Abstract
Buffalo is a luxurious genetic resource with multiple utilities (as a dairy, draft, and meat animal) and economic significance in the tropical and subtropical regions of the globe. The excellent potential to survive and perform on marginal resources makes buffalo an important source for nutritious products, particularly milk and meat. This study was aimed to investigate the evolutionary relationship, physiochemical properties, and comparative genomic analysis of the casein gene family (CSN1S1, CSN2, CSN1S2, and CSN3) in river and swamp buffalo. Phylogenetic, gene structure, motif, and conserved domain analysis revealed the evolutionarily conserved nature of the casein genes in buffalo and other closely related species. Results indicated that casein proteins were unstable, hydrophilic, and thermostable, although αs1-CN, β-CN, and κ-CN exhibited acidic properties except for αs2-CN, which behaved slightly basic. Comparative analysis of amino acid sequences revealed greater variation in the river buffalo breeds than the swamp buffalo indicating the possible role of these variations in the regulation of milk traits in buffalo. Furthermore, we identified lower transcription activators STATs and higher repressor site YY1 distribution in swamp buffalo, revealing its association with lower expression of casein genes that might subsequently affect milk production. The role of the main motifs in controlling the expression of casein genes necessitates the need for functional studies to evaluate the effect of these elements on the regulation of casein gene function in buffalo.
Introduction
Buffalo is a luxurious genetic resource with multiple utilities (as a dairy, draft, and meat animal) and economic significance in the tropical and subtropical regions of the globe (Rehman et al., 2019, 2020; ). The domesticated buffalo is grouped into river buffalo with karyotype 2n = 50 primarily present in southwestern Asia, India, south Mediterranean Europe, and Egypt and swamp buffalo with 2n = 48 distributed across Southeast Asia, southern and southeast China, where the swamp buffalo is used as draft power in the rice paddy fields while the river buffalo is mainly reared for milk production (; ; ). The excellent potential to survive and perform on marginal resources under harsh environmental conditions makes buffalo an important source for nutritious products, particularly milk and meat. Buffalo contributes about 13% of global milk production where the river buffalo produces 2,000 kg milk per year and swamp buffalo annual production is 500–600 kg (; ; ). Moreover, the physio-chemical characteristics of buffalo milk are different from cow milk, and buffalo milk is relished due to its peculiar taste and higher butterfat content ().
Buffalo milk contains higher protein, fat, and total solid contents relative to dairy cow milk (). The milk proteins are broadly categorized into whey (serum) protein and casein protein families based on their physio-chemical properties. Casein (CN) is the major milk protein, contributing 80% of the whole milk proteins including α-s1-CN, α-s2-CN, β-CN, and k-CN. Each CN protein has its unique amino acid configuration, genetic and functional properties (). Milk CNs are physiologically important as they provide food to the newborn and are associated with milk processing properties and lactation behaviors of dairy animals ().
Notably, the CN protein is characterized into calcium-sensitive αS1, αS2, and β caseins, in young one sustenance bone growth through providing calcium, and phosphorus enriched stable micelles, and the Ca-insensitive κ-casein (). So far, in mammals, caseins are the main constituent of milk proteins. The casein proteins coding genes CSN1S1 (αs1-casein), CSN1S2 (αs2-casein), CSN2 (β-casein), and CSN3 (κ-casein), have been mapped in the 250-350kb genomic DNA cluster on chromosome 6 in sheep, goat, and cattle (Rijnkels, 2002).
Casein is considered a powerful molecular model for evolutionary research (). It is also a useful tool to better understand the genetic architecture of less-studied species, phylogenetic relationships among mammalian species, and domestic animals, particularly the buffalo breeds (rive and swamp). From a physiological standpoint, there is a difference in milk yield and composition traits, including protein, fat, and solid contents among different species or breeds, suggesting the potential role of gene regulatory regions in these breeds. Exploring the genetic architecture and evolutionary processes is imperative to understand the regulatory mechanisms of the casein gene family in the buffalo. This study aims to investigate the evolutionary relationship, physiochemical properties, comparative genomics, and gene regulatory regions analysis of the casein gene family in river and swamp buffalo.
Materials and Methods
The sequences of different casein genes (CSN1S1, CSN2, CSN1S2, and CSN3) of Bos taurus were retrieved from NCBI1 and used as queries for the identification of casein genes from the buffalo genome. The buffalo (river and swamp) whole-genome sequences were downloaded from the Bigdata center and NCBI1,2. The Bos taurus casein protein sequences (XP_005208084.1, XP_024848786.1, XP_010804480.2, and XP_024848756.1) were used in BLAST search with an E value less or equal to 1.0 × e–5 with all default parameters, to retrieve non-redundant protein sequences of the buffalo. To avoid ambiguity, the redundancy of the sequences was checked. The chromosomal locations of casein genes were obtained from buffalo genome resources through the GFF file of annotated buffalo genome with corresponding gene positions in the MCScanX program as reported earlier (Wang et al., 2012).
The Maximum Likelihood method based on the JTT matrix model was used to infer the evolutionary history of representative species (). The accessions number of amino acid sequences used to construct the phylogenetic tree and holology of the representative speices sequence are given in Supplementary Table S1. The likelihood phylogram of 44 amino acid sequences with the highest log (−1641.52) was downloaded and the percentage of trees in which the associated taxa clustered together presented next to the branches. A bootstrap value of 3,000 replicates was used and the percentage of resampling was visualized on the node of the phylogram. All the missing and gaped positions were eliminated and MEGA7 was used to conduct the evolutionary analyses ().
Moreover, the genomic and coding sequence data of casein genes from buffalo and cattle were submitted to Gene Structure Display Server 2.03, for gene structure analysis and visualization of untranslated regions and exon-intron structure (). Additionally, 10 MEME (Multiple EM for Motif Elicitation) conserved motifs of caseins were explored using the MEME Suite4 (). The NCBI conserved domain (CDD) database was used to confirm the conserved domains5.
ProtParam tool was used to illustrate the physio-chemical properties of buffalo casein proteins including the isoelectric point (pI), grand average of hydropathicity (GRAVY), molecular weight (MW), number of amino acids, instability index (II), and aliphatic index (AI) (). Multiple sequence alignment of casein protein sequences was performed in Multiple Align Show to visualize the sequence variations and indels6.
The genomic sequences of casein genes of Mediterranean and swamp buffalo were subjected to the Promoter 2.0 Prediction Server7 to detect potential signals for putative transcription binding factor. The site with a score >1.0 was presumed as a high likelihood predicted site and the putative transcription binding factor site sequence was searched in the 100bp upstream regions from the high likelihood predicted site (). Further, the genomic sequences were analyzed in TFBIND software8 by using the transcription factor database TRANSFAC R.3.4 weight matrix to find the transcription factor binding sites (Tsunoda and Takagi, 1999). According described previously, four potential transcription factor binding sites (GATA, TATA, STAT, and OCT1) (; Robinson et al., 1998; Rosen et al., 1999; Wheeler et al., 2001; Wyszomierski and Rosen, 2001; Yamashita et al., 2001; ; Pauciullo et al., 2019) and one repressor site (YY1) (; Tomic et al., 1999) in casein genes of Mediterranean and swamp buffalo in 100bp upstream regions of the potential signal site were calculated (Wyszomierski and Rosen, 2001). The significant difference for the distribution of putative transcription factor binding and repressor sites in Mediterranean and swamp buffalo was statistically evaluated by using a t-test with a P-value of < 0.05 as statistical significance. Moreover, the potential nuclear hormone receptor sites in the genome of Mediterranean buffalo were detected by using the NHR scan9.
Results
The molecular phylogenetic analysis of representative bovine species revealed that all the casein gene sequences were clustered into four groups; CSN1S1, CSN2, CSN1S2, and CSN3 (Figure 1). Additionally, overall phylogenetic relationships revealed that Bubalus bubalis CSN gene family is more closely related to Bos mutus, Bos taurus, and Bos indicus sharing higher sequence homology about 93, 91, and 90%, respectively, as compared to the Capra hircus, Ovis aries and hybrid cattle with 86, 84, and 74% similarity respectively. Moreover, distantly related species included Camelus ferus and Equus caballus with 55 and 50% resemblance, respectively (Supplementary Table S2).
FIGURE 1
Furthermore, to perform the structural characterization of the CSN gene family in different species, analysis of gene organization, motifs pattern, and the conserved domains were carried out considering their phylogenetic relationships (Figure 2). In casein genes, 10 MEME conserved motifs were identified (Figure 2C). Motif 3 corresponding to 21 amino acid was annotated as kappa casein (K-CN) domain while motif 4, 5, and 6 were annotated as casein domain after the Pfams search (Table 1). The CDD BLAST was used to confirm the identified conserved domains (Figure 2D). Additionally, the ODAM and PHA03247 superfamily domain has also been dredged up in CSN genes (Figure 2D). Besides, the upstream and downstream untranslated regions (UTRs) and intron structure considerably varied, structural analysis of the gene indicated that buffalo CSN genes in the same group possess a corresponding number of introns and exons (Figure 2B). However, different CSN gene groups exhibited a variable pattern of introns and exons (Figure 2B).
FIGURE 2
TABLE 1
| Motif | Protein sequence | Length | Pfam domain |
| MEME-1 | NTLPENISSAEETDVAREPYKQLEAMAISPSKEALAT | 37 | – |
| MEME-2 | MKLLILTCLVALALARPLEELKVQGEPQEVLNENEERFFVA | 41 | – |
| MEME-3 | BKYQQKELALINNQYLAYPYY | 21 | K-CN |
| MEME-4 | FRQFYQLDAYPSGAWYYVPLGTQYTDAPSFSDIPNPIGSENSGKTTMPLW | 50 | CN |
| MEME-5 | VEVFTEKTKLTEEDVERLNLLKKJSQSYMHFPK | 33 | CN |
| MEME-6 | IPSINKILPVEPKAVPYPZADEPIVAFLEYSEEVJGPVPEP | 41 | CN |
| MEME-7 | QYLYQGPIVLNPWDQVKRNAVPITPTLNR | 29 | – |
| MEME-8 | TFCKEVVRNANEEEYSIGSSSEESAEVAT | 29 | – |
| MEME-9 | NKEVEKFQKEEKPST | 15 | – |
| MEME-10 | MKFFIFTCLLAVALA | 15 | – |
Ten differentially conserved motifs detected in casein protein (CSN1S1, CSN1S2, CSN2, and CSN3) gene family.
K-CN; kappa casein, CN; Casein.
Physiochemical properties of the CSN gene family in Bubalus bubalis was determined in terms of their distribution on the chromosome, exon count, molecular weight (Da), number of the amino acids (A.A) in each peptide, aliphatic index (AI), isoelectric point (pI), instability index (II) and Grand Average of hydropathicity Index (GRAVY) (Table 2). All the CSN genes were found on chromosome 7 in the region between ∼250 kb that harbors a variable number of exons and inconsistent length of the gene with amino acid residues (Table 2). The molecular weight of CN proteins ranged from 21 to 29 kDa. The CN peptides in buffalo were observed as unstable but thermostable proteins as the aliphatic index for all caseins had values > 65. Further, the pI values revealed that all CN proteins αs1-CN, β-CN, and κ-CN were acidic peptides except αs2-CN which behaved slightly basic in nature (Table 2). Lower values of GRAVY indicate the hydrophilic nature of buffalo CN proteins (Table 2).
TABLE 2
| Buffalo breed | Gene | Chromosome | Exon count | MW (Da) | A.A | pI | AI | II | GRAVY |
| Italian | CSN1S1 | 7 | 19 | 23451.87 | 206 | 4.89 | 90.87 | 59.32 | −0.332 |
| Italian | CSN1S2 | 7 | 18 | 25081.53 | 213 | 7.66 | 73.66 | 45.54 | −0.699 |
| Italian | CSN2 | 7 | 9 | 29110.29 | 259 | 6.31 | 100.04 | 92.21 | −0.124 |
| Italian | CSN3 | 7 | 5 | 21409.62 | 190 | 6.83 | 86.21 | 49.60 | −0.232 |
Physiochemical properties of the casein gene family in Bubalus bubalis (Mediterranean breed).
MW, Molecular Weight in Daltons; A.A, number of amino acids; pI, Isoelectric point; AI, Aliphatic Index; II, Instability Index; and GRAVY, Grand Average of hydropathicity Index.
Comparative amino acid analysis of buffalo breeds revealed 7 indels in CSN genes including a single indel in both CSN1S1 and CSN3 while two indels in CSN1S2 and 3 in CSN2. The CSN1S1 gene has an indel of 8 amino acids at position 50 > 57 whereas single amino acid change V46 > M in Murrah and S193 > L in Mediterranean buffalo was also observed (Figure 3A). Two indels of variable length were in CSN1S2, where 9 amino acid indel is positioned at 149 > 157, presumably is due to an alternative splicing of exon 13, and the second indel toward the terminal end of the peptide with a length of three amino acids 220 > 222. In swamp buffalo, three amino acid variations A131 > T, I162 > F, and T190 > A were also detected in CSN1S2 (Figure 3B). Furthermore, in CSN2 two prominent indels toward terminal ends with a length of 35 amino acids (5′end) at 1 > 35 and 12 amino acids (3′end) at 261 > 272, and a short indel of 2 amino acids 91 > 92 was observed. A single amino acid modification was observed in the Mediterranean buffalo (N120 > K) but much variable amino acid in three buffalo breeds was observed at 93 M > T > I (Figure 3C). Moreover, a highly variable region toward the 5′ end in CSN3 was perceived with an indel of 11 amino acids 19 > 29. All single amino acid differences were marked in Mediterranean buffalo except P40 > L which is observed in swamp buffalo (Figure 3D).
FIGURE 3
The genome sequences of Mediterranean and swamp buffalo CSN gene family was scanned to find out putative transcription factors binding sites by selecting previously reported four potential transcription sites (GATA, TATA, STAT, and OCT1), and one repressor binding site (YY1) (Supplementary Tables S3, S4). Both Mediterranean and swamp buffalo shared approximately an equal number of respective transcription sites except the repressor site YY1 that was highly distributed (P < 0.05) in the swamp buffalo as compared to the Mediterranean buffalo (Figure 4 and Supplementary Table S5). The distribution of GATA in the Mediterranean was 35, 6, 44, and 15 correspondings to CSN1S1, CSN2, CSN1S2, and CSN3, respectively, while swamp buffalo had 41, 29, 43, and 8, respectively (Figure 4 and Supplementary Table S5). Furthermore, TATA site distribution in Mediterranean buffalo was 3, 1, 7, and 1 in CSN1S1, CSN2, CSN1S2, and CSN3, respectively but in swamp buffalo, it was 1, 2, 12, and 3, respectively (Figure 4 and Supplementary Table S5). A considerable difference (P > 0.05) was observed in the STAT site’s distribution in CSN1S1 (9 vs. 3), CSN2 (4 vs. 2), CSN1S2 (7 vs. 7), and CSN3 (4 vs. 5) of Mediterranean and swamp buffalo (Figure 4 and Supplementary Table S5). The distribution of OCT1 transcription sites varied across the CSN1S1 (21 vs. 13), CSN2 (9 vs. 6), CSN1S2 (32 vs. 45), and CSN3 (4 vs. 9) of Mediterranean and swamp buffalo (Figure 4 and Supplementary Table S5).
FIGURE 4
The pattern of nuclear hormone receptors (NHRs) sites in the CSN gene family of Bubalus bubalis was explored using genome sequence data of Mediterranean buffalo. A total of 58 NHRs sites were observed in the buffalo CSN gene family that was mostly distributed toward 5′end (Figure 5 and Supplementary Table S6). Moreover, the number of NHRs identified in CSN1S1, CSN1S2, CSN2, and CSN3 were 17, 22, 4, and 15, respectively (Figure 5). A total of 7 inverted repeats (IR) were observed in different CSN genes that are primarily used as the hormonal response element (HRE) important for steroid receptors. Single IR in each of CSN1S1 and CSN3, while 5 IR were observed in CSN1S2 whereas, CSN2 harbored no IR (Figure 5 and Supplementary Table S6). In total 22 direct repeats (DR) and 29 everted repeats (ER) were found in the buffalo CSN genes which are prominently used by type II receptors (RXR) and some type III receptors (orphan receptors) can also able to use DR. The number of DR distributed in CSN1S1, CSN1S2, CSN2, and CSN3 was 6, 4, 3, and 9, and ER was 10, 13, 1, and 5, respectively (Figure 5 and Supplementary Table S6). All these HRE were detected close to the putative transcription binding sites (Supplementary Tables S3, S4, S6).
FIGURE 5
Discussion
The advances in genome sequencing technology particularly next-generation sequencing has led to the availability of sequenced genomes for different animal species that opens up new ways to understand genomic architecture at the molecular level (). Comparative genomics provides an opportunity for discovering novel genes and their functional components (Wei et al., 2002; Rijnkels et al., 2003). Exploring the genetics and evolutionary processes is required to understand the regulatory mechanisms of different physiological important genes like the CSN gene family in mammals. Buffalo possesses significant economic attributes owing to its high milk protein contents which are imperative for the production of commercial dairy products like cheese. The milk proteins and related coding genes have been ubiquitously studied due to their extensive distribution in all mammalian species, as an enriched nutrient source for neonates. Caseins (αs1, αs2, β, and κ) are the primary components of milk protein content in dairy animals. All the mammalian CSN genes are rapidly evolving genes and are mainly classified into four types including CSN1S1, CSN2, CSN1S2, and CSN3 (). The results of our molecular phylogenetic analysis of the CSN gene family are in consensus as all the representative species were clustered into four taxa. The buffalo species were grouped with cattle, Capra hircus, and Ovis aries sharing higher sequence homology with cattle breeds (Figure 1).
The amino acid sequence of protein data can impersonate a better prototype of biologically substantial conserved evolutionary motifs. For protein structural and functional analyses, these conserved regions are vital and can be traced by Multiple sequence alignment (). In reference to the aligned sequence of the CSN gene, high variation has been reported in all the CSN genes. Even though closely related species represent increased sequence similarity with conserved and non-conserved genomic regions (). In the present study, sequence analysis of CN protein revealed 10 conserved motifs in buffalo, and cattle using the MEME tool. Apart from the sequence variations in the CSN gene, further differences and divergence were observed because of different incidents including exon skipping (). Besides, the upstream and downstream UTRs and introns structure considerably varied, structural analysis of the gene indicated that buffalo CSN genes in the same group have a consistent number of exons and introns but variable patterns of exons and introns have also been observed. The variability of UTRs and intronic regions is mostly because of the absence or presence of retroposonic elements. In fact, these ruminants-specific retrotransposons insertions are often polymorphic (absent or present) at orthologous loci and they are highly informative genetic markers that can be considered a powerful phylogenetic tool for clustering studies, animal evolutionary history, population structure, and demography. In general, these elements are known to affect the genome in many other different ways: contributing to the genome size increase, genomic instability, exonization, epigenetic regulation, RNA editing, and so on (; ).
All these caseins are encoded by autosomal genes CSN1S1, CSN2, CSN1S2, and CSN3, respectively in closely linked DNA clusters (Pauciullo et al., 2019). The genomic cluster of the casein gene spans between 250 and 350 kb in different mammalian species (Ryskaliyeva, 2018), and in buffalo entire CSN gene covers a region of 250kb. This was hypothesized that the exon duplications events in the ancestral gene result in casein gene evolution (). For instance, donkeys, horses, rabbits, and rodents possess an extra copy of αs2-casein indicating the event of recent paralogous gene duplication (Stewart et al., 1987; ). While no evidence for the paralogous gene duplication in buffalo was practically observed that confirms the previous findings of phylogenetic data, which demonstrated Artiodactyla gene loss, whereas gain of an extra copy of the gene in other species was somewhat attained by differential exon usage (Rijnkels, 2002). Caseins are intrinsically disordered proteins (IDPs) related groups of proteins, manifested in milk as roughly spherical, amorphous, polydisperse particles, classically encompassing protein chains, and calcium phosphate nanoclusters. These particles are termed as casein micelles (). Caseins have flexible open conformation with an abundance of poly-L-proline II secondary structures and cannot be considered as hydrophobic proteins (). Similarly, lower values of GRAVY represent the hydrophilic nature of buffalo CN proteins.
Moreover, short phosphorylated sequences and flexible conformation remarkably increase the casein’s ability to keep calcium phosphate nanoclusters and develop a dense shell of peptide around the calcium phosphate to form a thermodynamically stable core-shell complex, even at quite higher phosphate and calcium concentrations (). In the present study, the aliphatic index showed that all CN proteins have values >65 so perused as thermostable. The casein micelles formation is essential for the effective transportation of phosphate and calcium via milk from the mother to the neonate (). Thus, a readily digestible calcium-enriched diet in the form of casein micelle is available for the neonate. Caseins as IDPs play an important role in mammary gland protection against pathological calcification, amyloid formation, and other dysfunctional processes that can minimize the reproductive success of the mother (). Our findings illustrated all the CN peptides in buffalo were determined as unstable protein and the pI revealed all casein proteins α s1-, β-, and κ-CN were determined as acidic peptides except αs2 which behaved slightly basic nature.
In recent years, the polymorphisms of milk proteins have aroused great research interest because of the genotypes of milk proteins may be related to milk composition and milk yield of dairy mammals (). The amino acid changes possibly have a functional effect on the buffalo caseins (). Comparative amino acid sequence analysis revealed that CN protein harbor higher amino acid variations in river buffalo (Mediterranean and Murrah) as compared to the swamp buffalo. The results of the present study are in line with previous studies (; ; ; Rangel et al., 2017; ; ; ) which reported the potential association of genetic variants in CSN genes with lactation performance, milk composition, and attributes of milk products. Thus, casein gene-based markers are important candidates for the selective breeding of buffalo to improve the quantity and quality of milk (). Moreover, further insights are required to ubiquitously apply these candidate markers to other mammals due to genetic variability and locus distribution (Sulimova et al., 2007; ).
Nevertheless, understanding the molecular basis for the regulation of CSN gene expression is very crucial for improving milk production (). Sequence analysis of promotor region of CSN genes has shown various transcription factor binding sites including transcription initiation sites such as STAT5, NF1 and GR, C/EBP (; Robinson et al., 1998; Rosen et al., 1999; Wheeler et al., 2001; Wyszomierski and Rosen, 2001; Yamashita et al., 2001; ) and potential repressors sites such as YY1, CIS3, SOCS-1, and SOCS-3 (; Tomic et al., 1999). The identification of critical regulatory regions responsible for the expression of the CSN genes provides valuable information for the selection of markers in dairy mammals especially the buffaloes. So, in both Mediterranean and swamp buffalo, we selected four potential transcription sites (GATA, TATA, STAT, and OCT1) and one repressor binding site (YY1), for comparative genomic analysis (Figure 4). OCT1 affects the factors of acute myeloid leukemia (AML), forming a complex that reduces its inhibitory role in DNA binding and promotes the expression of the casein gene ().
Various lactogenic hormones like prolactin, insulin, hydrocortisone, and some growth factors such as insulin-like growth factor 1 (IGF-1) and epidermal growth factor (EGF) are crucial for mammary gland activation and eventually the milk proteins gene expression regulation (; Tsunoda and Takagi, 1999). Therefore, we further analyzed the distribution of HRE including DR, ER, and IR in the genome of the buffalo. All these HRE were detected close to the putative transcription binding sites. Therefore, the combined action of the transcription factor and HRE can mediate the activation of caseins (Figure 6). STAT5 is the principal transcription factor in milk protein gene expression that could be activated by the action of growth hormone (GH) and prolactin (PR) via the STAT/JAK2 signaling pathway or Src-kinase/STAT signaling pathway through the EGF action (). Dimerization and phosphorylation activate the STAT5 and translocate it to the nucleus where STAT5 dimers bind with the DNA and induce transcription (Figure 6; ).
FIGURE 6
Multiple mechanisms are being used by YY1 for transcriptional suppression. Mostly YY1 competes with activator factors and overlaps the binding site ultimately repressing the gene transcription. In mammary epithelial cells, YY1 competes with a β-CN activating promoter also known as mammary gland factor (MGF), fallouts in transcription repression (Figure 7A). Moreover, the c-fos promoter possesses two extra YY1 sites between the TATA box and calcium or cyclic AMP response element (CRE) in addition to YY1 overlapping sites (). The YY1 binding remotely caused direct suppression of the upstream CRE promoter. YY1 can repress the c-fos promoter in a site-dependent or independent manner, including the interaction of zinc finger patterns or binding with cAMP response element-binding (CREB) at the basic leucine zipper region (bZIP) in YY1 (Figure 7B). Most likely, the YY1 and CREB interact in the nucleus and inhibit transcription (). The YY1 can recruit corepressors that directly induce transcriptional repression or facilitate chromatin condensing to assist further YY1 mediated repression. The repression activity of YY1 is generally because of its glycine-rich and zinc-finger regions. Simultaneous deletions in each individual or both regions reduce the GAL4-YY1 fusion proteins deficient for transcriptional repression (Figure 7C). Thus, cofactors interactions are often required with repression domains of YY1 to facilitate repression like mRPD3 (Yang et al., 1996) or Smad family members (). A considerably higher ratio of STATs distribution and lower number of repressor binding site YY1 was observed in Mediterranean buffalo as compared to swamp buffalo. This envisages that lower STATs and higher YY1 site distribution in swamp buffalo might lead to a lower expression of CSN gene subsequently leading to poor milk yield in swamp buffalo.
FIGURE 7
Our study provides inclusive insights into the regulation of the casein gene family revealing a plausible association of STATs and YYI distribution with a poor milk production potential of swamp buffalo. Moreover, we report striking findings regarding genetic variations in transcription activators and repressor elements from evolutionary standpoint. Further investigations are required to confirm these findings to elucidate the putative role of STATs and repressor sites in the regulation of CSN gene expression and their potential utility for the genomic selection of buffaloes for effective utilization and enhanced production.
Conclusion
The present study provides a comprehensive insight into the molecular structure and function of the casein gene family in buffalo. Phylogenetic, gene structure, motif, and conserved domain analysis elucidated the evolutionary conserved nature of the casein gene in buffalo and closely related species. Buffalo casein proteins were observed as unstable, hydrophilic, and thermostable. The α s1-, β-, and κ-CN behaved as acidic peptides except for αs2, which was slightly basic. Comparative genomic analysis revealed higher amino acid variations in the river buffalo (Mediterranean and Murrah breeds) than swamp buffalo, revealing that these variations may influence milk production traits in buffalo. Moreover, for the first time, our findings indicate lower STATs and higher YY1 site distribution in swamp buffalo as a plausible reason for the comparatively lower expression of casein genes that ultimately affect milk production.
Statements
Data availability statement
The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary Material.
Author contributions
FH and QL: conceptualization. SR, TF, and QL: resources. FH, BL, TF, and XL: data curation. SR, TF, and XL: methodology and software. QL and AL: supervision. SR: writing—original draft preparation. FH, XL, SW, TF, AL, BL, and QL: writing—review and editing. All authors have read and agreed to the published version of the manuscript.
Funding
This study was granted and supported by the National Natural Science Fund (U20A2051, 31760648, and 31860638), Guangxi Natural Science Foundation (AB18221120), and Guangxi Distinguished Scholars Program (201835).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fgene.2021.662609/full#supplementary-material
Footnotes
1.^https://www.ncbi.nlm.nih.gov/
4.^http://meme-suite.org/tools/meme
5.^https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi
6.^https://www.bioinformatics.org/sms/multi_align.html
References
1
AhmadS.AnjumF. M.HumaN.SameenA.ZahoorT. (2013). Composition and physicochemical characteristics of buffalo milk with particular emphasis on lipids, proteins, minerals, enzymes and vitamins.J. Anim. Plant Sci.2362–74.
2
AzevedoA. L.NascimentoC. S.SteinbergR. S.CarvalhoM. R.PeixotoM. G.TeodoroR. L.et al (2008). Genetic polymorphism of the kappa-casein gene in Brazilian cattle.Genet. Mol. Res.7623–630. 10.4238/vol7-3gmr428
3
BaileyT. L.WilliamsN.MislehC.LiW. W. (2006). MEME: discovering and analyzing DNA and protein sequence motifs.Nucleic Acids Res.34W369–W373.
4
BasilicataM. G.PepeG.SommellaE.OstacoloC.ManfraM.SostoG.et al (2018). Peptidome profiles and bioactivity elucidation of buffalo-milk dairy products after gastrointestinal digestion.Food Res. Int.1051003–1010.
5
CarverJ. A.HoltC. (2019). “Functional and dysfunctional folding, association and aggregation of caseins,” in Advances in Protein Chemistry and Structural Biology, Vol. 118ed.DonevR. (Amsterdam: Academic Press), 163–216. 10.1016/bs.apcsb.2019.09.002
6
ChughtaiN.SchimchowitschS.LebrunJ. J.AliS. (2002). Prolactin induces SHP-2 association with Stat5, nuclear translocation, and binding to the β-casein gene promoter in mammary cells.J. Biol. Chem.27731107–31114. 10.1074/jbc.m200156200
7
CosenzaG.PauciulloA.AnnunziataA. L.RandoA.ChianeseL.MarlettaD.et al (2010). Identification and characterization of the donkey CSN1S2 I and II cDNAs.Ital. J. Anim. Sci.9:e40.
8
CosenzaG.PauciulloA.FeliginiM.ColettaA.ColimoroL.Di BerardinoD.et al (2009). A point mutation in the splice donor site of intron 7 in the as2-casein encoding gene of the Mediterranean River buffalo results in an allele-specific exon skipping.Anim. Genet.40:791. 10.1111/j.1365-2052.2009.01897.x
9
CosenzaG.PauciulloA.MacciottaN. P. P.ApicellaE.SteriR.La BattagliaA.et al (2015). Mediterranean river buffalo CSN1S1 gene: search for polymorphisms and association studies.Anim. Prod. Sci.55654–660. 10.1071/an13438
10
de OliveiraL. S. M.AlvesJ. S.BastosM. S.da CruzV. A. R.PintoL. F. B.TonhatiH.et al (2021). Water buffaloes (Bubalus bubalis) only have A2A2 genotype for beta-casein.Trop. Anim. Health Prod.53:145.
11
DebeljakM. A.FrajmanP. O.LenasiT. I.NaratM. O.BaldiA. N.DovcP. E. (2005). Functional analysis of the bovine beta-and kappa casein gene promoters using homologous mammary gland derived cell line.Arch. Anim. Breed.48334–345. 10.5194/aab-48-334-2005
12
FanX.GaoS.FuL.QiuL.MiaoY. (2020). Polymorphism and molecular characteristics of the CSN1S2 gene in river and swamp buffalo.Arch. Anim. Breed.63345–354. 10.5194/aab-63-345-2020
13
GallegoM. I.BinartN.RobinsonG. W.OkagakiR.CoschiganoK. T.PerryJ.et al (2001). Prolactin, growth hormone, and epidermal growth factor activate Stat5 in different compartments of mammary tissue and exert different and overlapping developmental effects.Dev. Biol.229163–175. 10.1006/dbio.2000.9961
14
GasteigerE.GattikerA.HooglandC.IvanyiI.AppelR. D.BairochA. (2003). ExPASy: the proteomics server for in-depth protein knowledge and analysis.Nucleic Acids Res.313784–3788. 10.1093/nar/gkg563
15
GiambraI. J.ChianeseL.FerrantiP.ErhardtG. (2010). Short communication:molecular genetic characterization of ovine αS1-casein allele H caused by alternative splicing.J. Dairy Sci.93792–795. 10.3168/jds.2009-2615
16
GingerM. R.PiotteC. P.OtterD. E.GrigorM. R. (1999). Identification, characterisation and cDNA cloning of two caseins from the common brushtail possum (Trichosurus vulpecula).Biochim. Biophys. Acta Gen. Subj.142792–104. 10.1016/s0304-4165(99)00008-2
17
GordonS.AkopyanG.GarbanH.BonavidaB. (2006). Transcription factor YY1: structure, function, and therapeutic implications in cancer biology.Oncogene251125–1142. 10.1038/sj.onc.1209080
18
HelmanD.SandowskiY.CohenY.MatsumotoA.YoshimuraA.MerchavS.et al (1998). Cytokine-inducible SH2 protein (CIS3) and JAK2 binding protein (JAB) abolish prolactin receptor-mediated STAT5 signaling.FEBS Lett.441287–291. 10.1016/s0014-5793(98)01555-5
19
HennighausenL.RobinsonG. W. (1998). Think globally, act locally: the making of a mouse mammary gland.Genes Dev.12449–455. 10.1101/gad.12.4.449
20
HoltC.CarverJ. A.EcroydH.ThornD. C. (2013). Invited review: caseins and the casein micelle: their biological functions, structures, and behavior in foods.J. Dairy Sci.966127–6146. 10.3168/jds.2013-6831
21
HuB.JinJ.GuoA. Y.ZhangH.LuoJ.GaoG. (2015). GSDS 2.0: an upgraded gene features visualization server.Bioinformatics311296–1297. 10.1093/bioinformatics/btu817
22
InmanC. K.LiN.ShoreP. (2005). Oct-1 counteracts autoinhibition of Runx2 DNA binding to form a novel Runx2/Oct-1 complex on the promoter of the mammary gland-specific gene β-casein.Mol. Cell. Biol.253182–3193. 10.1128/mcb.25.8.3182-3193.2005
23
JonesD. T.TaylorW. R.ThorntonJ. M. (1992). The rapid generation of mutation data matrices from protein sequences.Bioinformatics8275–282. 10.1093/bioinformatics/8.3.275
24
JonesW. K.Yu-LeeL. Y.CliftS. M.BrownT. L.RosenJ. M. (1985). The rat casein multigene family. fine structure and evolution of the beta-casein gene.J. Biol. Chem.2607042–7050. 10.1016/s0021-9258(18)88885-8
25
KawasakiK.LafontA. G.SireJ. Y. (2011). The evolution of milk casein genes from tooth genes before the origin of mammals.Mol. Biol. Evol.282053–2061. 10.1093/molbev/msr020
26
KnudsenS. (1999). Promoter2. 0: for the recognition of PolII promoter sequences.Bioinformatics15356–361. 10.1093/bioinformatics/15.5.356
27
KumarS.StecherG.TamuraK. (2016). MEGA7: molecular evolutionary genetics analysis version 7.0 for bigger datasets.Mol. Biol. Evol.331870–1874. 10.1093/molbev/msw054
28
KurisakiK.KurisakiA.ValcourtU.TerentievA. A.PardaliK.Ten DijkeP.et al (2003). Nuclear factor YY1 inhibits transforming growth factor β-and bone morphogenetic protein-induced cell differentiation.Mol. Cell. Biology.234494–4510. 10.1128/mcb.23.13.4494-4510.2003
29
LiZ.LuS.CuiK.ShafiqueL.RehmanS.LuoC.et al (2020). Fatty acid biosynthesis and transcriptional regulation of Stearoyl-CoA Desaturase 1 (SCD1) in buffalo milk.BMC Genet.21:23. 10.1186/s12863-020-0829-6
30
LuX. R.DuanA. Q.LiW. Q.Abdel-ShafyH.RushdiH. E.LiangS. S.et al (2020). Genome-wide analysis reveals genetic diversity, linkage disequilibrium, and selection for milk production traits in Chinese buffalo breeds.J. Dairy Sci.1034545–4556. 10.3168/jds.2019-17364
31
LuoX.ZhouY.ZhangB.ZhangY.WangX.FengT.et al (2020). Understanding divergent domestication traits from the whole-genome sequencing of swamp-and river-buffalo populations.Natl. Sci. Rev.7686–701. 10.1093/nsr/nwaa024
32
MadendeM.OsthoffG. (2019). Comparative genomics of casein genes.J. Dairy Res.86323–330. 10.1017/s0022029919000414
33
MartinA.OrgogozoV. (2013). The loci of repeated evolution: a catalog of genetic hotspots of phenotypic variation.Evolution671235–1250.
34
MasinaP.RandoA.Di GregorioP.CosenzaG.MancusiA. (2007). Water buffalo kappa-casein gene sequence.Ital. J. Anim. Sci.6(Suppl. 2) 353–355.
35
MassellaE.PivaS.GiacomettiF.LiuzzoG.ZambriniA. V.SerrainoA. (2017). Evaluation of bovine beta casein polymorphism in two dairy farms located in northern Italy.Ital. J. Food Saf.6:6904.
36
MiluchovaM.GáborM.CandrákJ.TrakovickáA.CandrákováK. (2018). Association of HindIII-polymorphism in kappa-casein gene with milk, fat and protein yield in holstein cattle.Acta Biochim. Pol.65403–407.
37
MoioliB.GeorgoudisA.NapolitanoF.CatilloG.GiubileiE.LigdaC.et al (2001). Genetic diversity between Italian, Greek and Egyptian buffalo populations.Livest. Prod. Sci.70203–211. 10.1016/s0301-6226(01)00175-0
38
NeuwaldA. F. (2016). Gleaning structural and functional information from correlations in protein multiple sequence alignments.Curr. Opin. Struct. Biol.381–8. 10.1016/j.sbi.2016.04.006
39
NilsenH.OlsenH. G.HayesB.SehestedE.SvendsenM.NomeT.et al (2009). Casein haplotypes and their association with milk production traits in Norwegian Red cattle.Genet. Sel. Evol.41:24. 10.1186/1297-9686-41-24
40
PauciulloA.ErhardtG. (2015). Molecular characterization of the llamas (Lama glama) casein cluster genes transcripts (CSN1S1, CSN2, CSN1S2, CSN3) and regulatory regions.PLoS One10:e0124963. 10.1371/journal.pone.0124963
41
PauciulloA.ShuiepE. T.OgahD. M.CosenzaG.Di StasioL.ErhardtG. (2019). Casein gene cluster in camelids: comparative genome analysis and new findings on haplotype variability and physical mapping.Front. Genet.10:748. 10.3389/fgene.2019.00748
42
RangelA. H.ZarosL. G.LimaT. C.BorbaL. H.NovaesL. P.MotaL. F.et al (2017). Polymorphism in the beta casein gene and analysis of milk characteristicsin Gir and Guzerá dairy cattle.Genet. Mol. Res.16:gmr16029592. 10.4238/gmr16029592
43
RehmanS.NadeemA.JavedM.HassanF.LuoX.KhalidR. B.et al (2020). Genomic identification, evolution and sequence analysis of the heat-shock protein gene family in buffalo.Genes11:1388. 10.3390/genes11111388
44
RehmanS.ShafiqueL.YousufM. R.LiuQ.AhmedJ. Z.RiazH. (2019). Spectrophotometric calibration and comparison of different semen evaluation methods in Nili-Ravi buffalo bulls.Pak. Vet. J.39568–572. 10.29261/pakvetj/2019.073
45
RijnkelsM. (2002). Multispecies comparison of the casein gene loci and evolution of casein gene family.J. Mammary Gland Biol. Neoplasia7327–345.
46
RijnkelsM.ElnitskiL.MillerW.RosenJ. M. (2003). Multispecies comparative analysis of a mammalian-specific genomic domain encoding secretory proteins.Genomics82417–432. 10.1016/s0888-7543(03)00114-9
47
RobinsonG. W.JohnsonP. F.HennighausenL.SterneckE. (1998). The C/EBPβ transcription factor regulates epithelial cell proliferation and differentiation in the mammary gland.Genes Dev.121907–1916. 10.1101/gad.12.12.1907
48
RosenJ. M.WyszomierskiS. L.HadsellD. (1999). Regulation of milk protein gene expression.Annu. Rev. Nutr.19407–436.
49
RyskaliyevaA. (2018). Exploring the Fine Composition of Camelus Milk from Kazakhstan with Emphasis on Protein Components.Doctoral dissertation, Université Paris Saclay, Paris.
50
StewartA. F.BonsingJ.BeattieC. W.ShahF.WillisI. M.MackinlayA. G. (1987). Complete nucleotide sequences of bovine alpha S2-and beta-casein cDNAs: comparisons with related sequences in other species.Mol. Biol. Evol.4231–241.
51
SulimovaG. E.AzariM. A.RostamzadehJ.AbadiM. M.LazebnyO. E. (2007). κ-casein gene (CSN3) allelic polymorphism in Russian cattle breeds and its information value as a genetic marker.Russ. J. Genet.4373–79. 10.1134/s1022795407010115
52
TomicS.ChughtaiN.AliS. (1999). SOCS-1,-2,-3: selective targets and functions downstream of the prolactin receptor.Mol. Cell. Endocrinol.15845–54. 10.1016/s0303-7207(99)00180-x
53
TsunodaT.TakagiT. (1999). Estimating transcription factor bindability on DNA.Bioinformatics15622–630. 10.1093/bioinformatics/15.7.622
54
WangY.TangH.DeBarryJ. D.TanX.LiJ.WangX.et al (2012). MCScanX: a toolkit for detection and evolutionary analysis of gene synteny and collinearity.Nucleic Acids Res.40:e49. 10.1093/nar/gkr1293
55
WeiL.LiuY.DubchakI.ShonJ.ParkJ. (2002). Comparative genomics approaches to study organism similarities and differences.J. Biomed. Inform.35142–150. 10.1016/s1532-0464(02)00506-3
56
WheelerT. T.BroadhurstM. K.SadowskiH. B.FarrV. C.ProsserC. G. (2001). Stat5 phosphorylation status and DNA-binding activity in the bovine and murine mammary glands.Mol. Cell. Endocrinol.17639–48. 10.1016/s0303-7207(01)00481-6
57
WyszomierskiS. L.RosenJ. M. (2001). Cooperative effects of STAT5 (signal transducer and activator of transcription 5) and C/EBP β (CCAAT/enhancer-binding protein-β) onβ-casein gene transcription are mediated by the glucocorticoid receptor.Mol. Endocrinol.15228–240. 10.1210/me.15.2.228
58
YamashitaH.NevalainenM. T.XuJ.LeBaronM. J.WagnerK. U.ErwinR. A.et al (2001). Role of serine phosphorylation of Stat5a in prolactin-stimulated β-casein gene expression.Mol. Cell. Endocrinol.183151–163. 10.1016/s0303-7207(01)00546-9
59
YangW. M.InouyeC.ZengY.BearssD.SetoE. (1996). Transcriptional repression by YY1 is mediated by interaction with a mammalian homolog of the yeast global regulator RPD3.Proc. Natl Acad. Sci. U.S.A.9312845–12850. 10.1073/pnas.93.23.12845
Summary
Keywords
buffalo breeds, caseins, evolution, regulatory regions, milk yield
Citation
Rehman S, Feng T, Wu S, Luo X, Lei A, Luobu B, Hassan F and Liu Q (2021) Comparative Genomics, Evolutionary and Gene Regulatory Regions Analysis of Casein Gene Family in Bubalus bubalis. Front. Genet. 12:662609. doi: 10.3389/fgene.2021.662609
Received
01 February 2021
Accepted
01 March 2021
Published
23 March 2021
Volume
12 - 2021
Edited by
Guohua Hua, Huazhong Agricultural University, China
Reviewed by
Yongwang Miao, Yunnan Agricultural University, China; Gregorio Miguel Ferreira De Camargo, Federal University of Bahia, Brazil
Updates
Copyright
© 2021 Rehman, Feng, Wu, Luo, Lei, Luobu, Hassan and Liu.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Faiz-ul Hassan, f.hassan@uaf.edu.pkQingyou Liu, qyliu-gene@gxu.edu.cn; qyliu-gene@qq.com
†These authors have contributed equally to this work
This article was submitted to Livestock Genomics, a section of the journal Frontiers in Genetics
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.