ORIGINAL RESEARCH article

Front. Mol. Biosci., 16 March 2023

Sec. Molecular Diagnostics and Therapeutics

Volume 10 - 2023 | https://doi.org/10.3389/fmolb.2023.1111869

Evolution of Indian Influenza A (H1N1) Hemagglutinin Strains: A Comparative Analysis of the Pandemic Californian HA Strain

  • 1. Department of Bioinformatics, Pondicherry University, Puducherry, India

  • 2. Department of Biological Sciences and Bioengineering, Indian Institute of Technology Kanpur, Kanpur, India

Abstract

The need for a vaccine/inhibitor design has become inevitable concerning the emerging epidemic and pandemic viral infections, and the recent outbreak of the influenza A (H1N1) virus is one such example. From 2009 to 2018, India faced severe fatalities due to the outbreak of the influenza A (H1N1) virus. In this study, the potential features of reported Indian H1N1 strains are analyzed in comparison with their evolutionarily closest pandemic strain, A/California/04/2009. The focus is laid on one of its surface proteins, hemagglutinin (HA), which imparts a significant role in attacking the host cell surface and its entry. The extensive analysis performed, in comparison with the A/California/04/2009 strain, revealed significant point mutations in all Indian strains reported from 2009 to 2018. Due to these mutations, all Indian strains disclosed altered features at the sequence and structural levels, which are further presumed to be associated with their functional diversity as well. The mutations observed with the 2018 HA sequence such as S91R, S181T, S200P, I312V, K319T, I419M, and E523D might improve the fitness of the virus in a new host and environment. The higher fitness and decreased sequence similarity of mutated strains may compromise therapeutic efficacy. In particular, the mutations observed commonly, such as serine-to-threonine, alanine-to-threonine, and lysine-to-glutamine at various regions, alter the physico-chemical features of receptor-binding domains, N-glycosylation, and epitope-binding sites when compared with the reference strain. Such mutations render diversity among all Indian strains, and the structural and functional characterization of these strains becomes inevitable. In this study, we observed that mutational drift results in the alteration of the receptor-binding domain, the generation of new variant N-glycosylation along with novel epitope-binding sites, and modifications at the structural level. Eventually, the pressing need to develop potentially distinct next-generation therapeutic inhibitors against the HA strains of the Indian influenza A (H1N1) virus is also highlighted here.

1 Introduction

Influenza is a global viral threat that can lead to severe or fatal diseases. It targets every class of individuals, including pregnant women and immunocompromised people (; Rambaut et al., 2008; Makau et al., 2017). According to the World Health Organization (WHO), there have been approximately 3–5 million cases of influenza each year since 2009, with over 650,000 deaths (; ). Commonly, the epidemic of influenza is highly reported in the winter season of the temperate zone. It not only affects individuals but also causes significant economic losses due to several factors including workplace absenteeism and costs of the treatment (Simonsen, 1999; ). The notable concern is the virulence of the influenza A viruses causing global pandemics. The pandemic outburst of influenza A (H1N1) in 2009 is the latest episode reported in the last decade (; ; Mishra et al., 2010). In 2009, during the pandemic outbreak of the influenza A (H1N1) pdm09 strain, India reported about 27,236 virology laboratory-certified cases of influenza A (H1N1) with 981 fatal reports (https://www.ncdc.gov.in/dashboard.php). The WHO documented that the pandemic virus would continue as the seasonal influenza virus (WHO, 2010). The Ministry of Health and Family Welfare reported in 20 October 2020 that in the post-pandemic period (i.e., since 2010), the influenza A (H1N1) pdm09 strain caused nearly 185,578 laboratory-confirmed cases with more than 12,000 deaths in India. The maximum cases were reported from states like Rajasthan, Gujarat, Delhi, Jammu and Kashmir, Maharashtra, Madhya Pradesh, Telangana, Karnataka, and Tamil Nadu (Dashboard:: National Centre for Disease Control (NCDC). The periodic outbreak of influenza poses critical challenges in the public health.

In particular, the flu viruses, belonging to the Orthomyxoviridae family, are classified as influenza A, B, C, and D types. Influenza A-type viruses are reported to cause infection in multiple hosts, like avian and mammalian species, while the B-type influenza infection is restricted to humans (Paules and Subbarao, 2017; ; Ravina et al., 2020). Influenza C causes a mild infection in humans but is not either epidemic or pandemic in nature. The type D-mediated flu is mainly reported in cattle and pigs but not in humans (Odagiri et al., 2015; Zhai et al., 2017). The genomes of influenza viruses A and B contain eight negative-sense single-stranded RNA (-ssRNA) segments, whereas those of influenza viruses C and D contain only seven -ssRNA segments due to the absence of one of the envelope glycoproteins (Wang and Veit, 2016; Su et al., 2017). The RNA segments of influenza A and B viruses with negative polarity encode about 10 proteins, namely, 1) two surface glycoproteins (hemagglutinin (HA) and neuraminidase (NA)), 2) one nucleoprotein (NP), 3) three polymerase proteins (PA, PB1, and PB2), 4) two matrix proteins (M1 and M2), and 5) two non-structural proteins (NS1 and NS2) (; Murhekar and Mehendale, 2016; Lazniewski et al., 2018; ). The C and D influenza viral RNA segments code for nine proteins due to the lack of envelope glycoproteins (; ). Among these proteins, both HA and NA disclose 18 and 11 subtypes of surface proteins, respectively. These surface proteins play a crucial role in the naming of viral diseases (Webster and Govorkova, 2014; ).

HA is a central factor in the initialization of the infection and responsible for binding of the virus to the host cell receptor (sialic acid) surface. HA promotes the fusion of the virus membrane with the host endosomal membranes to facilitate viral entry into the host cell (Saxena et al., 2018). Another surface glycoprotein NA intercepts the newly synthesized virion concentration by breaking the alpha-ketosidic linkage between sialic acid and the proximate sugar residue in order to stop 1) virion aggregation and 2) the virus binding back to the dying host cell via HA. This allows for the efficient release of viral progeny, which then spreads to new target cells. This results in the disruption of the identification of the HA receptor-binding site and facilitates the spread of viral particles beyond the infected site and promotes severe infection (McAuley et al., 2019). Previous studies suggest the phenotypic variation is guided by a series of mutations that change the antigenic properties of the strain (McDonald et al., 2007; Sriwilaijaroen and Suzuki, 2012). The majority of the antigenic drift in the influenza virus is thought to be guided by the mutations in the HA1 region of the HA protein (Wiley et al., 1981; Nelson and Holmes, 2007).

The evolution of influenza strains is mainly driven by the antigenic drift due to frequent and continuous mutations. With such dynamic antigenic changes, the virus continuously and steadily multiplies and accumulates in the cell/organism (Lin et al., 2009; Neumann et al., 2009; Shi et al., 2010). Variations generated by the mutations mainly affect the affinity or specificity of both antigenic and receptor-binding sites (; Yokoyama et al., 2017), and also mediate conformational changes in the receptor-binding pocket as well (Sriwilaijaroen and Suzuki, 2012). With all these possible mutations, the virus becomes insensitive to the inhibitors, which were designed specifically for the native strains. Viruses with such significant variability pose a severe challenge to society, especially in the diagnosis, medication, and control of viral infection in humans (Sriwilaijaroen and Suzuki, 2012; ; ; ; Sharma et al., 2019). Hence, it is important to study the mutational and phylogenetic evolution of the HA surface protein from different strains of the influenza virus, especially by characterizing the recognition sites such as the receptor-binding site, N-glycosylation site, and the antigenic sites.

The current study implements comparative sequence analyses to characterize and establish the evolutionary relationships of Indian isolates with the pandemic Californian strain (being the closest member to these Indian strains) reported in 2009 as a reference to describe changes reported in the swine (H1N1) virus during 2009–2018. In silico analysis is performed by comparing the HA protein sequences of the Indian influenza A (H1N1) virus to the reference pandemic strain (A/California/04/2009) with special emphasis on the characterization of various recognition sites including receptor-binding sites, antigenic binding sites, and glycosylation sites, by accounting the variants reported since 2009.

Hereafter, the isolates of HA protein sequences of the influenza A (H1N1) virus infecting humans from California and India will be referred to as HACal and HAInd, respectively, throughout the article. For the structural analysis, two representative structures, namely, 1) HACal (reported in 2009, the reference strain) and 2) the HA protein (Acc No: QCP70896) reported in 2018 (HAInd-2018) have been used in this study.

2 Material and methods

2.1 Data collection

The HAInd protein sequences, reported from various geological locations of India during 2009–2018, are deposited in the NCBI (Table 1), and the same were retrieved for the present study (https://www.ncbi.nlm.nih.gov/genomes/FLU/Database/nph-select.cgi?go=database).

TABLE 1

Year2009201020112012201320142015201620172018
AEN79398AJE62461AKM14732AKM14739AJE62527AKE37501ALA50342ASJ82233ATW75053QEU44874
ALX27941AEN79399AKM14733AKM14740AJE62528AKE37493ALA50343ASJ82234ATW75054QEU44876
ALX27940AEM63501AKM14734AKM14741AJE62529AKE37494ALD18975ASJ82238ATW75055QEU44877
AKM14710AKM14717AKM14735AKM14742AJE62530ARG42801AKS48057ASJ82239ATW75056QEU44883
AKM14711AKM14718AKM14736AKM14743AJE62520ARG42802ALK80387ASJ82240ATW75057QEU44880
AKM14712AKM14719AIU46629AKM14744AJE62521ALK80385ASJ82241ATW75058QEU44882
AKM14713AKM14720AKS48053AKM14745AJE62522ALK80389ASJ82242ATW75059QEU44879
AKM14714AKM14721AJE62491AKM14746AKE37409ALK80390ASJ82243ATW75060QEU44878
AKM14715AKM14722AJE62492AKM14747AGY42549ALK80386ASJ82244ATW75061QEU44873
AKM14716AKM14723AJE62493AKM14748AKE37418ALK80388ASJ82245ATW75062QPC70893
------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------------------
AJE62445AJE62474AJE62483AII31198AJE62523------------ASU06458ASR91934QCP70895
ADG57095AEM63474AJE62484AJE62511AJE62524-------------ASU06459ASR91935QCP70896
Total no. of isolates134583393270553227413

NCBI accession numbers of the HAInd strains of the influenza A (H1N1) virus reported during 2009–2018.

2.2 HA sequence retrieval and multiple sequence analysis (MSA)

To understand the mutational and evolutionary drift among the HAInd protein sequences that circulated during the aforementioned period, MSA was carried out using ClustalW (Thompson et al., 1994). The evolutionarily closest sequence has been identified using the pair-wise distance matrix method. The resulting MSA was used to find the evolutionarily conserved regions in the examined sequences.

2.3 Evaluation of the phylogenetic relation

Following MSA, phylogenetic analysis was performed on HAInd proteins reported during 2009–2018. In order to understand the evolutionary relationship of these HAInd proteins of H1N1 strains from India, along with the reported pandemic Californian strain (A/California/04/2009), a phylogenetic tree was constructed using the maximum parsimony method. Parsimony analysis was performed in PAUP (v.4.0) using a heuristic search approach along with the following settings: 1) characters unordered with equal weight, 2) random taxon addition, and 3) branch swapping with the tree bisection–reconnection (TBR) algorithm. Resampling was performed with 1,000 replicates by bootstrapping to check the reliability of the results (; Tamura et al., 2004; Victoria Martínez et al., 2008). The selected HAInd sequences revealed a close relationship with the pandemic HACal protein of the pandemic strain (A/California/04/2009) reported in 2009. Hence, the HAInd sequences, evolved as the closest members to the HACal protein, were clustered as one clade and used for further studies (Table 2).

TABLE 2

List of Indian isolates closest to the Californian strain
YearGene accession numberVariant’s nameAbbreviated variant’s name used in the study
2009GQ280797A/California/04/2009CA-HA-09
2009AEM63482A/Blore/NIV1196/2009IN-HA-09
2010AIU46627A/Khargone/293/2010IN-HA-10
2011AEX63612A/India/GWL01/2011IN-HA-11
2012AJE62498A/Delhi/057/2012IN-HA-12
2013AKE37409A/India/Alp135125/2013IN-HA-13
2014ARG42801A/Kerala/RGCB140815/2014IN-HA-14
2015ALK80385A/India/DRDE_GWL719/2015/IN-HA-15
2016ASJ82246A/India/P167512/2016IN-HA-16
2017ASJ82235A/India/P1722376/2017IN-HA-17
2018QCP70896A/India/Che-1851811/2018IN-HA-18

Identified top 10 HAInd proteins share the closest evolutionary relationship with the reference HAcal strain.

2.4 Mutational analysis

Mutational analysis was carried out using the ClustalW alignment tool of BioEdit (version 7.2.5) () with a bootstrap value of 1,000 to generate a global alignment for the selected HAInd proteins compared with the HACal protein (Table 2) to investigate whether there is any prevalence of phenotypic variation in the reported HAInd protein sequences. The algorithm computed a distance matrix between each pair of sequences based on pairwise sequence alignment scores.

2.5 Ab initio structural modeling of the HA protein

In addition to sequence comparison, the effects of mutations on the structure of HA were also investigated. For the HA structure comparison analysis, the following were selected: 1) one of the Indian HA proteins (Acc No: QCP70896), reported in 2018 (will be referred to as HAInd-2018, hereafter) and 2) the reference HACal protein.

The complete crystallographic structure of the reference HACal protein (with 566 amino acids) is not reported in the PDB website, and the reported HACal structure (PDB ID: 3LZG) has only 506 amino acids. Hence, the complete HACal structure was predicted using the ab initio modeling strategy implemented in Robetta (Raman et al., 2009; Song et al., 2013). The sequences of HACal and HAInd-2018 (GQ280797 and QCP70896, respectively, in FASTA format) were retrieved from the NCBI databank (http://www.ncbi.nlm.nih.gov/) and utilized for homology modeling. The superimposition of both crystal and modeled HAInd-2018 and HACal structures is shown in Supplementary Figure S5.1 and Supplementary Figure S5.2. The modeled HA protein structures were analyzed by WHAT IF and SAVES (http://nihserver.mbi.ucla.edu/SAVES/) servers and were visualized by UCSF Chimera (v.1.15) software (Pettersen et al., 2004). The robustness of the generated models was ensured by the RAMPAGE server (Ramachandran map).

2.6 Receptor-binding site (RBS) analysis

Receptor-binding site analysis was performed on the HAInd protein to examine the mutation-mediated variation that emerged at the binding sites when compared to the HACal protein. Wei Hu et al. reported the highly conserved receptor-binding domains of the HA protein of the influenza A (H1N1) virus (), and their information was used while characterizing both HAInd and HACal strains.

2.7 Epitope-binding site (EBS) analysis

The analysis of the EBS gains importance as it provides the hotspot for membrane fusion between the host and pathogens. Analysis of the conserved EBS is essential to understand its dominance over the recognition of the antibody. Apart from the canonical/native epitope sites, the identification of mutation-derived new epitope sites is also essential to explain the exact viral–host interaction during the membrane fusion mechanism. Epitope sites of both HAInd and HACal proteins of the influenza A (H1N1) virus were analyzed in the SVMTriP web server (http://sysbio.unl.edu/SVMTriP) using default parameters to explain both the conserved EBS and the newly emerging EBS due to mutation. The potential antigenic sites in the HA sequence were examined using a string kernel-based support vector machine (SVM), SVMTriP (Yao et al., 2012). This SVM model calculates the similarity using the BLOSUM62 matrix for the tripeptides or trimers from the input sequences given in FASTA format. Finally, the predicted epitopes, within the default limit of 20 sites, are ranked according to their scores.

2.8 N-glycosylation site analysis

One of the most influential post-translational modifications is N-glycosylation, which affects antigenicity, biological activity, cell–cell interactions, protein solubility, protein folding, localization, and trafficking. Here, the N-glycosylation sites across functional domains of the HA protein are mapped to locate both known and mutation-derived new sites as well. The NetNGlyc 1.0 server (https://services.healthtech.dtu.dk/service.php?NetNGlyc-1.0) was used with default parameters to analyze the N-glycosylation sites that are conserved among the Indian isolates of influenza A (H1N1) viruses. The NetNGlyc 1.0 server predicts all possible sequence patterns, “N-X-S/T” (any amino acids except P at the X position) within HA protein sequences as potential N-glycosylation sites, based on an artificial neural network approach. The most probable N-X-S/T patterns with the highest percentage of occurrence are filled out using the cutoff value of 0.5. The locations of the predicted N-glycosylation sites in the monomer of the HAInd protein are numbered according to the full-length HACal protein sequence.

2.9 Amino acid composition analysis

The ProtParam (https://web.expasy.org/protparam/) tool implemented in the ExPASy server is capable of predicting various physicochemical properties from the sequence, such as molecular weight, pI, amino acid composition, atomic composition, extinction coefficient, estimated half-life, instability index, aliphatic index, and grand average of hydropathicity (GRAVY) from the sequence. Here, variation in the amino acid composition of HAInd proteins reported during 2009–2018 is analyzed in comparison with the HACal protein using ProtParam with default parameters to understand the genetic susceptibility and evolution of Indian isolates compared with the pandemic strain (A/California/04/2009).

2.10 Secondary structure prediction

A high degree of conformational plasticity may present a barrier to the development of beneficial antibodies. The GOR IV web server (https://npsa-prabi.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_gor4.html) was used with default parameters to 1) understand the degree of conformational plasticity by analyzing the secondary structure (alpha helix, extended strand, and random coil) and also 2) further illustrate the variable and invariable structural changes in HAInd proteins reported during 2009–2018 compared with the selected HACal protein.

2.11 Electrostatic potential (ESP) analysis

Electrostatic interactions (EIs) play a vital role in determining biomolecular functions. In particular, the EIs, which govern biomolecular sensing, are highly regulated by the nature of electrostatic potential. Hence, analysis of effective biomolecular sensing requires a thorough characterization of the distribution of ESP over the biomolecular surface boundaries. Here, the electrostatic charge distribution over the surface of both HAInd and HACal proteins is calculated at an ionic strength of 0.15 M and visualized/analyzed using the Adaptive Poisson–Boltzmann Solver (APBS) plugin, integrated in VMD software (version 1.9.3). The ESP, represented as an isoelectrostatic potential map, depicts red and blue contours with values of −5.0 and +5.0 kBT/e, respectively.

3 Results

3.1 HA sequence retrieval of Californian and selected Indian strains

About 512 HAInd protein sequences, reported during 2009–2018 from various geographical locations in India until October 2020, are available in the NCBI repository database under the subsection “Influenza virus.” We collected the available HAInd protein sequences in FASTA format (Supplementary File S1) and performed the BLAST search for the identification of reference strains, followed by MSA. It is interesting to observe that the HACal protein of the A/California/04/2009 strain disclosed a very close relation with the 10 Indian isolates (given in Table 1) reported from 2009 to 2018. Hence, these strains are selected for further comparative analyses to explore the evolution of HAInd proteins. The 3D structures of the HAInd protein are unavailable, whereas the crystal structures of the HACal protein, available in PDB (for example, PDB ID: 3AL4, 3LZG, 3UBE, 3UBJ, 3UBN, 3UBQ, 3UYW, 3UYX, 3ZTN, 4JTV, 4JTX, 4JU0, 4M4Y, 5GJS, 5K9O, 5WKO, 6URM, and 6WJ1), lack a complete structure (Xu et al., 2010; ; Xuan et al., 2011; Xu et al., 2012; ; Zhang et al., 2013; Zhang et al., 2013; Joyce et al., 2016; Wang et al., 2016; Lang et al., 2017; ; Wu et al., 2020). Due to the lack of a complete structure of the HA protein, we modeled the complete structure of both HACal and HAInd-2018 using the full-length sequence (566 aa) and compared it with the reported crystal structure (PDB ID: 3LZG). The superimposition of both crystal and modeled structures reveals similar architecture, as shown in Supplementary File S5. Hereafter, the three-dimensionally modeled structures of the entire sequence of HACal and HAInd-2018 are used for further comparative structural analyses.

3.2 Evolutionary relationship analysis

Knowledge on the extent of genetic reassortment, antigenic shifts, and drifts in HA surface proteins of the H1N1 influenza virus isolates reported in India has become an indispensable concept as it discloses the most important factors related to its virulence. By examining the evolution of sequences, we tried to highlight how the selective pressure on the viral protein changes over time, leading to alterations in antigenicity, which further discloses variation in host specificity toward their receptor. A total of 512 HA protein sequences reported from the Indian strains of H1N1 viruses circulated during 2009–2018 (HAInd) were retrieved from the NCBI flu database (Supplementary File S1). At first, an exhaustive MSA was performed on these selected HAInd and HACal sequences using ClustalW. In ClustalW, the sequences expressing variations due to mutation during the evolution of virus strains are aligned in accordance with the evolutionary distance and are further analyzed for phylogenetic relationships in a year-wise manner. A comparison of all HAInd proteins with reference to HACal revealed the presence of new mutations as well. The MSA and phylogenetic tree (constructed using PAUP) revealed that HAInd proteins (evolved from 2009 to 2018, as given in Table 2) share a close evolutionary relationship with the HACal protein (Supplementary File S2) and were chosen for further investigation.

3.3 Mutational analysis on HACal and HAInd protein sequences

Mutational analysis on the selected 10 HAInd sequences was performed in comparison with HACal disclosed additional phenotypic variations at 84 positions, out of which 16 mutations gain importance as they share more conservation. Table 3 lists all the observed mutations in the selected HAInd proteins. In HAInd, positions 114, 180, 273, 300, 516, 202, 468, 214, 220, 100, 338, and 391 (the grey highlighted positions in Table 3) have a greater probability of mutation than HACal. For a better understanding, the frequency (cumulative occurrence) of a mutation, in comparison with the reference HACal, is calculated and depicted in the frequency plot (Figure 1). The residues disclosing more than 50% of mutational occurrences are in red font. Similar colors in the plot depict similar mutations, but the order of mutation from one residue to another is differentiated with the “*” symbol. For instance, the frequency of mutation of proline to serine is observed 10 times in HAInd proteins, whereas the mutation of serine to proline in HAInd proteins is only observed four times.

TABLE 3

Accession numberStrain namePosition of amino acids mutation in HA surface protein
8111315336191100101103114128138142143146150155160164174179180181190192197198
GQ280797A/California/04/2009LTAAVLSPSDDFSNHNTHSNSSKSVVHH
AEM63482A/Blore/NIV1196/2009LTAAVLSSSDDLGILNPLTIPTKSAGPL
AIU46627A/Khargone/293/2010LTAAVLSSSDDFSNHNTHSNSSKSVVHH
AEX63612A/India/GWL01/2011LTAAVLSSSDDFSNHNTHSNSSKSVVHH
AJE62498A/Delhi/057/2012LTAAGLSSSNDFSNHNTHSNSSKSVVHH
AKE37409A/India/Alp135125/2013MTAAVLSSGDDFSNHNTHGNSSKSVVHH
ARG42801A/Kerala/RGCB140815/2014LTAAVLSSSDNFSNHNTHSNSSQSVVHH
ALK80385A/India/DRDE_GWL719/2015LTAAVLSSSDNFSNHDTHSNSSQSVVHH
ASJ82246A/India/P167512/2016LTTAVISSNDNFSNHNTHSNSNQSVVHH
ASJ82235A/India/P1722376/2017LITTVLSSNDNFSNHNTHSNSNQSVVHH
QCP70896A/India/Che-1851811/2018LTTAVLRSNDNFNNHNTHSNSNQTVVHH
Accession numberStrain namePosition of amino acids mutation in HA surface protein
200202210213214215216217218220223224232233234237239240245246247257261266273274278280
GQ280797A/California/04/2009SSQDTYVFVSYSAIRVDQNYYIAVAMAS
AEM63482A/Blore/NIV1196/2009PSKNAFFLGSSREIKMGKNFSIEGALVP
AIU46627A/Khargone/293/2010SSQDAYVFVTYSAIRVDQNYYVAVAMAS
AEX63612A/India/GWL01/2011SSQDAYVFVTYSAIRVDQINYIAVAMAS
AJE62498A/Delhi/057/2012SSQDAYVFVTYSAIRVDQNYYIAVAMAS
AKE37409A/India/Alp135125/2013STQDTYVFVTYSAIRVDQNYYIAVAMAS
ARG42801A/Kerala/RGCB140815/2014STQDAYVFVTYSAIRVDQNYYIAVTMAS
ALK80385A/India/DRDE_GWL719/2015STQDAYVFVTYSAIRVDQNYYIAVTMAS
ASJ82246A/India/P167512/2016STQDAYVFVTYSATRVDQNYYIAVTMAS
ASJ82235A/India/P1722376/2017STQDAYVFVTYSGTRVDQNYYIAVTMAS
QCP70896A/India/Che-1851811/2018PTQDAYVFVTYSATRVDQNYYIAVTMAS
Accession numberStrain namePosition of amino acids mutation in HA surface protein
282283286289290293294295298300302304312319338391405415421426442456468491508514516523
GQ280797A/California/04/2009IIDVHNTTTKANIKIETNIKLDSTEREE
AEM63482A/Blore/NIV1196/2009FFNFPIPPPKVTIKVETNIKLDSTEREE
AIU46627A/Khargone/293/2010IIDVHNTTTKANIKVKTNIKLDSTEREE
AEX63612A/India/GWL01/2011IIDVHNTTTKANIKVKTNIKRDSTEREE
AJE62498A/Delhi/057/2012IIDVHNTTTKANIKVKTNIKLDNAEREE
AKE37409A/India/Alp135125/2013IIDVHNTTTKANIKVKTNIKLYNTEREE
ARG42801A/Kerala/RGCB140815/2014IIDVHNTTTEANVKVKTNIKLDNTGRKE
ALK80385A/India/DRDE_GWL719/2015IIDVHNTTTEANIKVKQKITLDNTERKE
ASJ82246A/India/P167512/2016IIDVHNTTTEANIKVKTNIKLDNTERKE
ASJ82235A/India/P1722376/2017IIDVHNTTTEANIKVKTNIKLDNTEKKE
QCP70896A/India/Che-1851811/2018IIDVHNTTTEANVTVKTNMKLDNTERKD

Mutations (bold fonts) in the HAInd proteins reported during 2009-2018 are compared with the HACal protein (2009) and are highlighted in grey

FIGURE 1

A year-wise analysis of mutational occurrence reported among the HAInd proteins from 2009 reveals that 1) all selected HAInd proteins possess mutations such as P100S, T214A, and I338V; 2) the mutations S220T and E391K are reported from 2010 onward; 3) the residues D114, K180, A273, K300, and E516 of HACal remain conserved among the selected HAInd sequences reported until 2013 and the same sites disclosed mutations from 2014 onward such as D114N, K180Q, A273T, K300E, and E516K; 4) the mutations A13T, S101N, S179N, and I233T are reported since 2016; and 5) the mutations S202T and S468N are reported since 2013 and 2012, respectively. All these observations witness the occurrence of additional mutations that evolved over the successive period. It should be noted that the mutations of residues from T to A (T → A, S → N, D → N, K → Q, K → E, P → S, S → T, I → V, A → T, and E → K) play a significant role in the emerging diversity of HAInd proteins.

3.4 Receptor-binding site (RBS) in HACal and HAInd protein sequences

Wei Hu et al. reported seven receptor-binding sites (RBS) that are highly conserved in the HACal protein. The variations analyzed at the RBS of HAInd in comparison with the reported RBS of HACal () are given in Table 4. The RBS of the HAInd strain (2009) is reported with 22 single amino acid mutations at the following positions: 1) RBS3 (S160T, N164I, and S173P), 2) RBS4 (H197P, H198L, S200P, and Q210K), 3) RBS5 (V218G, Y223S, S224R, and A232E), 4) RBS6 (V266G, M274L, A278V, S280P, I282F, and I283F), and 5) RBS7 (T294P, T295P, T298P, A302V, and N304T), in comparison with the HACal protein. Few more mutations reported in HAInd strains during 2010–2018 are discussed in the following paragraphs.

TABLE 4

Accession numberStrain’s nameReceptor-binding site (RBS)
RBS1 (22–40)RBS2 (80–98)RBS3 (159–176)
GQ280797A/California/04/2009IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
AEM63482A/Blore/NIV1196/2009IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKTFYKILIWLVKKGNPYP
AIU46627A/Khargone/293/2010 2IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
AEX63612A/India/GWL01/2011 20IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
AJE62498A/Delhi/057/2012IGYHANNSTDTGDTVLEKNGNPECESLSTASSWSYIVEKGFYKNLIWLVKKGNSYP
AKE37409A/India/Alp135125/2013IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
ARG42801A/Kerala/RGCB140815/2014IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
ALK80385A/India/DRDE_GWL719/2015IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
ASJ82246A/India/P167512/2016IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
ASJ82235A/India/P1722376/2017IGYHANNSTDTVDTVLEKNGNPECESLSTASSWSYIVEKSFYKNLIWLVKKGNSYP
QCP70896A/India/Che-1851811/2018IGYHANNSTDTVDTVLEKNGNPECESLSTARSWSYIVEKSFYKNLIWLVKKGNSYP
Accession numberStrain’s nameReceptor-binding site (RBS)
RBS4 (195–212)RBS5 (218–233)RBS6 (263–286)RBS7 (294–304)
GQ280797A/California/04/2009GIHHPSTSADQQSLYQNAVGSSRYSKKFKPEIAIGNLVVPRYAFAMERNAGSGIIISDTTCQTPKGAIN
AEM63482A/Blore/NIV1196/2009GIPLPPTSADQQSLYKNAGGSSRSRKKFKPEIEIGNLGVPRYAFALERNVGPGFFISDPPCQPPKGVIT
AIU46627A/Khargone/293/2010 2GIHHPSTSADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFAMERNAGSGIIISDTTCQTPKGAIN
AEX63612A/India/GWL01/2011 20GIHHPSTSADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFAMERNAGSGIIISDTTCQTPKGAIN
AJE62498A/Delhi/057/2012GIHHPSTSADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFAMERNAGSGIIISDTTCQTPKGAIN
AKE37409A/India/Alp135125/2013GIHHPSTTADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFAMERNAGSGIIISDTTCQTPKGAIN
ARG42801A/Kerala/RGCB140815/2014GIHHPSTTADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFTMERNAGSGIIISDTTCQTPEGAIN
ALK80385A/India/DRDE_GWL719/2015GIHHPSTTADQQSLYQNAVGTSRYSKKFKPEIAIGNLVVPRYAFTMERNAGSGIIISDTTCQTPEGAIN
ASJ82246A/India/P167512/2016GIHHPSTTADQQSLYQNAVGTSRYSKKFKPEIATGNLVVPRYAFTMERNAGSGIIISDTTCQTPEGAIN
ASJ82235A/India/P1722376/2017GIHHPSTTADQQSLYQNAVGTSRYSKKFKPEIGTGNLVVPRYAFTMERNAGSGIIISDTTCQTPEGAIN
QCP70896A/India/Che-1851811/2018GIHHPPTTADQQSLYQNAVGTSRYSKKFKPEIATGNLVVPRYAFTMERNAGSGIIISDTTCQTPEGAIN

Mutations at the RBS of HAInd proteins (reported during 2009–2018) with reference to HACal are indicated in bold fonts.

RBS1, RBS2, and RBS3 reveal mutations such as V33G (in 2012), S91R (in 2018), and S160G (2012), respectively. In RBS4, the mutation S202T that emerged in 2013 was conserved among the strains reported in successive years. RBS4 also witnessed an additional mutation (S200P) in the 2018 strain. In RBS5, all strains have inherited the A220T mutation along with few more such as 1) I233T in 2016, 2) A232G and I233T in 2017, and 3) I233T in 2018. In RBS6 and RBS7, mutations such as A273T and K300E were identified between 2014 and 2018. Specifically, the 2018 strain that emerged with seven mutations at the RBS (Figure 2) may imply that HAInd is more prone to mutation than HACal.

FIGURE 2

In general, except for the 2009 strain, the RBS analysis reveals that the HAInd strains circulated during 2010–2018 were significantly conserved except for the few aforementioned mutations. Despite the observed significant conservation at the sequence level, the emerging single mutation posed a challenge to the inhibitors in sensing the receptor-binding sites and hence prompted the scientific community to design sequence-specific receptor-binding agents for further inhibition.

3.5 Epitope-binding site (EBS) in HACal and HAInd protein sequences

Epitope mapping is critical in the development of vaccines or therapeutic monoclonal antibodies as it offers information on the mechanism of action. In the current study, the epitope-binding domains were analyzed using the SVMTriP web server, and the predicted epitope segments in the HAInd protein sequences are given in Supplementary Table S3 (Supplementary File S3) along with their rank and score. The analysis reveals about 10 antigenic sites when compared to the reference HACal protein. Of these 10 antigenic sites, C-EBS1, C-EBS2, C-EBS8, and C-EBS10 (amino acid positions from 26–45, 66–85, 341–360, and 446–465, respectively) were also conserved in the Indian isolates during 2009–2018. C-EBS3 is not identified in Indian strains. C-EBS9 is reported only in 2009 strains, and in contrast, C-EBS6 is reported for all Indian strains except the 2009 strain. The sites C-EBS4 and C-EBS5 are also conserved but not reported in the 2009, 2015, and 2018 strains. C-EBS7 is observed only with 40% of occurrence.

In addition to the reported 10 C-EBSs, SVMTriP also identified 10 potential EBS (at residue positions 110–129, 146–165, 242–261, 317–336, 366–385, 386–405, 407–426, 408–427, and 515–534, and hereafter will be referred to as I-EBS) exclusively in HAInd proteins (Table 5). These predicted antigenic sites were analyzed using the SVMTriP tool and are listed according to the predicted score, rank, and positions of the EBS (Supplementary File S3). The sequence positions 1) 366–385 (YGYHHQNEQGSGYAADLKST) and 2) 386–405 (QNAIDKITNKVNSVIEKMNT) are identified as conserved I-EBS in 2010–2018, while sequences at 3) 515–534 (EKIDGVKLESTRIYQILAIY) are conserved I-EBS in 2014–2017 Indian isolates (Supplementary File S3). The results suggest that mutational events trigger more antigenic sites. The newly identified antigenic sites such as I-EBS7, I-EBS8, and I-EBS10 (Figure 3) are anticipated to provide more interacting sites in the target, which would eventually fine-tune the process of therapeutic drug/vaccine design.

TABLE 5

Top 10 epitope-binding sites identified in HAInd proteins
No.RankPositionEpitope-binding sites (hereafter referred to as I-EBS)SVMTriP score
11136–155I-EBS3KTSSWPNHDSNKGVTAACPH1
2226–45I-EBS1ANNSTDTVDTVLEKNVTVTH0.997
33366–385I-EBS7YGYHHQNEQGSGYAADLKST0.996
43341–360I-EBS6IQSRGLFGAIAGFIEGGWTG0.996
53276–295I-EBS5RNAGSGIIISDTPVHDCNTT0.996
6466–85I-EBS2PLHLGKCNIAGWILGNPECE0.995
75386–405I-EBS8QNAIDKITNKVNSVIEKMNT0.98
86446–465I-EBS9LENERTLDYHDSNVKNLYEK0.858–0.994
97160–179I-EBS4(G)SFYKNLIWLVKKGNSYPKLS(N)0.869
108515–534I-EBS10EKIDGVKLESTRIYQILAIY0.292–0.426

Top 10 antigenic sites identified in HAInd proteins using the SVMTriP server.

FIGURE 3

3.6 Prediction of N-glycosylation sites in HACal and HAInd protein sequences

The attachment and release of viruses from their host cells exploit the phenomenon of glycosylation. For example, the N-glycosylation of the HA surface protein allows the pathogen to escape from the host’s defense mechanism through co-evolving with the host protein and eventually identifying the host receptor for further fusion. Hence, N-glycosylation sites are crucial in determining the H1N1 host binding and release factors, which subsequently determine the fate of virus infection in the host as well. In line with this importance, N-glycosylation sites were predicted in HAInd strains reported during 2009–2018 using NetNGlyc 1.0 v and are shown in Figure 4. The HACal protein possesses about eight N-glycosylation sites, namely, 27NNST30, 28NSTD31, 40NVTV43, 104NGTC107, 293NNTC296, 304NTSL307, 498NGTY501, and 557NGSL560 (here, each N-glycosylation site is referred to with the starting and ending positions of amino acids).

FIGURE 4

As disclosed by HACal, the selected HAInd strains also disclose all these N-glycosylation sites except the Indian A/Blore/NIV1196/2009 strain (Table 6), which lacks 293NNTC296 and 304NTSL307 N-glycosylation sites. Along with these reported nine N-glycosylation sites, the HAInd strains reported during 2016–2018 reported an additional N-glycosylation site, 179NQSY182. A clear observation demonstrated that the amino acid 179SKSY182 of the HACal protein was conserved in the HAInd strains reported from 2009 to 2013, and by the mutation K180Q (reported in 2014–2015), the amino acid segment 179SQSY182 evolved as a precursor to the identified 179NQSY182 N-glycosylation site (in which S is mutated into one of the active site forming residues, N) in the HAInd sequences reported in the subsequent years (2016–2018).

TABLE 6

Accession numberStrain’s nameAmino acid positions
27–3028–3140–43104–107179–182293–296304–307498–501557–560
GQ280797A/California/04/2009NNSTNSTDNVTVNGTCSKSYNTTCNTSLNGTYNGSL
AEM63482A/Blore/NIV1196/2009NNSTNSTDNVTVNGTCTKSYIPPCTTSLNGTYNGSL
AIU46627A/Khargone/293/2010 2NNSTNSTDNVTVNGTCSKSYNTTCNTSLNGTYNGSL
AEX63612A/India/GWL01/2011 20NNSTNSTDNVTVNGTCSKSYNTTCNTSLNGTYNGSL
AJE62498A/Delhi/057/2012NNSTNSTDNVTVNGTCSKSYNTTCNTSLNGTYNGSL
AKE37409A/India/Alp135125/2013NNSTNSTDNVTVNGTCSKSYNTTCNTSLNGTYNGSL
ARG42801A/Kerala/RGCB140815/2014NNSTNSTDNVTVNGTCSQSYNTTCNTSLNGTYNGSL
ALK80385A/India/DRDE_GWL719/2015NNSTNSTDNVTVNGTCSQSYNTTCNTSLNGTYNGSL
ASJ82246A/India/P167512/2016NNSTNSTDNVTVNGTCNQSYNTTCNTSLNGTYNGSL
ASJ82235A/India/P1722376/2017NNSTNSTDNVTVNGTCNQSYNTTCNTSLNGTYNGSL
QCP70896A/India/Che-1851811/2018NNSTNSTDNVTVNGTCNQTYNTTCNTSLNGTYNGSL

Predicted N-glycosylation sites of HAInd compared with the reference HACal proteins. The newly emerged N-glycosylation sites (amino acids in 179–182 positions), specific to HAInd strains, are shown in bold.

It is also vital to ensure the structurally stable evolution of Indian strains by retaining the characteristic hydrophobic/hydrophilic interactions despite the encountered mutations. Therefore, a detailed study about the 3D structure of viral proteins along with physico-chemical characterization would be useful to understand the changes in viral activity attributed to the changes at the sequence level.

3.7 Amino acid composition of HACal and HAInd protein sequences

The amino acid compositional variation of HAInd proteins reported during 2009–2018 was compared with that of HACal using the ProtParam server (Figure 5) to understand the impact of the mutational effect on the number of compositional amino acids toward the conformational stability of HA proteins (Supplementary File S4). A comparison of the statistical occurrence of each amino acid in HAInd with HACal revealed a few interesting observations. For example, about 32 serine amino acids of the HACal strain mutated into threonine and asparagine in HAInd with a statistical occurrence of 18 and 14, respectively. This shows that the propensity of serine getting mutated into threonine and asparagine is more prevalent in Indian strains. The observation of S mutating into T (a crucial amino acid in forming the active site of an enzyme) and N (one of the critical factors reported to regulate viral replication) (Lee et al., 2019) has biological significance. In particular, the observation of the new N-glycosylation site 179NQTY182 (which also forms a part of EBS4 observed at 160 (G) SFYKNLIWLVKKGNSYPKLS (N) 179 (Supplementary File S3), reported in the Indian strains from 2016 to 2018, is one such example. It is also vital to disclose the intermediate stages of mutation (S to N) from 179SKSY182 to 179SQSY182 and, finally, to 179NQSY182 over the studied period (Table 6). Another example of S mutated as T, resulting in RBS4 (195GIHHPSTSADQQSLYQNA212 to 195GIHHPSTTADQQSLYQNA212) and RBS5 (218VGSSRYSKKFKPEIAI233 to 218VGTSRYSKKFKPEIAI233), is shown in Table 4.

FIGURE 5

3.8 Predicted secondary structure of HACal and HAInd proteins

Secondary structures of HACal and HAInd sequences, pertaining to their structural stability, are analyzed using the GOR IV web server. Figure 6 depicts the compactness of the 3D structure of HA stains in terms of the fraction of residues forming the structural elements, particularly helix, sheet, and random coil. Analysis of the composition of the secondary structure in all HAInd sequences revealed the prevalence of a high proportion (50%) of random coils when compared to the helix and extended sheets (which equally share 25% each). It should be noted here that the equal contribution of both helix and extended sheets is retained in the HAInd strains until 2015. In the HAInd strains reported from 2016 to 2018, the overall helical components are reduced by 2%, and accordingly, the occurrence of both extended sheets and random coils is increased. Such an observation is witnessed by the transformation of a few helices into extended sheets and random coils (for example, the amino acid segments 9–12, 230–234, and 236–241).

FIGURE 6

Overall, the present analysis indicates the high occurrence of random coils in all selected HAInd strains as one of the potentially unique characteristics of HA strains, which lowers the structural compactness (along with additional contributions from the helices to extended sheets and random coils). Such increased random coil segments enhance the structure flexibility, thereby promoting an effective interaction with other essential components of the host.

3.9 Electrostatic potential (ESP) of HACal and HAInd proteins

The host cell defense mechanism is highly sensitive to the physicochemical nature of the interacting viral particle, and the emerging mutations perturb their sensing mechanism. At the molecular level, explicitly, the EIs take a lead role in establishing strong complex formation. The electrostatic potential surfaces (ESPSs) of the HA proteins from both Indian (2018) and California strains are compared and contracted to better understand the potential of the Indian strain (Figure 7). Both electropositive and negative potential sites are shown in blue and red surfaces, respectively, along with the near-neutral residues as white surfaces. The mutated residues are labeled and indicated using yellow arrows. The ESP map, depicting the distribution of both positive and negative ESPSs of HA proteins, was generated using the Adaptive Poisson–Boltzmann Solver (APBS) to compare and contrast the electrostatic features of HAInd-2018 and HACal proteins. Along with the ESPS, the effect of mutations on the solvent accessibility of both HAInd-2018 and HACal proteins was also analyzed (Figure 7).

FIGURE 7

Table 7 lists all mutated RBD residues in both HAInd and HACal proteins. From the examination of the ESPS of both strains, it could be speculated that the HAInd protein could get attached to the receptor more efficiently due to the emergence of potential electrostatic interactions. Some of the mutations observed at the RBD of the HAInd protein are predicted to affect the antibody neutralization mechanism either by introducing conformational changes locally in the HA protein due to S91R, S200P, S202T, S220T, I233T, A273T, and K300E mutations (; ; ) or by altering its surface charge distribution due to D114N, K180Q, K300E, K319T, and E391K mutations. Such significant redistribution of the ESPS promotes increased resistivity against known therapeutics when compared to the HACal strain.

TABLE 7

Amino acid positionResiduesDomain/motif
HACalHAInd-2018
13AlaThrHA1/β-strand
91Ser (*)Arg (+)HA1/β-hairpin
100ProSerHA1/β-turn
101SerAsnHA1/β-turn
114Asp (−)Asn (*)HA1/β-turn
138SerAsnHA1/β-turn
179SerAsnHA1/β-strand
180Lys (+)Gln (*)HA1/β-strand
181SerThrHA1/β-strand
200SerProHA1/β-strand
202SerThrHA1/α-helix
214ThrAlaHA1/β-turn
220SerThrHA1/β-strand
233IluThrHA1/α-helix
273AlaThrHA1/β-strand
300Lys (+)Glu (−)HA1/β-turn
312IluValHA1/β-strand
319Lys (+)Thr (*)HA1/β-strand
338IluValHA1/β-turn
391Glu (−)Lys (+)HA2/α-helix
421IluMetHA2/α-helix
468SerAsnHA2/α-helix
516Glu (−)Lys (+)HA2/β-turn
523Glu (−)Asp (−)HA2/β-strand

List of mutated residues and their locations in both HACal and HAInd protein structures. The RBD residues are in bold, and the mutated residues (from charged to uncharged and vice versa) are indicated by *.

4 Discussions

The HA protein of the influenza A (H1N1) virus is known to play a significant role in the entry of viruses into the host and their pathogenicity as well. An “effective HA target-based vaccine/drug” has become a pressing need for society. The complexity in designing HA inhibitors arose due to several factors, including the higher rate of missense/point mutations. The H1N1 strain, A/California/04/2009, is the closest neighbor of all strains reported in India during the 2009 pandemic. A methodical analysis of the HA proteins of Indian strains from 2009 to 2018 was performed and compared with that of the A/California/04/2009 strain. The HAInd strains, reported with more specific mutations at a higher rate, emerged with enhanced virulence (Tharakaraman and Sasisekharan, 2015) and also became resistant to antiviral drugs such as oseltamivir, zanamivir, and peramivir (Parida et al., 2016; Tandel et al., 2018). These viruses with frequent reassortment at the sequence level evolved as more virulent than the previous seasonal H1N1 viruses (; Su et al., 2015; Luo et al., 2018a) and acquired better abilities to infect humans, which caused worse outbreaks (Luo et al., 2018b).

4.1 Evolutionary relation between HA proteins

Here, we present a systematic analysis of the HA proteins of H1N1 to understand the adaptation and divergence among Indian strains due to frequent mutational events. Particularly, the analyses focused on the impact of missense mutations on receptor-binding domains, antigenic site alteration, N-glycosylation site prediction, amino acid compositional variability, and associated variability in secondary structure. In line with this, the present analysis also exclusively emphasizes on Indian strains and compares them with a recognized reference pandemic strain to understand the challenges behind the failure of successful medication in the Indian context. Accordingly, about 512 Indian strains were retrieved along with the A/California/04/2009 strain from the flu database of the NCBI reported during 2009–2018 and were analyzed by MSA to explore the evolutionarily conserved genetic regions. Site-specific variations observed in the aligned sequences, reflecting the rate of mutations or degree of evolution, were further analyzed to figure out the evolutionarily conserved regions with reference to the strain A/California/04/2009. A one-to-one relation between the aligned sequences was visualized using PAUP-generated phylogenetic tree, which displayed the closest evolutionary relationship between Indian and Californian strains of the influenza A (H1N1) virus (Supplementary File S2). Variations in sequences due to missense mutations at various positions play a vital role in altering the structure and function of different domains of the HA protein, such as the receptor-binding domain, epitope-binding domain, and N-glycosylation site.

Alignment of the amino acid sequences of HAInd reported during 2009–2018 showed about 84 amino acid substitutions when compared to the reference HACal protein. About 24 substitutions were observed in HAInd-2018, in which 16 were highly concerned (Table 3). Analyses reveal that among the 16 mutations, seven mutations were found in the receptor-binding sites (Table 4), four were in antigenic sites (Table 5), and three were involved in the formation of N-glycosylation sites (Table 6). The HAInd strains are characterized by the mutations P100S, T214A, S220T, I338V, and E391K, i.e., possible beneficiary mutations that got fixed in the strains reported during 2009–2018 (Table 3). The literature suggests that T214A substitution in HA genes decreases the binding affinity with the host receptor (). We observed six new amino acid mutations (S91R, S138N, S200P, K319T, I421M, and E523D) in HAInd-2018. The mutations S91R and S200P were found to be unique in HAInd-2018, and these substitutions were abundant in the complete HA population (in 2018) compared to the pandemic HACal. The substitutions A13T, S101N, D114N, I312V, S468N, and E516K were also observed in HAInd and are also reflected in the recent studies (; Prasad et al., 2020; Siddiqui et al., 2020). In accordance with our results, another research group carried out a mutational examination of H1N1 with random samples and observed that viruses circulated during 2017 have 18 detected substitutions in HAInd (). They also reported I233T, S179N, S181T, and I312V as new substitutions, among which S181T and I312V were presented as unique mutations in HAInd isolates (). Interestingly, we did not find I312V in 2017. The observed amino acid substitutions (S91, S200, S202, A214, and I233) have been found in receptor-binding sites envisaged to vary during the adaptation process to α2-6-linked sialic acid receptors in humans (Maines et al., 2009). The I223T amino acid substitution is linked with increased binding affinity to human α2-6-linked sialic acid receptors (). Substitutions S200P and S202T are responsible for enhanced receptor-binding avidity by altering the receptor-binding affinity, whereas the A214T substitution is linked to the decreased binding avidity (). A previous study suggested that S202T is one of the responsible substitutions involved in increased mortality and morbidity (). Studies also support our observations that mutations of HA like P100S, T214A, S220T, I338V, and E391K are conserved mutations specific to the dominant variant(s) of influenza A (H1N1) viruses during post-pandemic circulation in India (Morlighem et al., 2011; ; Siddiqui et al., 2020). It is also evident from research that the substitutions S181T and I312V in HA could lead to altered glycan specificity (). The substitution K180Q triggers conformational variation in ligand binding, which might trigger the failure of specific ligand-binding properties as well (). The mutation S179N, associated with glycosylation, is responsible for the increased pathogenicity of the viral particle by preventing the antigenic sites of immune recognition ().

4.2 Sequence and functional analysis of EBS, RBS, and N-glycosylation sites

Out of 84 mutational sites, about 12 most probable conserved mutational sites at amino acid positions 100, 114, 180, 202, 214, 220, 273, 300, 338, 391, 468, and 516 have been observed in the last five consecutive years (Table 3). The HACal protein possesses seven characteristic receptor-binding sites () and has been compared against all HAInd strains. Indian strains expressed mutations mainly like serine-to-threonine, alanine-to-threonine, and lysine-to-glutamine at various binding sites (RBS 4–7) over a period of time, i.e., mutations S220T (at RBS 5), S202T (at RBS 4), A273T (at RBS 6), and K300E (at RBS7) were reported since 2010, 2013, 2014, and 2018, respectively (Table 4). The results suggest that these mutations may trigger the alteration in the RBD and become resistant to available therapeutic options. In comparison, all HAInd proteins emerge with more point mutations than the selected HACal, which play a significant role to evade from the known immune defense mechanism and further become life-threatening as well. Epitope mapping gains prime importance in the design of therapeutic monoclonal antibodies or vaccines, and any sequence-level mutations at the antigenic epitope sites hinder or delay the design of effective novel vaccines. In line with this, the studied Indian strains, which revealed significant mutations in the epitope-binding domains of HA proteins (Supplementary File S4), also delayed the successful identification of a vaccine for all Indian strains. Hence, faster evolution of the epitope-binding domain renders more complexity in the eradication process of the influenza A (H1N1) virus. Similar to epitope-binding sites, variations at N-glycosylation sites also increase complexity in the design of inhibitors (Zhang et al., 2004; Wei et al., 2010). Mutations in the glycosylation sites aid the HA protein (Table 6) to co-evolve with the host protein for the successful initiation of further infections.

The glycosylation of the influenza strain can disturb its host specificity, virulence, and contagious nature either directly by changing the biological activity of surface proteins (Schulze, 1997), or indirectly by 1) attenuating receptor-binding sites (), 2) masking antigenic sections of the protein (), 3) obstructing the HA protein precursor via its cleavage into the disulfide-linked subunits HA1 and HA2 (Ohuchi et al., 1989), and 4) regulating the catalytic activity or preventing proteolytic cleavage of the stalk of NA (Matsuoka et al., 2009). A report revealing the destabilization of the coiled coil of the HA protein due to the buried hydrophilic residue, Thr59, also endorses the sequential and structural level of distortions raised by the mutations threonine-to-serine observed in this study (Lin et al., 2018). Hence, the examined mutation-mediated structural diversification of the HA protein gains importance.

The ESPS characterized for the Indian isolate reported in 2018 revealed significant changes in the electrostatic surface, which is also presumed to render strong binding of HA proteins with the host receptors. The specific mutations observed in HAInd-2018 (for example, S91R, S181T, S200P, I312V, K319T, I421M, and E523D) may increase the fitness of the virus in a new environment and host, which may render a reduced efficacy toward the available treatment. The mutation-mediated adaptability and efficacy of HAInd proteins of the influenza A (H1N1) virus need to be studied critically.

5 Conclusion

In essence, our data emphasize the evolutionary relationship of H1N1 strains circulated in India during the post-pandemic period, 2009–2018, with the A/H1N1pdm09 pandemic reference strain. The present study clearly depicts the presence of frequent mutations in HAInd proteins of the influenza A virus, which drifted significantly from the reference HACal strain A/California/04/2009. In addition, the mutational, structural, and functional characterization of the circulated influenza A strains indicates that the regionally reported mutations in all HAInd proteins may be associated with their adaptability in sustaining locally for efficient human transmissibility. In India, during the last few decades, a recurrent episode of influenza A virus infection has been reported among humans, which proposes several factors, including 1) the reflection of better detection technologies and, finally, 2) the need for constant surveillance to monitor any changes in the genomic content of the influenza A viruses that could initiate a potential transmission and pronounced virulence among humans. The findings presented here offer a better insight into the development of distinct next-generation therapeutic inhibitors by accounting all observed mutations in the reported isolates.

In this study, the observed mutational drift results in the 1) alteration of receptor-binding domains, 2) generation of new-variant N-glycosylation and epitope-binding sites, and 3) even modifications at the structural level. Molecular investigations, however, are warranted to confirm the binding and antigenic potential of such residue changes at this point and their associated impact on morbidity and mortality as well. Hence, continued surveillance at a national level is required for the early detection of such genetic changes in viruses and the associated secondary emergence of antiviral resistance. Overall, the present work highlights additional information required for the design of more specific inhibitors with increased selectivity against Indian influenza A (H1N1) viruses.

Statements

Data availability statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary Material.

Author contributions

AR and SP contributed to the conception and design of the study. SP performed and analyzed the in silico studies under the supervision of AR. MR and MS supported the additional analysis part. All authors approved the final version of the manuscript.

Acknowledgments

The authors acknowledge the Department of Bioinformatics, Pondicherry University, Puducherry, India, for providing the facilities. The author SP acknowledges the ICMR for the SRF fellowship (No: BMI/11(116)/2022).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors, and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmolb.2023.1111869/full#supplementary-material

References

  • 1

    AbeY.TakashitaE.SugawaraK.MatsuzakiY.MurakiY.HongoS. (2004). Effect of the addition of oligosaccharides on the biological activities and antigenicity of influenza A/H3N2 virus hemagglutinin. J. Virol.78, 96059611. 10.1128/JVI.78.18.9605-9611.2004

  • 2

    AbrusánG.MarshJ. A. (2016). Alpha helices are more robust to mutations than beta strands. PLoS Comput. Biol.12, e1005242. 10.1371/journal.pcbi.1005242

  • 3

    AdamD. C.ScotchM.MacIntyreC. R. (2019). Phylodynamics of influenza A/H1N1pdm09 in India reveals circulation patterns and increased selection for clade 6B residues and other high mortality mutants. Viruses11, 791. 10.3390/v11090791

  • 4

    Al KhatibH. A.Al ThaniA. A.GallouziI.YassineH. M. (2019). Epidemiological and genetic characterization of pH1N1 and H3N2 influenza viruses circulated in MENA region during 2009–2017. BMC Infect. Dis.19, 314322. 10.1186/s12879-019-3930-6

  • 5

    AlonsoW. J.YuC.ViboudC.RichardS. A.Schuck-PaimC.SimonsenL.et al (2015). A global map of hemispheric influenza vaccine recommendations based on local patterns of viral circulation. Sci. Rep.5, 1721417216. 10.1038/srep17214

  • 6

    AminM.SorourM. K.KasryA. (2020). Comparing the binding interactions in the receptor binding domains of SARS-CoV-2 and SARS-CoV. J. Phys. Chem. Lett.11, 48974900. 10.1021/acs.jpclett.0c01064

  • 7

    AshaK.KumarB. (2019). Emerging influenza D virus threat: What we know so far. J. Clin. Med.8, 192. 10.3390/jcm8020192

  • 8

    BaillieJ. K.DigardP. (2013). Influenza—Time to target the host?N. Engl. J. Med.369, 191193. 10.1056/NEJMcibr1304414

  • 9

    BiswasD.DuttaM.SarmahK.YadavK.BuragohainM.SarmaK.et al (2019). Genetic characterisation of influenza A (H1N1) pdm09 viruses circulating in Assam, Northeast India during 2009–2015. Indian J. Med. Microbiol.37, 4249. 10.4103/ijmm.IJMM_18_416

  • 10

    CheungC. S.-F.FruehwirthA.PaparoditisP. C. G.ShenC.-H.FoglieriniM.JoyceM. G.et al (2020). Identification and structure of a multidonor class of head-directed influenza-neutralizing antibodies reveal the mechanism for its recurrent elicitation. Cell Rep.32, 108088. 10.1016/j.celrep.2020.108088

  • 11

    ChuaS. C. J. H.TanH. Q.EngelbergD.LimL. H. K. (2019). Alternative experimental models for studying influenza proteins, host–virus interactions and anti-influenza drugs. Pharmaceuticals12, 147. 10.3390/ph12040147

  • 12

    CortiD.VossJ.GamblinS. J.CodoniG.MacagnoA.JarrossayD.et al (2011). A neutralizing antibody selected from plasma cells that binds to group 1 and group 2 influenza A hemagglutinins. Sci. (80-. )333, 850856. 10.1126/science.1205669

  • 13

    CoxN. J.SubbaraoK. (2000). Global Epidemiology of Influenza: Past and present *, 407421. 10.1146/annurev.med.51.1.407

  • 14

    DandagiG. L.ByahattiS. M. (2011). An insight into the swine-influenza A (H1N1) virus infection in humans. Lung India Off. Organ Indian Chest Soc.28, 3438. 10.4103/0970-2113.76299

  • 15

    de VriesR. P.de VriesE.Martínez-RomeroC.McBrideR.van KuppeveldF. J.RottierP. J. M.et al (2013). Evolution of the hemagglutinin protein of the new pandemic H1N1 influenza virus: Maintaining optimal receptor binding by compensatory substitutions. J. Virol.87, 1386813877. 10.1128/JVI.01955-13

  • 16

    FelsensteinJ. (1985). Confidence limits on phylogenies: A justification. Evol. (N. Y).39, 783791. 10.1111/j.1558-5646.1985.tb00420.x

  • 17

    FergusonL.OlivierA. K.GenovaS.EppersonW. B.SmithD. R.SchneiderL.et al (2016). Pathogenesis of influenza D virus in cattle. J. Virol.90, 56365642. 10.1128/JVI.03122-15

  • 18

    GanH. H.ZinnoJ. P.PianoF.GunsalusK. C. (2022). Omicron Spike protein has a positive electrostatic surface that promotes ACE2 recognition and antibody escape. Front. Virol.43. 10.3389/fviro.2022.894531

  • 19

    GaoY.ZhangY.ShinyaK.DengG.JiangY.LiZ.et al (2009). Identification of amino acids in HA and PB2 critical for the transmission of H5N1 avian influenza viruses in a mammalian host. PLoS Pathog.5, e1000709. 10.1371/journal.ppat.1000709

  • 20

    GartenR. J.DavisC. T.RussellC. A.ShuB.LindstromS.BalishA.et al (2009). Antigenic and genetic characteristics of swine-origin 2009 A (H1N1) influenza viruses circulating in humans. Sci. (80-325, 197201. 10.1126/science.1176225

  • 21

    GathererD. (2009). The 2009 H1N1 influenza outbreak in its historical context. J. Clin. Virol.45, 174178. 10.1016/j.jcv.2009.06.004

  • 22

    GerhardW.YewdellJ.FrankelM. E.WebsterR. (1981). Antigenic structure of influenza virus haemagglutinin defined by hybridoma antibodies. Nature290, 713717. 10.1038/290713a0

  • 23

    GhaffariH.TavakoliA.MoradiA.TabarraeiA.Bokharaei-SalimF.ZahmatkeshanM.et al (2019). Inhibition of H1N1 influenza virus infection by zinc oxide nanoparticles: Another emerging application of nanomedicine. J. Biomed. Sci.26, 7010. 10.1186/s12929-019-0563-4

  • 24

    GuillebaudJ.HéraudJ.RazanajatovoN. H.LivinskiA. A.AlonsoW. J. (2017). Both hemispheric influenza vaccine recommendations would have missed near half of the circulating viruses in Madagascar. Influenza Other respi. Viruses11, 473478. 10.1111/irv.12517

  • 25

    HallT. A. (1999). BioEdit a user friendly Biol. Seq. alignment Ed. Anal. Progr. Wind.41: 9598.

  • 26

    HongM.LeeP. S.HoffmanR. M. B.ZhuX.KrauseJ. C.LaursenN. S.et al (2013). Antibody recognition of the pandemic H1N1 Influenza virus hemagglutinin receptor binding site. J. Virol.87, 1247112480. 10.1128/JVI.01388-13

  • 27

    HuW. (2010). Highly conserved domains in hemagglutinin of influenza viruses characterizing dual receptor binding. Nat. Sci.2, 10051014. 10.4236/ns.2010.29123

  • 28

    HütterJ.RödigJ. V.HöperD.SeebergerP. H.ReichlU.RappE.et al (2013). Toward animal cell culture–based influenza vaccine design: Viral hemagglutinin N-glycosylation markedly impacts immunogenicity. J. Immunol.190, 220230. 10.4049/jimmunol.1201060

  • 29

    Intelli-E.DevelopmentC.JainS.FinelliL.ShawM. W.LindstromS.et al (2009). New England journal. N. Engl. J. Med.360, 26052615. 10.1056/NEJMoa0903810

  • 30

    IulianoA. D.RoguskiK. M.ChangH. H.MuscatelloD. J.PalekarR.TempiaS.et al (2017). Articles estimates of global seasonal influenza-associated respiratory mortality: A modelling study. 6736, 116. 10.1016/S0140-6736(17)33293-2

  • 31

    JawadB.AdhikariP.PodgornikR.ChingW.-Y. (2022). Binding interactions between receptor-binding domain of spike protein and human angiotensin converting enzyme-2 in omicron variant. J. Phys. Chem. Lett.13, 39153921. 10.1021/acs.jpclett.2c00423

  • 32

    JonesS.Nelson-SathiS.WangY.PrasadR.RayenS.NandelV.et al (2019). Evolutionary, genetic, structural characterization and its functional implications for the influenza A (H1N1) infection outbreak in India from 2009 to 2017. Sci. Rep.9, 1469014710. 10.1038/s41598-019-51097-w

  • 33

    JoyceM. G.WheatleyA. K.ThomasP. V.ChuangG.-Y.SotoC.BailerR. T.et al (2016). Vaccine-induced antibodies that neutralize group 1 and group 2 influenza A viruses. Cell166, 609623. 10.1016/j.cell.2016.06.043

  • 34

    LangS.XieJ.ZhuX.WuN. C.LernerR. A.WilsonI. A. (2017). Antibody 27F3 broadly targets influenza A group 1 and 2 hemagglutinins through a further variation in VH1-69 antibody orientation on the HA stem. Cell Rep.20, 29352943. 10.1016/j.celrep.2017.08.084

  • 35

    LazniewskiM.DawsonW. K.SzczepińskaT.PlewczynskiD. (2018). The structural variability of the influenza A hemagglutinin receptor-binding site. Brief. Funct. Genomics17, 415427. 10.1093/bfgp/elx042

  • 36

    LeeJ. M.EguiaR.ZostS. J.ChoudharyS.WilsonP. C.BedfordT.et al (2019). Mapping person-to-person variation in viral mutations that escape polyclonal serum targeting influenza hemagglutinin. Elife8, e49324. 10.7554/eLife.49324

  • 37

    LinT.WangG.LiA.ZhangQ.WuC.ZhangR.et al (2009). The hemagglutinin structure of an avian H1N1 influenza A virus. Virology392, 7381. 10.1016/j.virol.2009.06.028

  • 38

    LinX.NoelJ. K.WangQ.MaJ.OnuchicJ. N. (2018). Atomistic simulations indicate the functional loop-to-coiled-coil transition in influenza hemagglutinin is not downhill. Proc. Natl. Acad. Sci.115, E7905E7913. 10.1073/pnas.1805442115

  • 39

    LuoT.LiuL.ShenX.IrwinD. M.LiaoM.ShenY. (2018a). The evolutionary dynamics of H1N1/pdm2009 in India. Infect. Genet. Evol.65, 276282. 10.1016/j.meegid.2018.08.009

  • 40

    LuoT.LiuL.ShenX.IrwinD. M.LiaoM.ShenY. (2018b). The evolutionary dynamics of H1N1/pdm2009 in India. Infect. Genet. Evol.65, 276282. 10.1016/j.meegid.2018.08.009

  • 41

    MainesT. R.JayaramanA.BelserJ. A.WadfordD. A.PappasC.ZengH.et al (2009). Transmission and pathogenesis of swine-origin 2009 A (H1N1) influenza viruses in ferrets and mice. Sci. (80-. )325, 484487. 10.1126/science.1177238

  • 42

    MakauJ. N.WatanabeK.IshikawaT.MizutaS.HamadaT.KobayashiN.et al (2017). Identification of small molecule inhibitors for influenza a virus using in silico and in vitro approaches. PLoS One12, e0173582. 10.1371/journal.pone.0173582

  • 43

    MatsuokaY.SwayneD. E.ThomasC.Rameix-WeltiM.-A.NaffakhN.WarnesC.et al (2009). Neuraminidase stalk length and additional glycosylation of the hemagglutinin influence the virulence of influenza H5N1 viruses for mice. J. Virol.83, 47044708. 10.1128/JVI.01987-08

  • 44

    McAuleyJ. L.GilbertsonB. P.TrifkovicS.BrownL. E.McKimm-BreschkinJ. L. (2019). Influenza virus neuraminidase structure and functions. Front. Microbiol.10, 39. 10.3389/fmicb.2019.00039

  • 45

    McDonaldN. J.SmithC. B.CoxN. J. (2007). Antigenic drift in the evolution of H1N1 influenza A viruses resulting from deletion of a single amino acid in the haemagglutinin gene. J. Gen. Virol.88, 32093213. 10.1099/vir.0.83184-0

  • 46

    MishraA. C.ChadhaM. S.ChoudharyM. L.PotdarV. A. (2010). Pandemic influenza (H1N1) 2009 is associated with severe disease in India. PLoS One5, e10540. 10.1371/journal.pone.0010540

  • 47

    MorlighemJ.-É.AokiS.KishimaM.HanamiM.OgawaC.JallohA.et al (2011). Mutation analysis of 2009 pandemic influenza A (H1N1) viruses collected in Japan during the peak phase of the pandemic. PLoS One6, e18956. 10.1371/journal.pone.0018956

  • 48

    MurhekarM.MehendaleS. (2016). The 2015 influenza A (H1N1) pdm09 outbreak in India. Indian J. Med. Res.143, 821823. 10.4103/0971-5916.192077

  • 49

    NelsonM. I.HolmesE. C. (2007). The evolution of epidemic influenza. Nat. Rev. Genet.8, 196205. 10.1038/nrg2053

  • 50

    NeumannG.NodaT.KawaokaY. (2009). Emergence and pandemic potential of swine-origin H1N1 influenza virus. Nature459, 931939. 10.1038/nature08157

  • 51

    OdagiriT.MatsuzakiY.OkamotoM.SuzukiA.SaitoM.TamakiR.et al (2015). Isolation and characterization of influenza C viruses in the Philippines and Japan. J. Clin. Microbiol.53, 847858. 10.1128/JCM.02628-14

  • 52

    OhuchiM.OrlichM.OhuchiR.SimpsonB. E. J.GartenW.KlenkH.-D.et al (1989). Mutations at the cleavage site of the hemagglutinin after the pathogenicity of influenza virus A/chick/Penn/83 (H5N2). Virology168, 274280. 10.1016/0042-6822(89)90267-5

  • 53

    ParidaM.DashP. K.KumarJ. S.JoshiG.TandelK.SharmaS.et al (2016). Emergence of influenza A (H1N1) pdm09 genogroup 6B and drug resistant virus. India. January to May 2015. 10.2807/1560-7917.ES.2016.21.5.30124

  • 54

    PaulesC.SubbaraoK. (2017). Influenza. Lancet Lond Engl.390, 697708. 10.1016/S0140-6736(17)30129-0

  • 55

    PettersenE. F.GoddardT. D.HuangC. C.CouchG. S.GreenblattD. M.MengE. C.et al (2004). UCSF Chimera—A visualization system for exploratory research and analysis. J. Comput. Chem.25, 16051612. 10.1002/jcc.20084

  • 56

    PrasadR.MohanakumariV. V.SasiR. V.NairR.JonesS.PillaiM. R. (2020). Complete genome analysis of Influenza A (H1N1) viruses isolated in Kerala, India. Microbiol. Resour. Announc.9, e0006220. 10.1128/MRA.00062-20

  • 57

    RamanS.VernonR.ThompsonJ.TykaM.SadreyevR.PeiJ.et al (2009). Structure prediction for CASP8 with all-atom refinement using Rosetta. Proteins77, 8999. 10.1002/prot.22540

  • 58

    RambautA.PybusO. G.NelsonM. I.ViboudC.TaubenbergerJ. K.HolmesE. C. (2008). The genomic and epidemiological dynamics of human influenza A virus. Nature453, 615619. 10.1038/nature06945

  • 59

    RavinaR.DalalA.MohanH.PrasadM.PundirC. S. (2020). Detection methods for influenza A H1N1 virus with special reference to biosensors: A review. Biosci. Rep.40. 10.1042/BSR20193852

  • 60

    SaxenaS. K.HaikerwalA.KumarS.BhattM. L. B. (2018). Introductory chapter: Human influenza A virus infection-global prevalence, prevention, therapeutics, and challenges. Influ. Ther. Challenges1. 10.5772/intechopen.77350

  • 61

    SchulzeI. T. (1997). Effects of glycosylation on the properties and functions of influenza virus hemagglutinin. J. Infect. Dis.176, S24S28. 10.1086/514170

  • 62

    SharmaV.SharmaM.DhullD.KaushikS. (2019). Phylogenetic analysis of the hemagglutinin gene of influenza A (H1N1) pdm09 and A (H3N2 ) virus isolates from Haryana, India. VirusDisease30, 336343. 10.1007/s13337-019-00532-7

  • 63

    ShiW.LeiF.ZhuC.SieversF.HigginsD. G. (2010). A complete analysis of HA and NA genes of influenza A viruses. PLoS One5, e14454. 10.1371/journal.pone.0014454

  • 64

    SiddiquiA.ChowdharyR.MaanH. S.GoelS. K.TripathiN.PrakashA. (2020). In silico analysis and molecular characterization of Influenza A (H1N1) pdm09 virus circulating and causing major outbreaks in central India, 2009–2019. Iran. J. Microbiol.12, 483494. 10.18502/ijm.v12i5.4611

  • 65

    SimonsenL. (1999). The global impact of influenza on morbidity and mortality, 17, S3S10.Vaccine. 10.1016/s0264-410x(99)00099-7

  • 66

    SongY.DiMaioF.WangR. Y.-R.KimD.MilesC.BrunetteT. J.et al (2013). High-resolution comparative modeling with RosettaCM. Structure21, 17351742. 10.1016/j.str.2013.08.005

  • 67

    SriwilaijaroenN.SuzukiY. (2012). Molecular basis of the structure and function of H1 hemagglutinin of influenza virus. Proc. Jpn. Acad. Ser. B88, 226249. 10.2183/pjab.88.226

  • 68

    SuS.FuX.LiG.KerlinF.VeitM. (2017). Novel Influenza D virus: Epidemiology, pathology, evolution and biological characteristics. Virulence8, 15801591. 10.1080/21505594.2017.1365216

  • 69

    SuY. C. F.BahlJ.JosephU.ButtK. M.PeckH. A.KoayE. S. C.et al (2015). Phylodynamics of H1N1/2009 influenza reveals the transition from host adaptation to immune-driven selection. Nat. Commun.6, 7952. 10.1038/ncomms8952

  • 70

    SwoffordD. L.Phylogenetic analysis using parsimony *PAUP* 4.0 Beta: Command Reference—Draft Version 2—(ucl.ac.uk).

  • 71

    TamuraK.NeiM.KumarS. (2004). Prospects for inferring very large phylogenies by using the neighbor-joining method. Proc. Natl. Acad. Sci. U. S. A.101, 1103011035. 10.1073/pnas.0404206101

  • 72

    TandelK.SharmaS.DashP. K.ParidaM. (2018). Oseltamivir‐resistant influenza A (H1N1) pdm09 virus associated with high case fatality, India 2015. J. Med. Virol.90, 836843. 10.1002/jmv.25013

  • 73

    TharakaramanK.SasisekharanR. (2015). Influenza surveillance: 2014–2015 H1N1 “swine”-derived influenza viruses from India. Cell Host Microbe17, 279282. 10.1016/j.chom.2015.02.019

  • 74

    ThompsonJ. D.HigginsD. G.GibsonT. J. (1994). Clustal W: Improving the sensitivity of progressive multiple sequence alignment through sequence weighting, position-specific gap penalties and weight matrix choice. Nucleic Acids Res.22, 46734680. 10.1093/nar/22.22.4673

  • 75

    Victoria MartínezB.AhmedA.ZuernerR. L.AhmedN.BulachD. M.Quinteiro VázquezJ.et al (2008). Conservation of the S10-spc-alpha locus within otherwise highly plastic genomes provides phylogenetic insight into the genus leptospira. 10.1371/journal.pone.0002752

  • 76

    WangM.VeitM. (2016). Hemagglutinin-esterase-fusion (HEF) protein of influenza C virus. Protein Cell7, 2845. 10.1007/s13238-015-0193-x

  • 77

    WangW.SunX.LiY.SuJ.LingZ.ZhangT.et al (2016). Human antibody 3E1 targets the HA stem region of H1N1 and H5N6 influenza A viruses. Nat. Commun.7, 13577. 10.1038/ncomms13577

  • 78

    WebsterR. G.GovorkovaE. A. (2014). Continuing challenges in influenza. Ann. N. Y. Acad. Sci.1323, 115139. 10.1111/nyas.12462

  • 79

    WeiC.-J.BoyingtonJ. C.DaiK.HouserK. V.PearceM. B.KongW.-P.et al (2010). Cross-neutralization of 1918 and 2009 influenza viruses: Role of glycans in viral evolution and vaccine design. Sci. Transl. Med.2, 24ra21. 10.1126/scitranslmed.3000799

  • 80

    WileyD. C.WilsonI. A.SkehelJ. J. (1981). Structural identification of the antibody-binding sites of Hong Kong influenza haemagglutinin and their involvement in antigenic variation. Nature289, 373378. 10.1038/289373a0

  • 81

    WuN. C.AndrewsS. F.RaabJ. E.O’ConnellS.SchrammC. A.DingX.et al (2020). Convergent evolution in breadth of two VH6-1-encoded influenza antibody clonotypes from a single donor. Cell Host Microbe28, 434444. 10.1016/j.chom.2020.06.003

  • 82

    XuR.EkiertD. C.KrauseJ. C.HaiR.CroweJ. E.JrWilsonI. A. (2010). Structural basis of preexisting immunity to the 2009 H1N1 pandemic influenza virus. Sci. (80-. )328, 357360. 10.1126/science.1186430

  • 83

    XuR.McBrideR.NycholatC. M.PaulsonJ. C.WilsonI. A. (2012). Structural characterization of the hemagglutinin receptor specificity from the 2009 H1N1 influenza pandemic. J. Virol.86, 982990. 10.1128/JVI.06322-11

  • 84

    XuanC.ShiY.QiJ.ZhangW.XiaoH.GaoG. F. (2011). Structural vaccinology: Structure-based design of influenza A virus hemagglutinin subtype-specific subunit vaccines. Protein Cell2, 9971005. 10.1007/s13238-011-1134-y

  • 85

    YaoB.ZhangL.LiangS.ZhangC. (2012). SVMTriP: A method to predict antigenic epitopes using support vector machine to integrate tri-peptide similarity and propensity. 10.1371/journal.pone.0045152

  • 86

    YokoyamaM.FujisakiS.ShirakuraM.WatanabeS. (2017). Molecular dynamics simulation of the influenza A (H3N2 ) hemagglutinin trimer reveals the structural basis for adaptive evolution of the recent epidemic clade 3C. 2a. Front. Microbiol.8, 110. 10.3389/fmicb.2017.00584

  • 87

    ZhaiS.-L.ZhangH.ChenS.-N.ZhouX.LinT.LiuR.et al (2017). Influenza D virus in animal species in Guangdong Province, southern China. Emerg. Infect. Dis.23, 13921396. 10.3201/eid2308.170059

  • 88

    ZhangM.GaschenB.BlayW.FoleyB.HaigwoodN.KuikenC.et al (2004). Tracking global patterns of N-linked glycosylation site variation in highly variable viral glycoproteins: HIV, SIV, and HCV envelopes and influenza hemagglutinin. Glycobiology14, 12291246. 10.1093/glycob/cwh106

  • 89

    ZhangW.ShiY.QiJ.GaoF.LiQ.FanZ.et al (2013). Molecular basis of the receptor binding specificity switch of the hemagglutinins from both the 1918 and 2009 pandemic influenza A viruses by a D225G substitution. J. Virol.87, 59495958. 10.1128/JVI.00545-13

Summary

Keywords

influenza A, H1N1, virus, phylogenetic analysis, antigenic site, N-glycosylation, receptor-binding domain

Citation

Pushan SS, Samantaray M, Rajagopalan M and Ramaswamy A (2023) Evolution of Indian Influenza A (H1N1) Hemagglutinin Strains: A Comparative Analysis of the Pandemic Californian HA Strain. Front. Mol. Biosci. 10:1111869. doi: 10.3389/fmolb.2023.1111869

Received

30 November 2022

Accepted

20 February 2023

Published

16 March 2023

Volume

10 - 2023

Edited by

Geetika Sharma, Generate Biommedicines, United States

Reviewed by

Hrishikesh Lokhande, Brigham and Women’s Hospital and Harvard Medical School, United States

Shipra Sharma, The Scripps Research Institute, United States

Updates

Copyright

*Correspondence: Amutha Ramaswamy,

This article was submitted to Molecular Diagnostics and Therapeutics, a section of the journal Frontiers in Molecular Biosciences

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics