Abstract
Objective: Recently, abundant number of studies have revealed many functions of circular RNAs in multiple diseases, however, the role of circular RNA in the rupture of human intracranial aneurysm is still unknown. This study aims to explore the potential functions of circular RNA in the rupture of human intracranial aneurysms.
Methods: The differentially expressed circular RNAs between un-ruptured intracranial aneurysms (n = 5) and ruptured intracranial aneurysms (n = 5) were analyzed with the Arraystar human circRNAs microarray. Quantitative real-time PCR (qPCR) was used to verify the results of the circRNA microarray. The role of circular RNA in intracranial aneurysm rupture was assessed in vitro. MTT assay, CCK-8 assay, Caspase3/7 assay, assay of cell apoptosis and Celigo wound healing was conducted to evaluate the relationship between circular RNA and the rupture of human intracranial aneurysms.
Results: A total of 13,175 circRNA genes were detected. Among them 63 circRNAs upregulated and 54 circRNAs downregulated significantly in ruptured intracranial aneurysms compared with un-ruptured intracranial aneurysms (p < 0.05 Fold Change > 1.5). Five upregulated circRNAs were selected for further study (hsa_circ_0001947, hsa_circ_0043001, hsa_circ_0064557, hsa_circ_0058514, hsa_circ_0005505). The results of qPCR showed only hsa_circ_0005505 significantly upregulated (p < 0.05). The expression of hsa_circ_0005505 was higher in ruptured intracranial aneurysm tissues. And our in vitro data showed that hsa_circRNA_005505 promotes the proliferation, migration and suppresses the apoptosis of vascular smooth muscle cell.
Conclusion: This study revealed an important role of hsa_circ_0005505 in the proliferation, migration and apoptosis of vascular smooth muscle cell, and indicated that hsa_circ_0005505 may associate with the pathological process of intracranial aneurysms.
Introduction
Intracranial aneurysm (IA) is a cerebrovascular disorder characterized by a regional ballooning of intracranial arteries. The incidence of intracranial aneurysm in general population is 1.8–8.4% (). Rupture of an intracranial aneurysm can lead to fatal subarachnoid hemorrhage (SAH) which carries a high risk of death or disability. How to assess the possibility of intracranial aneurysm rupture is still inconclusive. In recent 5 years, plenty of researchers studied about the molecular mechanism of the intracranial aneurysm rupture. Many biological processes such as inflammation, the phenotypic changes of vascular smooth muscle cell (VSMC), cell adhesion, atherosclerosis and abnormal extracellular matrix metabolism may participate in the mechanism of intracranial aneurysm rupture (; ). Existing evidence suggests that the process of abnormal inflammatory response in blood vessel wall is initiated by hemodynamic changes, induces the activation of signaling pathways such as NFκB through unknown mechanism. Then, Matrix Metalloproteinases (MMP) such as MMP2 and MMP9 generates the extracellular matrix degradation and phenotypic changes of VSMC which leads to the formation and rupture of aneurysm (; ; ). VSMC distributes in the middle layer of artery wall and is the main cell that synthesizes matrix of artery wall. Following a number of stimuli, the phenotype of VSMC can switch from a contractile type to a pro-inflammatory, dedifferentiated phenotype characterized by the increased expression of OPN (osteopontin), YAP1 (Yes-associated protein 1), inflammatory factors and MMP which may be crucial to aneurysm formation and rupture (Yoshida and Owens, 2005). During the VSMC phenotype change, the proliferation, migration and synthetic ability of VSMC will be promoted and are major events leading to the intracranial aneurysm rupture ().
Circle RNAs (termed circRNAs) are one type of non-coding RNAs (ncRNAs) that are formed covalently closed loop structures and widely expressed in human cells (; ). In recent years, as the widespread use of RNA sequencing technique and biological experiments, many circRNAs have been discovered and proved to be highly expressed in a tissue-specific or cell type-specific manner (; ). And some researchers have revealed the biological function of circRNA. It was reported that circRNAs can function as miRNA sponges that control gene transcription (), besides, circRNAs can interact with different proteins and affect the function of combined protein (). Moreover, circRNAs have the function of encoding functional peptides or proteins (; Yang et al., 2017). Emerging evidence also suggests a potential role of circRNAs in different human diseases (). However, research about the role of circRNAs in the formation and rupture of intracranial aneurysm are rare, and the overall pathophysiological contributions of circRNAs to intracranial aneurysm remain largely unknown.
In this study we acquired differentially expressed circRNAs between ruptured intracranial aneurysm (RIA) tissues and un-ruptured intracranial aneurysm (UIA) tissues through circRNA microarray. We further detected hsa_circ_0005505 and assessed the role of hsa_circ_0005505 in intracranial aneurysm rupture in vitro.
Methods
Patients and Specimens
A total of 10 pairs of ruptured and un-ruptured intracranial aneurysm tissues were obtained from surgical resection during the aneurysm clipping surgery in Beijing Tiantan Hospital. The collection of human specimens was approved by the Medical Ethics Committee of Beijing Tiantan Hospital, Capital Medical University. Written informed consent was obtained from each patient according to the policies of the committee. All specimens were stored in liquid nitrogen, and five pairs of samples were used to conduct circRNA microarray analysis, other samples were used to perform qPCR.
Total RNA Isolation and Quality Control
We extracted RNA with the use of Trizol Reagent (Invitrogrn, NY, United States) from five paired ruptured and un-ruptured intracranial aneurysms according to the manufacturer’s instructions. The quality and concentration of RNA was tested by the NanoDrop ND- 1000 (Thermo Fisher Scientific, Wilmington, United States) (Supplementary Table S1).
RNA Labeling and Hybridization
Sample labeling and array hybridization were performed according to the manufacturer’s protocol (Arraystar, Rockville, United States). Briefly, total RNAs were digested with Rnase R (Lucigen, Middleton, United States) to remove linear RNAs and rich circular RNAs. Then, the enriched circular RNAs were amplified and transcribed into fluorescent cRNA utilizing a random priming method (Arraystar Super RNA Labeling Kit; Arraystar, Rockville, United States). The labeled cRNAs (Supplementary Table S2) were purified by RNeasy Mini Kit (Qiagen, Duesseldorf, Germany). The concentration and specific activity of the labeled cRNAs (pmol Cy3/μg cRNA) were measured by NanoDrop ND-1000 (Thermo Fisher Scientific, Wilmington, United States). 1 μg of each labeled cRNA was fragmented by adding 5 μl 10 × blocking agent and 1 μl of 25 × fragmentation buffer, then heated the mixture at 60°C for 30 min, finally 25 μl 2 × hybridization buffer was added to dilute the labeled cRNA. 50 μl of hybridization solution was dispensed into the gasket slide and assembled to the circRNA expression microarray slide. The slides were incubated for 17 h at 65°C in an Agilent Hybridization Oven (Santa Clara, United States). The hybridized arrays were washed, fixed and scanned using the Agilent Scanner G2505C (Santa Clara, United States).
CircRNA Microarray Analysis
Agilent Feature Extraction software (version 11.0.1.1) was used to analyze acquired array images. Quantile normalization and subsequent data processing were performed using the R software limma package. Differentially expressed circRNAs with statistical significance between two groups were identified through Volcano Plot filtering. Differentially expressed circRNAs between two samples were identified through Fold Change filtering. Hierarchical Clustering was performed to show the distinguishable circRNAs expression pattern among samples.
Real-Time Quantitative PCR
Real-time PCR was used to verify differentially expressed circRNAs obtained from microarray analysis. RNase R (Lucigen, Middleton, United States) was used to purify the circRNAs again. The relevant cDNAs were composed (M-MLV, promega, Madison, United States) and stored in −20°C. QuantStudio5 Real-time PCR System (Applied Biosystems, Waltham, United States) was used to perform qPCR. The sequence of circRNA results was acquired from the database “circBase” (http://circrna.org). Primers were produced by RiboBio (Guangzhou, China) (Supplementary Table S3). Because of the influence of concentration quantitative error and reverse transcription efficiency error, the cDNA content of every sample was different. In order to correct these errors, we regarded housekeeping gene β-actin as internal reference, as a result, we accepted the ratio of genes to be tested and internal reference, in other words, the relative content of the gene to be tested. All qPCR experiments in our research were performed triplicate.
Construction of circRNA-miRNA-mRNA Network
CSCD (http://gb.whu.edu.cn/CSCD/) was used to recognize miRNAs binding on our target circRNA. Three algorithms including Targetscan (), miRDB (), and miRTarBase () were used to analyze parental genes of miRNAs binding on the target circRNA. The circRNA-miRNA-mRNA network was visualized by Cytoscape (version3.7.1).
Gene Ontology and Kyoto Encyclopedia of Genes and Genomes Pathway Analysis
We assumed that our target circRNA may have molecular interactions with these genes, or our target circRNA may regulate biological functions through these genes. GO analysis on genes correlated with these miRNAs was performed by DAVID (https://david.ncifcrf.gov/). The p value after adjustment represents the significance of GO terms. We also perform KEGG pathway analysis of parental genes of circRNA-binding miRNAs, in order to reveal the biological or pathological processes which circRNAs participate in. The p value after adjustment represents the significance of pathway correlations as well.
Cell Culture
Human brain vascular smooth muscle cells (HBVSMCs) were obtained from Bnbio (BNCC102172, Beijing, China). The cells were cultured in Smooth Muscle Cell Medium (SMCM, Sciencell, San Diego, United States) containing 2% fetal bovine serum (FBS, Sciencell, San Diego, United States), 5 ml of smooth muscle cell growth supplement (SMCGS, Sciencell, San Diego, United States), and 5 ml of penicillin/streptomycin solution (P/S, Sciencell, San Diego, United States) at 37°C in an incubator of 5% CO2.
Transduction of Cells
The hsa_circ_0005505 specific shRNA, their relevant lentiviruses [LV-circRNA-RNAi (74402-1), LV-circRNA-RNAi (74403-2), LV-circRNA-RNAi (74404-1)] and negative control lentivirus were obtained from Shanghai Genechem Co., LTD. (Shanghai, China). HBVSMCs were transduced with individual types of lentivirus at a multiplicity of infection (MOI) of 50 and the ideal value of infection efficiency was 80%.
MTT Assay
MTT assay was used to measure the viability of HBVSMCs according to the manufacturer’s instructions (Dingguo Biotech, Shanghai, China). HBVSMCs (2 × 103 per well) were plate in 96-well plates and treated with 20 μl of 5 mg/ml MTT solution, then the spectrophotometrically at 490 nm was analyzed by automatic microplate reader (Tecan infinite, Mannedorf, Switzerland). MTT assay was performed triplicate in our research.
Cell Counting Kit-8 Assay
CCK-8 assay was utilized to test the cell viability in order to verify the effect of the target gene on cell proliferation. The assay was performed according to manufacturer’s instructions (Dojindo Laboratories, Kumamoto, Japan). HBVSMCs (2 × 103 per well) were plate in 96-well plates and treated with 10 μl of CCK-8 solution, then the spectrophotometrically at 450 nm was analyzed by automatic microplate reader (Tecan infinite, Mannedorf, Switzerland). CCK-8 assay was performed triplicate.
Apoptosis Analysis
Cell apoptosis was analyzed in two ways. The caspase3/7 assay was used to verify the effect of the target gene on apoptosis of cells by using the Caspase-Glo 3/7 Assay reagent test kit (Promega, Madison, United States). The apoptosis of cells was analyzed after 3 days since infection. We also analyzed cell apoptosis by using the Annexin V-APC Apoptosis Detection Kit (eBiosciences, San Diego, United States) according to the manufacturer’s instruction. HBVSMCs were stained with APC and then analyzed by fluorescence-activated cell sorting using FACScan (BD Biosciences, NYC, United States) after 5 days since infection. Both apoptosis analyses were performed three times.
Wound-Healing Assay
The wound -healing assay was used to evaluate the migration rate of cells. The transfected HBVSMCs were seeded into 96 well plates (5 × 104 per well). After 24 h incubation, parallel wounds with similar width were made in each well by 96 Wounding Replicator (VP scientific, United States). Wound closure level was monitored by Celigo (Nexcelom, Boston, United States) in 0, 8, and 24 h after wounded and lastly analyze the migration rate. Wound-healing assay was performed triplicate.
Western Blot
Protein was isolated from HBVSMC using a RIPA lysis buffer (Aspen biological, Wuhan, China). The protein content was assessed by using a BCA protein assay kit (Aspen biological, Wuhan, China). Protein lysates (40 μg/sample) were separated on 10% SDS-PAGE and transferred to polyvinylidene difluoride membranes (PVDF, Millipore, Billerica, United States). Then membranes were probed with following primary antibodies: anti-YAP1 (cat. no. ab205270, 1:1000, Abcam, Cambridge, United States), anti-MMP2 (cat. no. ab92536, 1:1000, Abcam, Cambridge, United States), anti-MMP9 (cat. no. ab76003, 1:500, Abcam, Cambridge, United States), anti-OPN (cat. no. ab214050, 1:1000, Abcam, Cambridge, United States) and anti-GAPDH (cat. no. ab37168, 1:10000, Abcam, Cambridge, United States), then incubated overnight at 4°C. After that, horseradish peroxidase-conjugated goat anti-mouse immunoglobulin G (IgG, cat. no. as1106; 1:10000; Aspen biological, Wuhan, China) and horseradish peroxidase-conjugated goat anti-rabbit immunoglobulin G (IgG, cat. no. as1107; 1:10000; Aspen biological, Wuhan, China) were used to detect protein band at room temperature for 30 min. Signals were detected using an enhanced chemiluminescence kit (ECL kit, Aspen biological, Wuhan, China) according to manufacturers’ instruction. The band density was quantified with the AlphaEaseFC software. GAPDH served as the loading control. Each experiment was performed at least three times.
Statistical Analysis
The fold-changes were estimated by unpaired Student’s t-test and used to identify the differentially expressed circRNAs in the sample of intracranial aneurysms. CircRNAs were selected as differentially expressed with a p < 0.05 and a fold-change > 1.5, which means they were statistically significant. The significance of qRT-PCR was assessed by Student’s t-test and p < 0.05 was considered statistically significant, it was analyzed by GraphPad Prism 8.4.0 (GraphPad Software, La Jolla, CA, United States). Other statistical methods such as chi-squared test, Wilcoxon signed-rank test and Mann Whitney U test were also performed. All statistical analyses were performed by SPSS 19.0 (SPSS, Inc., Chicago, United States).
Results
Identification of circRNA Microarray in Human UIA and RIA Samples
We detected a total of 13,174 circRNAs by Arraystar human circRNA Microarray. Among them, 117 circRNAs dysregulated between UIA and RIA tissues (fold-change > 1.5, p < 0.05) (Supplementary Table S4) and 93 of them have been identified by other studies before. Comparing RIA with UIA tissues, 63 circRNAs upregulated while 54 circRNAs downregulated. All circRNAs that we detected contain five types: “exonic,” “intronic,” “antisense,” “sense overlapping” and “intergenic.” In the 63 upregulated circRNAs, 57 (90.4%) circRNAs arising from the exons of the linear transcript, 4 (6.3%) circRNAs arising from the introns of the linear transcript, and 2 (3.3%) circRNAs transcribed from same gene locus as the linear transcript, but not classified into “exonic” and “intronic” which were classified into “sense overlapping” (Figure 1). However, in 54 downregulated circRNAs, 45 (83.3%) circRNAs were arising from exons, 4 (7.4%) circRNAs were classified into “sense overlapping,” 2 (3.7%) circRNAs were “intronic,” 2 (3.7%) circRNAs whose gene locus overlap with the linear RNA but transcribed from the opposite strand which means the “antisense,” and 1 (1.8%) circRNA was “intergenic” which means located outside known gene locus (Figure 2). The variation of circRNA expression between the UIA and RIA samples were assessed (Figure 3). Five upregulated circRNAs were selected for further investigation (hsa_circ_0001947, hsa_circ_0043001, hsa_circ_0064557, hsa_circ_0058514, hsa_circ_0005505). Besides fold-change > 1.5 and p < 0.05, all these five circRNAs’ raw intensities in UIA and RIA groups were more than 200 and their parental genes were well investigated by other studies in order to reveal these circRNA’s functions better.
FIGURE 1
FIGURE 2
FIGURE 3
The circRNA microarray profiling expression results were verified through quantitative reverse transcription PCR (qPCR) in five paired UIA and RIA samples. All these five selected circRNAs were upregulated which in agreement with the microarray results, but only hsa_circ_0005505 and hsa_circ_0043001 upregulated significantly (p < 0.05) (Figure 4). The parental gene of hsa_circ_0005505 is interleukin 1 receptor associated kinase 3 (IRAK3) and ras homolog family member T1 (RHOT1) is the parental gene of hsa_circ_0043001. Compared with RHOT1, IRAK3 has been revealed to be related with MAPK and NF-kappa B signaling pathway (; ), which participate in the pathological process of intracranial aneurysm. As a result, hsa_circ_0005505 was finally selected for further research.
FIGURE 4
Characteristics and Functions of hsa_circ_0005505
The hsa_circ_0005505 (chr12:66597490-66622150) is partly derived from exon 5–11 in human endogenous IRAK3. The genomic sequence of hsa_circ_0005505 is 24660nt and the spliced length is 754nt. To explore the potential functions of hsa_circ_0005505, we found hsa_circ_0005505 contain 14 open reading frames (ORFs) through ORFfinder (https://www.ncbi.nlm.nih.gov/orffinde) (Table 1), but only the longest one has the ability to encode protein. The result of the Conserved Domains (https://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi) showed that, the ORF of hsa_circ_0005505 may encode PKC (Protein Kinases, catalytic domain) _like super family (Bit Score = 260.20, E-value = 4.62e-88). Besides encoding proteins, the other potential function of circRNA is microRNA (miRNA) sponges. Through CSCD, miRNAs binding on hsa_circ_0005505 have been found (Supplementary Table S5). Also, we recognized proteins binding on hsa_circ_0005505 from CSCD, and the result was listed in Table 2. Furthermore, fluorescence in situ hybridization (FISH) against hsa_circ_0005505 showed the predominant cytoplasmic distribution of hsa_circ_0005505 (Figure 5). We also investigated the expression level of hsa_circ_0005505 in HBVSMCs. According to the result of qPCR, hsa_circ_0005505 is significantly upregulated in HBVSMCs (Figure 6).
TABLE 1
| Label | Strand | Frame | Start | Stop | Length (nt|aa) | Nucleotide sequence |
|---|---|---|---|---|---|---|
| ORF1 | + | 1 | 259 | 345 | 87|28 | MSPWIMFLFLNIMKKEYCLNLPSAFKIS |
| ORF2 | + | 1 | 433 | 543 | 111|36 | MLSNYLNRRKKCSVRSIGRGFYLSLKFYYCFITQTY |
| ORF3 | + | 2 | 656 | >754 | 99|32 | MAHSNRYINRNIQSHSLPAQRSTMLGHLWQYIK |
| ORF4 | + | 3 | 24 | >752 | 729|242 | MDVRHIEKYVDQGKSGTRELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLI |
| TNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIPEHNEKGILLKSS | ||||||
| ISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQC | ||||||
| KKHWKRFLSELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDR | ||||||
| LQCVGDTAPLPWHIRIGILIGISKAIHYLHNVQPCSVICGSIS | ||||||
| ORF5 | — | 1 | 700 | 587 | 114|37 | MALDIPINIPIRMCQGSGAVSPTHCNLSKSVPFLMYG |
| ORF6 | — | 1 | 409 | 332 | 78|25 | MYTSKISPSPIRKSLWKFLVPSMIF |
| ORF7 | — | 1 | 328 | 215 | 114|37 | MMEDLSSIPFSLCSGIRTLSTVTLAVSLNNIFGNPPS |
| ORF8 | — | 1 | 115 | 35 | 81|26 | MVLFFCAQDQSNSLVPLLPWSTYFSI |
| ORF9 | — | 2 | 726 | 559 | 168|55 | MVERCAGSEWLWIFLLIYRFECAKGVGPCHLHTAICQKVFHFSCMDKSDRTSQSL |
| ORF10 | — | 2 | 555 | 448 | 108|35 | MQPTLVCLGDETVVKLQAQIKTSSNASYTAFFSPV |
| ORF11 | — | 2 | 432 | 352 | 81|26 | MLGFESPLCIPQKSLLLQLGSLCGNF |
| ORF12 | — | 2 | 75 | >1 | 75|24 | MFHFYLGLHTFQYDEHPASCLKVSL |
| ORF13 | — | 3 | 629 | 540 | 90|29 | MQSVKKCSISHVWINQTELLSLCKICSQL |
| ORF14 | — | 3 | 335 | 240 | 96|31 | MKADGRFKQYSFFIMFRNKNIIHGDIGCFLE |
Open reading frames that detected from hsa_circ_0005505.
ORF: open reading frame.
TABLE 2
| ID | RBP | Start | End | Details |
|---|---|---|---|---|
| 1 | FUS_Human_GSE43308_HITS-CLIP | 66605210 | 66605225 | HHMF2_86273_FUS_rep2_1 |
| 2 | FUS_Human_GSE43308_HITS-CLIP | 66604094 | 66604110 | HHMF2_86272_FUS_rep2_2 |
| 3 | FUS_Human_GSE43308_HITS-CLIP | 66621697 | 66621715 | HHMF2_86276_FUS_rep2_4 |
| 4 | DGCR8_Human_GSE39086_HITS-CLIP | 66608982 | 66609004 | HHCT1_6374_DGCR8_T7.1_1 |
| 5 | FUS_Human_GSE43308_HITS-CLIP | 66619959 | 66619978 | HHMF2_86275_FUS_rep2_1 |
| 6 | FUS_Human_GSE43308_HITS-CLIP | 66603282 | 66603300 | HHMF3_96612_FUS_rep3_3 |
| 7 | FUS_Human_GSE43308_HITS-CLIP | 66611178 | 66611193 | HHMF3_96617_FUS_rep3_1 |
| 8 | FUS_Human_GSE43308_HITS-CLIP | 66604013 | 66604032 | HHMF3_96613_FUS_rep3_3 |
| 9 | FUS_Human_GSE43308_HITS-CLIP | 66609043 | 66609058 | HHMF3_96616_FUS_rep3_1 |
| 10 | FUS_Human_GSE43308_HITS-CLIP | 66606215 | 66606247 | HHMF3_96615_FUS_rep3_3 |
| 11 | FUS_Human_GSE43308_HITS-CLIP | 66604755 | 66604771 | HHMF3_96614_FUS_rep3_3 |
| 12 | DGCR8_Human_GSE39086_HITS-CLIP | 66618821 | 66618842 | HHCD1_11057_DGCR8_D8.1_1 |
Proteins binding on hsa_circ_0005505.
RBP: RNA Binding Proteins.
FIGURE 5
FIGURE 6
Construction of circRNA-miRNA-mRNA Network and GO, KEGG Pathway Analysis
Based on the hsa_circ_0005505 predicted targeting miRNAs, the circRNA-miRNA-mRNA network has been built (Figure 7). Then GO and KEGG pathway analysis of genes in hsa_circ_0005505-miRNA-mRNA network (Supplementary Table S6) have been performed in order to analyze the biological function of these genes. In the ontology analysis of molecular function, hsa_circ_0005505 correlated with genes such as MAP3K2, ACVRL1, CCNT2, RCC2, CTNND1, PTEN, PRKAG1, YWHAZ, CYLD, NR4A3, PDCD10, and mainly enriched in protein binding, DNA binding, RNA polymerase II core promoter proximal region sequence-specific DNA binding, zinc ion binding and sequence-specific DNA binding, respectively (Figure 8). In the biological process of gene oncology, hsa_circ_0005505 mainly correlated with ACVRL1, BTG2, CD86, PPP2CA, NF2, PTPN2 and so on and enriched in positive regulation of transcription, nervous system development, transcription, phosphatidylinositol-mediated signaling and regulation of transcription (Figure 8). In the ontology analysis of cellular component, genes such as CCNT2, CTNND1, DCAF8, MSANTD4, NR3C1, RBPJ, YY1, ELK4, PSMD correlated with hsa_circ_0005505 and mainly enriched in nucleus, nucleoplasm, PcG protein complex, cytoplasm, cytosol, respectively (Figure 8). The result of KEGG revealed that genes correlated with hsa_circ_0005505 enriched in Transcriptional misregulation in cancer, TGF-beta signaling pathway, MAPK signaling pathway, Melanoma and Ras signaling pathway (Figure 8). In brief, results of GO and KEGG pathway analysis suggested that, genes correlated with hsa_circ_0005505 may associated with cell proliferation and apoptosis.
FIGURE 7
FIGURE 8
Knockdown of hsa_circ_0005505 Inhibits HBVSMCs Proliferation, Migration and Induces Apoptosis In Virto
The pictures of infected HBVSMCs were shown in Figure 9. Then qPCR was performed to evaluate the transduction efficiency of three virus (Figure 9). Based on the result of qPCR, HBVSMCs infected by LV-circRNA-RNAi (74402-1) (KD1 in Figure 9) were selected for further experiments. Knockdown of hsa_circ_0005505 markedly inhibits HBVSMCs proliferation after transfected by shRNA according to the MTT assay (Figure 10) which was in consistent with the result of CCK8 assay (Figure 11). The effect of hsa_circ_0005505 on apoptosis of HBVSMCs was also analyzed. The result of apoptosis analysis suggested that knockdown of hsa_circ_0005505 significantly promotes HBVSMCs apoptosis (Figures 12, 13). Besides, the Wound-healing assay demonstrated that hsa_circ_0005505 silencing significantly impeded HBVSMCs migration (Figure 14). To further corroborate the effort of hsa_circ_0005505 on HBVSMC, western blot was performed subsequently. The results showed that, the inhibition of hsa_circ_0005505 reduced the protein level of known HBVSMC phenotype switch marker including OPN (), YAP1 () and also reduced the expression level of MMP2 and MMP9 (Figure 15).
FIGURE 9
FIGURE 10
FIGURE 11
FIGURE 12
FIGURE 13
FIGURE 14
FIGURE 15
Discussion
The development of high-throughput sequencing, gene chip technology and bioinformatics over the last decade have largely improved our knowledge on circRNA. It is becoming increasingly clear that circRNAs play a crucial role in the pathological process of many kinds of cancers, such as colorectal cancer (Zeng et al., 2018), breast cancer (), and hepatocellular carcinoma (Yu et al., 2018). However, whether circRNA participate in the pathological process of intracranial aneurysm is still unknown. In this study, we found hsa_circ_0005505 significantly upregulated in ruptured intracranial aneurysm tissues. Characteristics of hsa_circ_0005505 have been revealed and bioinformatical analysis of hsa_circ_0005505 also have been performed. Knockdown of hsa_circ_0005505 inhibits the proliferation, migration and induces apoptosis of HBVSMCs, which means hsa_circ_0005505 promotes the proliferation, migration of HBVSMCs but suppresses their apoptosis. Besides, the silencing of hsa_circ_0005505 reduce the protein level of OPN, YAP1, MMP2 and MMP9, in other words, hsa_cirx_0005505 promotes the expression of OPN, YAP1, MMP2 and MMP9. According to research about the formation and rupture of intracranial aneurysm, smooth muscle cell and it’s phenotypic modulation plays a significant role in these processes (). With the influence of multiple stimuli, VSMCs were modulated from differentiated VSMC concerned with contraction to cells with a pro-inflammatory, pro-matrix remodeling phenotype characterized by the increased expression of OPN, YAP1, inflammatory factors and MMP, besides, both the proliferation and migration of VSMC can be promoted (; ; ; ). suggested that VSMC phenotype modulation appeared to be more common in ruptured compared with unruptured aneurysms and appeared to be related to a remodeling of aneurysm wall and to a rupture mechanism. Following phenotypic modulation, both phenotypes of VSMC will loss and leading to aneurysm rupture eventually (). These findings revealed that phenotype modulation of VSMC exists in the whole process of intracranial aneurysm formation and rupture. Based on these studies, we make a hypothesis that hsa_circ_0005505 may play a pivotal role in the phenotypic modulation of HBVSMCs.
Research about the role of circRNAs in the formation and rupture of intracranial aneurysm is still scarce. However, several circRNAs have been found to be related with VSMCs. demonstrated that circ_ANRIL inhibits the proliferation and promotes the apoptosis of VSMCs and is associated with coronary artery disease. found circ_Lrp6 is a sponge for miR-145 and circ_Lrp6 hindered miR-145-mediated regulation of VSMC migration, proliferation, and differentiation, furthermore, the ratio of circ_Lrp6 bound to miR-145 versus unbound could play a role in vascular pathogenesis. CircRNAs mainly regulate gene transcription by acting as miRNA sponges, miRNAs binding with hsa_circ_0005505 have been revealed and we also have constructed the hsa_circ_0005505-miRNA-mRNA network. We will further explore the interaction of hsa_circ_0005505 with miRNAs and reveal the precise function of hsa_circ_0005505 in the pathological process of intracranial aneurysm.
Besides function as miRNA sponges to control gene transcription, circRNAs’ ability of encoding peptides or proteins also have been studied (; Yang et al., 2017). We have found that the ORF of hsa_circ_0005505 may encode PKC_like super family through bioinformatic analysis. PKC_like super family contains at least 11 isozymes and can be classified into three groups (). Existing studies demonstrate that PKC promotes the proliferation, migration and dedifferentiation of VSMCs (; ; ; ) and this is in line with our results about the function of hsa_circ_0005505 in virto. During the pathological process of intracranial aneurysm, the VSMC can undergo phenotype modulation. With the stimulation of environment, VSMC can transform from a differentiated phenotype concerned mainly with contraction to an undifferentiated, pro-inflammatory, promatrix -remodeling phenotype (). Furthermore, Zuniga et al. (2017) found that a member of PKC_like super family, PKC-epsilon, is a key mediator in resistin-induced inflammation by promoting the activation of NF-κB. All these findings suggest that PKC may play an important role in the formation and rupture of intracranial aneurysm and we’ll verify this hypothesis in our further study.
Our study also has some limitations. Firstly, the amount of our tissue sample is small. Our results need more intracranial aneurysm samples to testify. Second, due to the rare of aneurysm samples, some of our samples were stored in liquid nitrogen for several weeks, perhaps this would affect the amount of circRNAs. Lastly, the lack of studies about circRNAs in aneurysm make us can’t compare our results with others in order to improve our methods.
The above findings revealed an important role of hsa_circ_0005505 in the proliferation, migration and apoptosis of VSMCs and may take part in the phenotype modulation of VSMCs, indicating that hsa_circ_0005505 may associated with the pathological process of intracranial aneurysms.
Statements
Data availability statement
The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found below: ArrayExpress E-MTAB-10683.
Ethics statement
The studies involving human participants were reviewed and approved by Institutional review board of the Beijing Tiantan hospital. The patients/participants provided their written informed consent to participate in this study.
Author contributions
SW and HW was in charge of supervising the whole study. XC contributed to the conception or design of the work. XC and SY were responsible for drafting and revising. QL, ML, JW, and JY were responsible for analysis and interpretation of data. All authors contributed to manuscript revision, read, and approved the submission.
Funding
This work was supported by the National Key Research and Development Program of China (Grant No. 2016YFC1301800, SW).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmolb.2021.670691/full#supplementary-material
References
1
AokiT.KataokaH.MoriwakiT.NozakiK.HashimotoN. (2007). Role of Timp-1 and Timp-2 in the Progression of Cerebral Aneurysms. Stroke38, 2337–2345. 10.1161/strokeaha.107.481838
2
AokiT.KataokaH.NishimuraM.IshibashiR.MorishitaR.MiyamotoS. (2010). Ets-1 Promotes the Progression of Cerebral Aneurysm by Inducing the Expression of Mcp-1 in Vascular Smooth Muscle Cells. Gene Ther.17, 1117–1123. 10.1038/gt.2010.60
3
CalabroP.SamudioI.WillersonJ. T.YehE. T. H. (2004). Resistin Promotes Smooth Muscle Cell Proliferation through Activation of Extracellular Signal-Regulated Kinase 1/2 and Phosphatidylinositol 3-kinase Pathways. Circulation110, 3335–3340. 10.1161/01.cir.0000147825.97879.e7
4
ChalouhiN.AliM. S.JabbourP. M.TjoumakarisS. I.GonzalezL. F.RosenwasserR. H.et al (2012). Biology of Intracranial Aneurysms: Role of Inflammation. J. Cereb. Blood Flow Metab.32 (9), 1659–1676. 10.1038/jcbfm.2012.84
5
ChenY.LiC.TanC.LiuX. (2016). Circular Rnas: A New Frontier in the Study of Human Diseases. J. Med. Genet.53, 359–365. 10.1136/jmedgenet-2016-103758
6
ChengW.-T.WangN. (2013). Correlation between MMP-2 and NF-κ B Expression of Intracranial Aneurysm. Asian Pac. J. Trop. Med.6, 570–573. 10.1016/s1995-7645(13)60098-x
7
DingQ.ChaiH.MahmoodN.TsaoJ.Mochly-RosenD.ZhouW. (2011). Matrix Metalloproteinases Modulated by Protein Kinase Cε Mediate Resistin-Induced Migration of Human Coronary Artery Smooth Muscle Cells. J. Vasc. Surg.53, 1044–1051. 10.1016/j.jvs.2010.10.117
8
DuW. W.ZhangC.YangW.YongT.AwanF. M.YangB. B. (2017). Identifying and Characterizing Circrna-Protein Interaction. Theranostics7, 4183–4191. 10.7150/thno.21299
9
GeZ. W.WangB. C.HuJ. L.SunJ. J.WangS.ChenX. J.et al (2019). IRAK3 Gene Silencing Prevents Cardiac Rupture and Ventricular Remodeling through Negative Regulation of the NF‐κB Signaling Pathway in a Mouse Model of Acute Myocardial Infarction. J. Cel Physiol234 (7), 11722–11733. 10.1002/jcp.27827
10
HallI. F.ClimentM.QuintavalleM.FarinaF. M.SchornT.ZaniS.et al (2019). Circ_lrp6, a Circular Rna Enriched in Vascular Smooth Muscle Cells, Acts as a Sponge Regulating Mirna-145 Function. Circ. Res.124, 498–510. 10.1161/circresaha.118.314240
11
HansenT. B.JensenT. I.ClausenB. H.BramsenJ. B.FinsenB.DamgaardC. K.et al (2013). Natural Rna Circles Function as Efficient Microrna Sponges. Nature495, 384–388. 10.1038/nature11993
12
HoldtL. M.StahringerA.SassK.PichlerG.KulakN. A.WilfertW.et al (2016). Circular Non-coding Rna Anril Modulates Ribosomal Rna Maturation and Atherosclerosis in Humans. Nat. Commun.7, 12429. 10.1038/ncomms12429
13
HsuS.-D.LinF.-M.WuW.-Y.LiangC.HuangW.-C.ChanW.-L.et al (2011). Mirtarbase: A Database Curates Experimentally Validated Microrna-Target Interactions. Nucleic Acids Res.39, D163–D169. 10.1093/nar/gkq1107
14
IshibashiM.EgashiraK.ZhaoQ.HiasaK.-i.OhtaniK.IharaY.et al (2004). Bone Marrow-Derived Monocyte Chemoattractant Protein-1 Receptor Ccr2 Is Critical in Angiotensin Ii-Induced Acceleration of Atherosclerosis and Aneurysm Formation in Hypercholesterolemic Mice. Atvb24, e174–178. 10.1161/01.atv.0000143384.69170.2d
15
JabbarliR.RauschenbachL.DingerT. F.Darkwah OppongM.RodemerkJ.PierscianekD.et al (2020). In the wall Lies the Truth: a Systematic Review of Diagnostic Markers in Intracranial Aneurysms. Brain Pathol.30, 437–445. 10.1111/bpa.12828
16
JiangH.LunY.WuX.XiaQ.ZhangX.XinS.et al (2014). Association between the Hypomethylation of Osteopontin and Integrin β3 Promoters and Vascular Smooth Muscle Cell Phenotype Switching in Great Saphenous Varicose Veins. Ijms15 (10), 18747–18761. 10.3390/ijms151018747
17
JiangP.WuJ.ChenX.NingB.LiuQ.LiZ.et al (2018). Quantitative Proteomics Analysis of Differentially Expressed Proteins in Ruptured and Unruptured Cerebral Aneurysms by Itraq. J. Proteomics182, 45–52. 10.1016/j.jprot.2018.05.001
18
KangH. G.KimB. J.LeeJ.KimM.-J.KangD.-W.KimJ. S.et al (2015). Risk Factors Associated with the Presence of Unruptured Intracranial Aneurysms. Stroke46, 3093–3098. 10.1161/strokeaha.115.011351
19
KilicT.SohrabifarM.KurtkayaO.YildirimO.ElmaciI.GünelM.et al (2005). Expression of Structural Proteins and Angiogenic Factors in normal Arterial and Unruptured and Ruptured Aneurysm walls. Neurosurgery57, 997–1007. 10.1227/01.neu.0000180812.77621.6c
20
LaiX. L.DengZ. F.ZhuX. G.ChenZ. H. (2019). Apc Gene Suppresses Intracranial Aneurysm Formation and Rupture through Inhibiting the Nf-Κb Signaling Pathway Mediated Inflammatory Response. Biosci. Rep.39. 10.1042/bsr20181909
21
LewisB. P.ShihI.-h.Jones-RhoadesM. W.BartelD. P.BurgeC. B. (2003). Prediction of Mammalian Microrna Targets. Cell115, 787–798. 10.1016/s0092-8674(03)01018-3
22
LiJ.YangJ.ZhouP.LeY.ZhouC.WangS.et al (2015). Circular Rnas in Cancer: Novel Insights into Origins, Properties, Functions and Implications. Am. J. Cancer Res.5, 472–480.
23
LiangD.WiluszJ. E. (2014). Short Intronic Repeat Sequences Facilitate Circular Rna Production. Genes Dev.28, 2233–2247. 10.1101/gad.251926.114
24
LiuQ.WangQ.LiH. (2018). Embelin Inhibits Abdominal Aortic Aneurysm through Decreasing IL-6-induced STAT3 and NF-κB I-nactivation. Mol. Med. Rep.18, 2365–2372. 10.3892/mmr.2018.9221
25
LiuZ.ZhouY.LiangG.LingY.TanW.TanL.et al (2019). Circular Rna Hsa_circ_001783 Regulates Breast Cancer Progression via Sponging Mir-200c-3p. Cell Death Dis10, 55. 10.1038/s41419-018-1287-1
26
NakajimaN.NagahiroS.SanoT.SatomiJ.SatohK. (2000). Phenotypic Modulation of Smooth Muscle Cells in Human Cerebral Aneurysmal Walls[J]. Acta Neuropathologica100 (5), 475–480. 10.1007/s004010000220
27
PamudurtiN. R.BartokO.JensM.Ashwal-FlussR.StottmeisterC.RuheL.et al (2017). Translation of Circrnas. Mol. Cel66, 9–21. e27. 10.1016/j.molcel.2017.02.021
28
RasmussenH.ForderJ.KojimaI.ScriabineA. (1984). Tpa-induced Contraction of Isolated Rabbit Vascular Smooth Muscle. Biochem. Biophysical Res. Commun.122, 776–784. 10.1016/s0006-291x(84)80101-1
29
SalzmanJ.GawadC.WangP. L.LacayoN.BrownP. O. (2012). Circular Rnas Are the Predominant Transcript Isoform from Hundreds of Human Genes in Diverse Cell Types. PLoS One7, e30733. 10.1371/journal.pone.0030733
30
SobeyC. G.FaraciF. M. (1998). Subarachnoid Haemorrhage: What Happens to the Cerebral Arteries?Clin. Exp. Pharmacol. Physiol.25, 867–876. 10.1111/j.1440-1681.1998.tb02337.x
31
StarkeR. M.ChalouhiN.DingD.RaperD. M. S.McKisicM. S.OwensG. K.et al (2014). Vascular Smooth Muscle Cells in Cerebral Aneurysm Pathogenesis. Transl. Stroke Res.5, 338–346. 10.1007/s12975-013-0290-1
32
StarkeS.JostI.RossbachO.SchneiderT.SchreinerS.HungL.-H.et al (2015). Exon Circularization Requires Canonical Splice Signals. Cel Rep.10, 103–111. 10.1016/j.celrep.2014.12.002
33
WongN.WangX. (2015). miRDB: an Online Resource for microRNA Target Prediction and Functional Annotations. Nucleic Acids Res.43, D146–D152. 10.1093/nar/gku1104
34
WuX.OuyangY.WangB.LinJ.BaiY. (2020). Hypermethylation of the IRAK3-Activated MAPK Signaling Pathway to Promote the Development of Glioma. Cmar12, 7043–7059. 10.2147/cmar.s252772
35
XieC.GuoY.ZhuT.ZhangJ.MaP. X.ChenY. E. (2012). Yap1 Protein Regulates Vascular Smooth Muscle Cell Phenotypic Switch by Interaction with Myocardin. J. Biol. Chem.287 (18), 14598–14605. 10.1074/jbc.m111.329268
36
YamamotoM.Acevedo-DuncanM.ChalfantC. E.PatelN. A.WatsonJ. E.CooperD. R. (2000). Acute Glucose-Induced Downregulation of PKC-Βii Accelerates Cultured VSMC Proliferation. Am. J. Physiology-Cell Physiol.279, C587–C595. 10.1152/ajpcell.2000.279.3.c587
37
YangY.FanX.MaoM.SongX.WuP.ZhangY.et al (2017). Extensive Translation of Circular RNAs Driven by N6-Methyladenosine. Cell Res27, 626–641. 10.1038/cr.2017.31
38
YoshidaT.OwensG. K. (2005). Molecular Determinants of Vascular Smooth Muscle Cell Diversity. Circ. Res.96 (3), 280–291. 10.1161/01.res.0000155951.62152.2e
39
YuJ.XuQ.-g.WangZ.-g.YangY.ZhangL.MaJ.-z.et al (2018). Circular Rna Csmarca5 Inhibits Growth and Metastasis in Hepatocellular Carcinoma. J. Hepatol.68, 1214–1227. 10.1016/j.jhep.2018.01.012
40
ZengK.ChenX.XuM.LiuX.HuX.XuT.et al (2018). Circhipk3 Promotes Colorectal Cancer Growth and Metastasis by Sponging Mir-7. Cel Death Dis9, 417. 10.1038/s41419-018-0454-8
41
ZunigaM. C.RaghuramanG.HitchnerE.WeyandC.RobinsonW.ZhouW. (2017). Pkc-epsilon and Tlr4 Synergistically Regulate Resistin-Mediated Inflammation in Human Macrophages. Atherosclerosis259, 51–59. 10.1016/j.atherosclerosis.2017.02.021
Summary
Keywords
circular RNA, intracranial aneurysm, vascular smooth muscle cell, phenotype modulation, protein kinase C
Citation
Chen X, Yang S, Yang J, Liu Q, Li M, Wu J, Wang H and Wang S (2021) The Potential Role of hsa_circ_0005505 in the Rupture of Human Intracranial Aneurysm. Front. Mol. Biosci. 8:670691. doi: 10.3389/fmolb.2021.670691
Received
23 February 2021
Accepted
30 June 2021
Published
14 July 2021
Volume
8 - 2021
Edited by
Mahendra Pratap Kashyap, University of Alabama at Birmingham, United States
Reviewed by
Jacopo Junio Valerio Branca, University of Florence, Italy
Hui Li, Guangxi University, China
Updates
Copyright
© 2021 Chen, Yang, Yang, Liu, Li, Wu, Wang and Wang.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Hao Wang, cmu990103@163.com; Shuo Wang, captain9858@126.com
† These authors have contributed equally to this work
This article was submitted to Molecular Diagnostics and Therapeutics, a section of the journal Frontiers in Molecular Biosciences
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.