiliocin with antimicrobial and anti-inflammatory activities isolated from the swallowtail butterfly, Papilio xuthus. J. Biol. Chem. 286, 41296–41311. doi: 10.1074/jbc.M111.269225

PubMed Abstract | CrossRef Full Text | Google Scholar

Kleessen, B., Kroesen, A., Buhr, H., and Blaut, M. (2002). Mucosal and invading bacteria in patients with inflammatory bowel disease compared with controls. Scand. J. Gastroenterol. 37, 1034–1041. doi: 10.1080/003655202320378220

PubMed Abstract | CrossRef Full Text | Google Scholar

Krogdahl, Å., Bakke-McKellep, A., and Baeverfjord, G. (2003). Effects of graded levels of standard soybean meal on intestinal structure, mucosal enzyme activities, and pancreatic response in Atlantic salmon (Salmo salar L.). Aquac. Nutr. 9, 361–371. doi: 10.1046/j.1365-2095.2003.00264.x

CrossRef Full Text | Google Scholar

Lee, E., Shin, A., and Kim, Y. (2015). Anti-inflammatory activities of cecropin a and its mechanism of action. Arch. Insect Biochem. Physiol. 88, 31–44. doi: 10.1002/arch.21193

PubMed Abstract | CrossRef Full Text | Google Scholar

Li, S., Chi, S., Cheng, X., Wu, C., Xu, Q., Qu, P., et al. (2020). Effects of antimicrobial peptides on the growth performance, antioxidant and intestinal function in juvenile largemouth bass, Micropterus salmoides. Aquac. Rep. 16:100252. doi: 10.1016/j.aqrep.2019.100252

CrossRef Full Text | Google Scholar

Li, Y., Yang, P., Zhang, Y., Ai, Q., Xu, W., Zhang, W., et al. (2017). Effects of dietary glycinin on the growth performance, digestion, intestinal morphology and bacterial community of juvenile turbot, Scophthalmus maximus L. Aquaculture 479, 125–133. doi: 10.1016/j.aquaculture.2017.05.008

CrossRef Full Text | Google Scholar

Lin, X., Chen, W., Lin, S., and Luo, L. (2015). Effects of dietary cecropin on growth, non-specific immunity and disease resistance of tilapia (O. reochromis niloticus × O. aureus). Aquac. Res. 46, 2999–3007. doi: 10.1111/are.12457

CrossRef Full Text | Google Scholar

Liu, H., Pan, C., Liu, Q., Yang, W., and Liu, X. (2003). Effect of NF-κB and p38 MAPK in activated monocytes/macrophages on pro-inflammatory cytokines of rats with acute pancreatitis. World J. Gastroenterol. 9, 2513–2518. doi: 10.3748/wjg.v9.i11.2513

PubMed Abstract | CrossRef Full Text | Google Scholar

Liu, Y., Chen, Z., Dai, J., Yang, P., and Mai, K. (2018). The protective role of glutamine on enteropathy induced by high dose of soybean meal in turbot, Scophthalmus maximus L. Aquaculture 497, 510–519. doi: 10.1016/j.aquaculture.2018.08.021

CrossRef Full Text | Google Scholar

Liu, Y., Chen, Z., Dai, J., Yang, P., Xu, W., Ai, Q., et al. (2019). Sodium butyrate supplementation in high-soybean meal diets for turbot (Scophthalmus maximus L.): effects on inflammatory status, mucosal barriers and microbiota in the intestine. Fish Shellfish Immunol. 88, 65–75. doi: 10.1016/j.fsi.2019.02.064

PubMed Abstract | CrossRef Full Text | Google Scholar

Lucke, K., Miehlke, S., Jacobs, E., and Schuppler, M. (2006). Prevalence of Bacteroides and Prevotella spp. in ulcerative colitis. J. Med. Microbiol. 55, 617–624. doi: 10.1099/jmm.0.46198-0

PubMed Abstract | CrossRef Full Text | Google Scholar

Luis Balcázar, J., Decamp, O., Vendrell, D., De Blas, I., and Ruiz-Zarzuela, I. (2006). Health and nutritional properties of probiotics in fish and shellfish. Microb. Ecol. Health Dis. 18, 65–70. doi: 10.1080/08910600600799497

CrossRef Full Text | Google Scholar

Mansfield, G. S., Desai, A. R., Nilson, S. A., Van Kessel, A. G., Drew, M. D., and Hill, J. E. (2010). Characterization of rainbow trout (Oncorhynchus mykiss) intestinal microbiota and inflammatory marker gene expression in a recirculating aquaculture system. Aquaculture 307, 95–104. doi: 10.1016/j.aquaculture.2010.07.014

CrossRef Full Text | Google Scholar

Merrifield, D. L., Dimitroglou, A., Bradley, G., Baker, R. T. M., and Davies, S. J. (2009). Soybean meal alters autochthonous microbial populations, microvilli morphology and compromises intestinal enterocyte integrity of rainbow trout, Oncorhynchus mykiss (Walbaum). J. Fish Dis. 32, 755–766. doi: 10.1111/j.1365-2761.2009.01052.x

CrossRef Full Text | Google Scholar

Pop, M. (2012). We are what we eat: how the diet of infants affects their gut microbiome. Genome Biol. 13:152. doi: 10.1186/gb-2012-13-4-152

CrossRef Full Text | Google Scholar

Reddy, K. V. R., Yedery, R. D., and Aranha, C. (2004). Antimicrobial peptides: premises and promises. Int. J. Antimicrob. Agents 24, 536–547. doi: 10.1016/j.ijantimicag.2004.09.005

PubMed Abstract | CrossRef Full Text | Google Scholar

Refstie, S., Baeverfjord, G., Seim, R. R., and Elveb,ø, O. (2010). Effects of dietary yeast cell wall β-glucans and MOS on performance, gut health, and salmon lice resistance in Atlantic salmon (Salmo salar) fed sunflower and soybean meal. Aquaculture 305, 109–116. doi: 10.1016/j.aquaculture.2010.04.005

CrossRef Full Text | Google Scholar

Reveco, F. E., Øverland, M., Romarheim, O. H., and Mydland, L.T. (2014). Intestinal bacterial community structure differs between healthy and inflamed intestines in Atlantic salmon (Salmo salar L.). Aquaculture 420, 262–269. doi: 10.1016/j.aquaculture.2013.11.007

CrossRef Full Text | Google Scholar

Sahlmann, C., Sutherland, B. J. G., Kortner, T. M., Koop, B. F., Krogdahl, A., and Bakke, A. M. (2013). Early response of gene expression in the distal intestine of Atlantic salmon (Salmo salar L.) during the development of soybean meal induced enteritis. Fish Shellfish Immunol. 34, 599–609. doi: 10.1016/j.fsi.2012.11.031

PubMed Abstract | CrossRef Full Text | Google Scholar

Sealey, W. M., Barrows, F. T., Smith, C. E., Overturf, K., and LaPatra, S. E. (2009). Soybean meal level and probiotics in first feeding fry diets alter the ability of rainbow trout Oncorhynchus mykiss to utilize high levels of soybean meal during grow-out. Aquaculture 293, 195–203. doi: 10.1016/j.aquaculture.2009.04.013

CrossRef Full Text | Google Scholar

Shukla, P. K., Meena, A. S., Rao, V., Rao, R. G., Balazs, L., and Rao, R. (2018). Human defensin-5 blocks ethanol and colitis-induced dysbiosis, tight junction disruption and inflammation in mouse intestine. Sci. Rep 8:16241. doi: 10.1038/s41598-018-34263-4

PubMed Abstract | CrossRef Full Text | Google Scholar

Su, L., Nalle, S. C., Shen, L., Turner, E. S., Singh, G., Breskin, L. A., et al. (2013). TNFR2 activates MLCK-dependent tight junction dysregulation to cause apoptosis-mediated barrier loss and experimental colitis. Gastroenterology 145, 407–415. doi: 10.1053/j.gastro.2013.04.011

PubMed Abstract | CrossRef Full Text | Google Scholar

Su, Y.-L., Chen, G., Chen, L.-S., Li, J.-Z., Wang, G., He, J.-Y., et al. (2019). Effects of antimicrobial peptides on serum biochemical parameters, antioxidant activity and non-specific immune responses in Epinephelus coioides. Fish Shellfish Immunol. 86, 1081–1087. doi: 10.1016/j.fsi.2018.12.056

PubMed Abstract | CrossRef Full Text | Google Scholar

Tamboli, C. P., Neut, C., Desreumaux, P., and Colombel, J. (2004). Dysbiosis in inflammatory bowel disease. Gut 53, 1–4. doi: 10.1136/gut.53.1.1

CrossRef Full Text | Google Scholar

Tsukita, S., Furuse, M., and Itoh, M. (2001). Multifunctional strands in tight junctions. Nat. Rev. Mol. Cell Biol. 2, 285–293. doi: 10.1038/35067088

PubMed Abstract | CrossRef Full Text | Google Scholar

Ulloa, P. E., Solís, C. J., Paz, J. F. D. L., Alaurent, T. G. S., Caruffo, M., Hernández, A. J., et al. (2016). Lactoferrin decreases the intestinal inflammation triggered by a soybean meal-based diet in zebrafish. J. Immunol. Res. 2016:1639720. doi: 10.1155/2016/1639720

PubMed Abstract | CrossRef Full Text | Google Scholar

Wei, L., Yang, Y., Zhou, Y., Li, M., Yang, H., Mu, L., et al. (2018). Anti-inflammatory activities of Aedes aegypti cecropins and their protection against murine endotoxin shock. Parasit. Vectors 11:470. doi: 10.1186/s13071-018-3000-8

PubMed Abstract | CrossRef Full Text | Google Scholar

Wen, L. F., and He, J. G. (2012). Dose-response effects of an antimicrobial peptide, a cecropin hybrid, on growth performance, nutrient utilisation, bacterial counts in the digesta and intestinal morphology in broilers. Br. J. Nutr. 108, 1756–1763. doi: 10.1017/S0007114511007240

PubMed Abstract | CrossRef Full Text | Google Scholar

Wright, D. P., Rosendale, D. I., and Roberton, A. M. (2000). Prevotella enzymes involved in mucin oligosaccharide degradation and evidence for a small operon of genes expressed during growth on mucin. FEMS Microbiol. Lett. 190, 73–79. doi: 10.1111/j.1574-6968.2000.tb09265.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Wu, J., Mu, L., Zhuang, L., Han, Y., Liu, T., Li, J., et al. (2015). A cecropin-like antimicrobial peptide with anti-inflammatory activity from the black fly salivary glands. Parasit. Vectors 8:561. doi: 10.1186/s13071-015-1176-8

PubMed Abstract | CrossRef Full Text | Google Scholar

Wu, S., Zhang, F., Huang, Z., Liu, H., Xie, C., Zhang, J., et al. (2012). Effects of the antimicrobial peptide cecropin AD on performance and intestinal health in weaned piglets challenged with Escherichia coli. Peptides 35, 225–230. doi: 10.1016/j.peptides.2012.03.030

PubMed Abstract | CrossRef Full Text | Google Scholar

Yang, P., Hu, H., Liu, Y., Li, Y., Ai, Q., Xu, W., et al. (2018). Dietary stachyose altered the intestinal microbiota profile and improved the intestinal mucosal barrier function of juvenile turbot, Scophthalmus maximus L. Aquaculture 486, 98–106. doi: 10.1016/j.aquaculture.2017.12.014

CrossRef Full Text | Google Scholar

Yi, H., Zhang, L., Gan, Z., Xiong, H., Yu, C., Du, H., et al. (2016). High therapeutic efficacy of cathelicidin-WA against postweaning diarrhea via inhibiting inflammation and enhancing epithelial barrier in the intestine. Sci. Rep. 6:25679. doi: 10.1038/srep25679

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhai, Z., Ni, X., Jin, C., Ren, W., Li, J., Deng, J., et al. (2018). Cecropin a modulates tight junction-related protein expression and enhances the barrier function of porcine intestine epithelial cells by suppressing the MEK/ERK pathway. Int. J. Mol. Sci. 19:1941. doi: 10.3390/ijms19071941

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhang, H., Xia, X., Han, F., Jiang, Q., Rong, Y., Song, D., et al. (2015). Cathelicidin-BF, a novel antimicrobial peptide from Bungarus fasciatus, attenuates disease in a dextran sulfate sodium model of colitis. Mol. Pharm. 12, 1648–1661. doi: 10.1021/acs.molpharmaceut.5b00069

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhao, S., Chen, Z., Zheng, J., Dai, J., Ou, W., Xu, W., et al. (2019). Citric acid mitigates soybean meal induced inflammatory response and tight junction disruption by altering TLR signal transduction in the intestine of turbot, Scophthalmus maximus L. Fish Shellfish Immunol. 92, 181–187. doi: 10.1016/j.fsi.2019.06.004

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhou, X. X., Wang, Y. B., and Li, W. F. (2008). Effect of feeding apidaecin on common carp (Cyprinus carpio) growth performances and immune function. Aquaculture 279, 108–112. doi: 10.1016/j.aquaculture.2008.04.024

CrossRef Full Text | Google Scholar

Zhou, Z., Ringo, E., Olsen, R. E., and Song, S. K. (2018). Dietary effects of soybean products on gut microbiota and immunity of aquatic animals: a review. Aquac. Nutr. 24, 644–665. doi: 10.1111/anu.12532

CrossRef Full Text | Google Scholar

Keywords: cecropin AD, intestinal inflammation, intestinal tight junction, intestinal microbiota, turbot

Citation: Dai J, Ou W, Yu G, Ai Q, Zhang W, Mai K and Zhang Y (2020) The Antimicrobial Peptide Cecropin AD Supplement Alleviated Soybean Meal-Induced Intestinal Inflammation, Barrier Damage, and Microbial Dysbiosis in Juvenile Turbot, Scophthalmus maximus. Front. Mar. Sci. 7:584482. doi: 10.3389/fmars.2020.584482

Received: 17 July 2020; Accepted: 06 November 2020;
Published: 27 November 2020.

Edited by:

Kang-le Lu, Jimei University, China

Reviewed by:

Yun-Zhang Sun, Jimei University, China
Rui Jia, Chinese Academy of Fishery Sciences, China
Jin Niu, Sun Yat-sen University, China

Copyright © 2020 Dai, Ou, Yu, Ai, Zhang, Mai and Zhang. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

*Correspondence: Yanjiao Zhang, yanjiaozhang@ouc.edu.cn