ORIGINAL RESEARCH article

Front. Microbiol., 03 February 2016

Sec. Virology

Volume 7 - 2016 | https://doi.org/10.3389/fmicb.2016.00061

Unique Flap Conformation in an HIV-1 Protease with High-Level Darunavir Resistance

  • 1. Department of Infectious Diseases and Immunology, Clinical Research Center, National Hospital Organization Nagoya Medical Center Nagoya, Japan

  • 2. Department of Biotechnology, Nagoya University Graduate School of Engineering Nagoya, Japan

  • 3. AIDS Research Center, National Institute of Infectious Diseases Tokyo, Japan

  • 4. Synchrotron Radiation Research Center, Nagoya University Nagoya, Japan

  • 5. Department of AIDS Research, Nagoya University Graduate School of Medicine Nagoya, Japan

Abstract

Darunavir (DRV) is one of the most powerful protease inhibitors (PIs) for treating human immunodeficiency virus type-1 (HIV-1) infection and presents a high genetic barrier to the generation of resistant viruses. However, DRV-resistant HIV-1 infrequently emerges from viruses exhibiting resistance to other protease inhibitors. To address this resistance, researchers have gathered genetic information on DRV resistance. In contrast, few structural insights into the mechanism underlying DRV resistance are available. To elucidate this mechanism, we determined the crystal structure of the ligand-free state of a protease with high-level DRV resistance and six DRV resistance-associated mutations (including I47V and I50V), which we generated by in vitro selection. This crystal structure showed a unique curling conformation at the flap regions that was not found in the previously reported ligand-free protease structures. Molecular dynamics simulations indicated that the curled flap conformation altered the flap dynamics. These results suggest that the preference for a unique flap conformation influences DRV binding. These results provide new structural insights into elucidating the molecular mechanism of DRV resistance and aid to develop PIs effective against DRV-resistant viruses.

Introduction

At present, more than 20 antiviral drugs are clinically available to treat patients infected with human immunodeficiency virus type 1 (HIV-1). PIs, such as darunavir (DRV; previously known as TMC114), suppress HIV-1 replication by inhibiting the functions of the viral protease (PR). DRV is a second-generation HIV-1 PI and is one of the most potent anti-HIV-1 drugs, owing to its high antiviral activity and high genetic barrier to the generation of resistant viruses (Koh et al., 2003; De Meyer et al., 2005; Surleraux et al., 2005; Ghosh et al., 2006; Dierynck et al., 2007). However, a history of drug-resistant HIV infection and/or experience of treatment-failure with other regimens could raise concerns about the emergence of DRV-resistant virus, which subsequently results in incomplete viral suppression (Koh et al., 2010; Dierynck et al., 2011). The increasing number of these DRV resistance-associated mutations at baseline raises the risk of developing DRV resistance (Delaugerre et al., 2008). The latest International AIDS Society (IAS)-USA panel list shows 11 mutations associated with DRV resistance: V11I, V32I, L33F, I47V, I50V, I54M/L, T74P, L76V, I84V, and L89V (Wensing et al., 2014). The emergence of DRV-resistant viruses is the most troublesome clinical issue.

The mechanisms underlying DRV resistance must be elucidated to overcome DRV resistance and develop active drugs against DRV-resistant viruses. One valuable approach is to obtain three-dimensional (3D) structure information of PR variants with high-level resistance to DRV. Nonetheless, few reports have published 3D structures of PR variants with high-level resistance to DRV (Saskova et al., 2009; Agniswamy et al., 2012; Zhang et al., 2014), probably because of the rarity of these PRs. In this study, we generated viruses with high-level resistance to DRV by in vitro selection and determined a crystal structure of an HIV-1 PR with high-level resistance to DRV. We obtained a variant with high-level resistance to DRV, which carries I47V and I50V in the PR region. These two mutations are known as the major DRV-resistance mutations (Wensing et al., 2014), although it has also been reported that they reduce viral PR activity and viral fitness (Pazhanisamy et al., 1996; Maguire et al., 2002; Prado et al., 2002; Liu et al., 2005). The solved high-resolution crystal structure of the viral PR exhibited a unique curling conformation at the flap regions (residues 43–58) (Hornak et al., 2006b) that was not found in the previously reported PR structures. These results provide new structural insights into elucidating the molecular mechanism of DRV resistance and aid to develop PIs effective against DRV-resistant viruses.

Materials and methods

Sample collection

Twenty samples with viral sequences that implied resistance to multiple drugs were selected from patient samples sent to the Japanese Drug Resistance HIV-1 Surveillance Network for regular drug-resistance testing from January 2005 to December 2007 (Table 1; Hattori et al., 2010). This study was conducted according to the principles of the Declaration of Helsinki. The Ethical Committee at the National Institute of Infectious Diseases approved the study. All patients provided written informed consent for the collection of samples and the subsequent analyses.

Table 1

Patient IDExposed PIsGenotypic resistance mutations
MajorMinorOther*
FS492SQV, IDVI54V, V82F, L90MG16E, K20I, I62V, L63P8
FS796IDV, NFVM46I, V82F, L90ML63P, H69K3
FS1041RTV, NFVV32I, I54V, V82M, L90MK20R, K43T, M36I, I62V, L63P, A71V, G73S3
FS1120SQV, RTVI54V, V82S, L90ML10I, L33F, Q58E, L63P, A71V, G73S2
FS1182SQV, NFVL90MK20KM, L10I, L63P, A71IV, V77I, G73S3
FS1673SQV, RTV, IDV, NFVM46I, I84V, L90MK20KT, I62IV, L63P, A71V, G73S, V77I7
FS1745SQV, RTV, IDV, NFVM46I, I84V, L90ML10I, M36I, I62V, L63P, A71T, G73T7
FS1762RTV, DV, NFVM46I, I54V, V82AL10I, L24I, L33I, M36L, K43T, I62V, L63P, I64IV3
FS1777NFVM46MI, L90LML10LI, I62V, L63P, A71AV, G73GS, V77I4
FS2510SQV, RTV, NFVD30N, M46I, I54V, N88D, L90ML10I, L23I, K43T, I62V, L63P, A71T, V77I5
FS2628SQV, RTV, IDV, NFVM46I, I84V, L90ML10I, K20I, M36V, I62V, L63P, A71V, G73S3
FS2699RTV, NFVI54V, V82A, L90ML10I, K20I, M36I, A71V, G73S6
FS2715IDV, NFVI54V, V82A, L90ML10I, M36V, I62V, L63P, A71V, G73T2
FS2735SQV, RTV, IDV, NFVM46MI, I84IV, L90LML10LI, I62IV, L63P, A71V, G73GS, V77VI8
FS5929SQV, RTV, IDV, NFV, APV, LPVM46I, I54V, V82F, L90ML10I, L23I, L33F, F53L, Q58E, I62IV, L63P, A71V, G73S, V77I3
FS6174SQV, RTV, NFVD30N, I54V, N88D, L90ML10V, K20T, M36I, I62V, L63T, I64IV, A71V9
FS6175SQV, RTV, LPV, ATVV32I, M46L, I54V, V82A, L90ML10V, K20R, M36I, K43KT, F53FL, I62IV, L63P, A71V4
FS6189NFVD30N, N88D, L90ML63P, A71I, V77I4
FS6190SQV, RTV, NFV, LPV, ATVM46I, I84V, L90ML10I, K20T, M36I, F53L, Q58QE, I62V, L63AT, A71V8
FS7766RTV, APV, ATVL90ML10I, L63P, V77I3

Twenty multi-drug resistant HIV-1 isolates from clinical samples selected in this study.

*

The column shows the number of PR mutations in each patient other than major and minor mutations.

The multiple drug-resistant virus sample used in this study to induce DRV-resistant HIV-1.

In vitro selection of a DRV-resistant virus

We infected each virus derived from the patient serum into the R5-MaRBLE cell line (Chiba-Mizutani et al., 2007) and induced resistance by treating with 2 nM DRV. The cultures were maintained by changing half of the medium every 3–5 days and by step-wise increases in the DRV concentration to 1000 nM.

In vitro phenotype assay to examine drug susceptibility

The susceptibilities to the PIs were evaluated using an in-house drug susceptibility assay with the R5-MaRBLE cell line as described elsewhere (Chiba-Mizutani et al., 2007; Shibata et al., 2011). Inhibitory concentration 50% (IC50) values were obtained from three independent experiments.

Extraction and amplification of viral RNA

Viral RNA was extracted from the cultured system as follows. First, virus particles in the cell culture supernatant were collected by centrifugation at 20,000 × g at 4°C for 1.5 h. The collected particles were suspended in 300 μL of RNAgents Denaturing Solution (Promega, Madison, WI, USA). Then, the RNA was purified by phenol-chloroform extraction. The gag-PR region (625–3402; positions based on HXB2 numbering) of the purified RNA was reverse transcribed using a PrimeScript II High Fidelity One Step RT-PCR Kit (Takara Bio Inc., Kusatsu, Japan). Subsequently, an inner gag-PR region (681–3348) was amplified by nested PCR using PrimeSTAR GXL DNA Polymerase (Takara Bio Inc.). The primer sets used for the amplification were as follows: reverse transcription PCR, 5′-ATCTCTAGCAGTGGC GCCCGAACAG and 5′-TAC TTCTGTTAGTGCTTTGGTTCC and nested PCR, 5′-CTCTCTCGACGC AGGACTCG and 5′-TAA TCCCTGCATAAATCTGACTTGC.

Construction of recombinant viruses

A DNA fragment of gag-PR region (699–2580) was inserted into the pNL4-3 clone vector using a GeneArt Seamless Cloning and Assembly Kit (Thermo Fisher Scientific, Waltham, MA, USA). First, we amplified the target gag-PR region with PrimeSTAR GXL Polymerase. The primer set used for amplification was as follows: 5′-CGGCTT GCTGAAGCGCGCACAGCAAGAGGCGAGGGGCGGCGACTG and 5′-TTA CTGGTACAGTCTCAATAGGACTAATGGG. The amplified PCR product was ligated with pNL4-3 without gag-PR.

Construction of the inactive PR expression vector

The full-length PR region (2253–2549) was amplified by nested PCR using KOD DNA Polymerase (TOYOBO, Osaka, Japan). The primer set used for amplification was as follows: 5′-ATATACATATGCCTCAGAT CACTCTTTGG and 5′-TG GTGCTCGAGTTACTAAAAATTTAAAGTGCAGCC. Subsequently, the PCR product was inserted into pET-41a(+) (Merck Millipore, Billerica, MA, USA) using NdeI and XhoI restriction enzymes and a DNA Ligation Kit ver. 2.1 (Takara Bio Inc.). Mutagenesis was performed to obtain an inactive D25N PR mutant.

Expression, purification, and refolding of the inactive PR

The enzymatically-inactive PR was expressed, purified, and then refolded by using a method similar to that in the previous report by Dr. Schiffer's group (King et al., 2002). Briefly, the inactive PR was expressed in LB medium with 1 mM IPTG at 37°C. The inclusion bodies with the PR were collected by using a French press and subsequently centrifuged at 10,000 × g at 4°C for 5 min. The collected inclusion bodies were washed with 2 M urea, and the PR protein was solubilized in a 50% acetic acid solution. The obtained PR protein was purified by gel filtration with a HiLoad 26/60 Superdex75 (GE Healthcare Bio-Sciences, Pittsburgh, PA, USA) and AKTAPrime (GE Healthcare Bio-Sciences). The PR was refolded in buffer containing sodium acetate (pH 5.5). Finally, the PR was further purified by gel filtration with a HiLoad 26/60 Superdex75 column (GE Healthcare Bio-Sciences).

Crystallization of the inactive PR

The purified PR was concentrated to a final concentration of 2.6 mg mL−1 with a VIVASPIN MW5000 concentrator (GE Healthcare Bio-Sciences). Then, initial crystallization conditions of PR were screened using following crystallization screening kits: Wizard I (Emerald Biosystems, Bainbridge Island, WA, USA), Wizard II (Emerald Biosystems), and JCSG-plus Screen MD-137 (Molecular Dimensions, Suffolk, UK). The final optimized crystallization condition after iterative optimization cycles was at 0.84 M Lithium chloride, 0.84 mM Sodium citrate, 17%(w/v) PEG 6000, 10% Glycerol, and 5% Ethylene glycol. The crystal was obtained by the hanging-drop vapor-diffusion method. The drops were incubated at 20°C.

X-ray diffraction and data collection

The X-ray diffraction data were collected at the SPring-8 beamline BL38B1 (Sayo, Hyogo, Japan). The data were integrated with the HKL2000 program (Otwinowski and Minor, 1997). The structure of the inactive PR was determined by the molecular replacement method with the MOLREP programs (Vargin and Teplyakov, 1997; Winn et al., 2011) using a wild-type (WT) PR structure (Protein Data Bank (PDB) ID: 1KJ7) (Prabu-Jeyabalan et al., 2002) as the search model. The structure was further refined with the REFMAC5 and COOT programs (Murshudov et al., 1997; Emsley et al., 2010).

Molecular dynamics (MD) simulations

We performed 30 ns MD simulations of the ligand-free states of the PRs under explicit water conditions. The initial structures of the PRs were generated based on a known crystal structure (PDB ID: 1HHP) (Spinelli et al., 1991) and the structure solved in this study. In the initial structures, the PRs were surrounded by approximately 12,000 water molecules, and N25 was changed to the catalytically active D25. We conducted energy minimization for the PR system by first using 10,000 steps of the steepest descent method and then 10,000 steps of the conjugated gradient method. We subsequently heated the energy-minimized system to 310 K (~37°C) by using the NVT ensemble. Then, we performed MD simulations at 310 K and 1 atm by using the NPT ensemble. During the simulations, hydrogen bonds among residues in the fireman's grip, D25/T26/G27/D25′/T26′/G27′, were retained with a harmonic potential of 100 kcal mol−1 Å−2 and 100 kcal mol−1 degree−2.

We also predicted the structures of mutant PRs in complex with DRV with 6.0 ns MD simulations by using a method similar to that in our previous reports (Ode et al., 2007a,b). Briefly, the initial structure of each molecule was generated from a crystal structure of PR in complex with DRV (PDB ID: 1T3R) (Surleraux et al., 2005). We performed 6.0 ns MD simulations of these structures and then estimated the binding energies between PR and DRV by the MMPBSA method using 1000 trajectories from the well-equilibrated final 1.0 ns of the simulations. For the structural comparison, the representative structure among 1000 snapshots taken during the last 1.0 ns of the simulations was used. The formation of a hydrogen bond was defined as described in our previous studies (Ode et al., 2007a,b).

The simulations were conducted with the AMBER9 software package (Case et al., 2006). The ff10 force field (Hornak et al., 2006a) and gaff (Wang et al., 2004) were used to calculate the energies and forces in the simulations.

Results

In vitro selection yielded variants that accumulated DRV resistance-associated mutations

To obtain a crystal structure of an HIV-1 PR with high-level resistance to DRV, we generated a virus with high-level resistance to DRV from a clinically isolated multiple drug-resistant sample (FS5929). FS5929 contained one minor DRV resistance mutation (L33F) (Table 2) and conferred the highest DRV resistance (7.7-fold increase compared with the WT HIV-1 JR-CSF) of the 20 multiple drug-resistant samples selected for this study (Figure 1 and Table 1). After 154 days of culture in the presence of increasing concentrations of DRV, we obtained a virus mixture (FS5929R) with high-level resistance to DRV that was viable in cultures with 1000 nM DRV (Figure 2). Population sequence analyses of the PR region indicated that FS5929R consisted of at least seven variants (Table 2). The major virus (referred to as FS5929R1) had two major DRV resistance mutations (I47V and I50V), four minor mutations (V11I, V32I, L33F, and L89V), and V82F. The other minor variants had I47V mutation and either of I50V or L76V mutation although the other sequences were similar to that of the major virus. Additionally, we examined the PR cleavage sites in the gag sequences. No sequence changes around the cleavage sites occurred during culture (Table 3), although mutations at the flanking regions of the cleavage sites were observed in both FS5929 and FS5929R1 (except for the sites between the capsid and p2 and between p1 and p6). Together, these results show that the high-level DRV resistance of FS5929R is mainly attributed to the accumulation of DRV resistance-associated mutations in the PR region. In contrast, no DRV-resistant virus was developed by the induction of the WT HIV-1 JR-CSF for over half of a year (Figure 2) as detailed in previous reports (De Meyer et al., 2005; Surleraux et al., 2005; Dierynck et al., 2007).

Table 2

N*DRV resistance mutationsOther
MajorMinor
4750761132338954606282
NL4-3IILVVLLIDIV
FS5929(Day 0)FVVF
FS5929R(Day 154)4$VVIIFVVEF
3VVIFVVEF
2VVIIFVVEL
1VVIIFVVEF
1VVIFVVEF
1VIIFVAEF
1VIIFVVEF

List of PR mutations detected during in vitro selection.

*

The number of clones with the combination of mutations.

Classification of the IAS-USA mutation list at June/July 2014.

FS5929 and FS5929R denote the input virus for the in vitro selection (day 0) and the virus mixture obtained at the day 154 in this study.

The sequence contains mutations: L10I, L23I, L33F, M46I, F53L, I54V, G57R, Q58E, I62V, L63P, H69R, A71V, G73S, V77I, V82F, L90M, and I93L, compared with NL4-3. L33F is reported to be associated with DRV-resistance mutations.

$

The major virus in the virus mixture obtained at the day 154 (FS5929R) was defined as FS5929R1.

Figure 1

Figure 2

Table 3

Positions*102030405060
NL4-3MGARASVLSGGELDKWEKIRLRPGGKKQYKLKHIVWASRELERFAVNPGLLETSEGCRQI
FS5929(Day 0)---------------------------K-R------------------------------
FS5929R(Day 154)-----------K---------------K-R------------------------------
Positions708090100110120
NL4-3LGQLQPSLQTGSEELRSLYNTIAVLYCVHQRIDVKDTKEALDKIEEEQNKSKKKAQQAAA
FS5929(Day 0)-----------------------T-----------------E------------------
FS5929R(Day 154)-----------------------T-----------------E------------------
Positions129139149159169179
XXXXXXXX
NL4-3DTGNNS QVSQNYPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGA
FS5929(Day 0)------SK----F--------------------------I--------------------
FS5929R(Day 154)------SK----F--------------------------I--------------------
Positions189199209219229239
NL4-3TPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGT
FS5929(Day 0)--------------------------------------P Q-------------------A
FS5929R(Day 154)--------------------------------------P Q-------------------A
Positions249259269279289299
NL4-3TSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDR
FS5929(Day 0)------------S---V-----------------------V-------------------
FS5929R(Day 154)------------N---------------------------V-------------------
Positions309319329339349359
NL4-3FYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHK
FS5929(Day 0)----------------------------------------A-------------------
FS5929R(Day 154)----------------------------------------A-------------------
Positions369379389399409419
XXXXXXXXXXXXXXXX
NL4-3ARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEGHIAKNCRAPRKKGCWKCGKE
FS5929(Day 0)---------L--H-----M-------P--------------V-R-------R--------
FS5929R(Day 154)---------L--H-----M-------P--------------V-R----------------
Positions429439449458456466
XXXXXXXXXXXXXXXX
NL4-3GHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAPPEESFRFGEETTTPSQKQ
FS5929(Day 0)-------A---IH--E-----------------A-----PAP------------------
FS5929R(Day 154)-----------IH--E-----------------A-----PAP---------K--------
Positions476
NL4-3EPIDKELYPLA
FS5929(Day 0)--M-EG-----
FS5929R(Day 154)----EG-----

Gag sequence of major DRV-resistant viruses.

FS5929 and FS5929R denote the input viruses for the in vitro selection (day 0) and the virus mixture obtained at the day 154, respectively.

*

The eight residues flanking at each of five PR cleavage sites in Gag (MA-CA, CA-p2, p2-NC, NC-p1, and p1-p6) were highlighted with “X.”

The Gag sequence was shown as a major population sequence.

The major PR obtained from in vitro selection is resistant to DRV but not to TPV

Next, we focused on FS5929R1 and analyzed its resistance to DRV. We generated recombinant viruses carrying the gag-PR of FS5929R1 (rFS5929R1) and FS5929 (rFS5929) based on the HIV-1 NL4-3 backbone. The susceptibility assays showed that rFS5929R1 displayed a >175-fold increase in DRV resistance compared with that of WT NL4-3, whereas FS5929 was susceptible to DRV (1.9-fold increase) (Table 4). We also constructed three recombinant rFS5929R1 viruses lacking the major DRV resistance mutations I47V and/or I50V to assess the contribution of the major mutations to DRV resistance. Each rFS5929R1 virus without I47V (rFS5929R1I47) and rFS5929R1 without I50V (rFS5929R1I50) exhibited a >175-fold and 96.9-fold increase in DRV resistance, respectively, whereas the rFS5929R1 without the two mutations (rFS5929R1I47∕I50) exhibited a 20.4-fold increase. The results suggest that the two major mutations, especially I50V, largely contribute to the DRV resistance in rFS5929R1.

Table 4

NL4-3rFS5929rFS5929R1rFS5929R1I47rFS5929R1I50rFS5929R1I47∕I50
DRV0.0057 ± 0.0006*0.0111 ± 0.0036 (1.9)>1 (>175.3)>1 (>175.3)0.5528 ± 0.0722 (96.9)0.1162 ± 0.0149 (20.4)
APV0.0278 ± 0.00420.4440 ± 0.1263 (16.0)>1 (>35.9)>1 (>35.9)>1 (>35.9)>1 (>35.9)
LPV0.0182 ± 0.0011>1 (>54.9)>1 (>54.9)>1 (>54.9)>1 (>54.9)0.9493 ± 0.0453 (52.1)
RTV0.0347 ± 0.0049>1 (>28.8)>1 (>28.8)>1 (>28.8)>1 (>28.8)>1 (28.8)
NFV0.0120 ± 0.0006>1 (>83.1)>1 (>83.1)>1 (>83.1)>1 (>83.1)>1 (>83.1)
TPV0.1368 ± 0.01190.0646 ± 0.0192 (0.5)0.0500 ± 0.0119 (0.4)0.0204 ± 0.0068 (0.1)0.2397 ± 0.0250 (1.8)0.1810 ± 0.0037 (1.3)
ATV0.0047 ± 0.00130.0481 ± 0.0129 (10.2)0.0178 ± 0.0039 (3.8)0.0490 ± 0.0109 (10.4)0.0489 ± 0.0143 (10.4)0.1350 ± 0.0236 (28.7)
SQV0.0203 ± 0.00770.3030 ± 0.0622 (14.9)0.2500 ± 0.0506 (12.3)0.2631 ± 0.0555 (13.0)0.1838 ± 0.0451 (9.1)0.2440 ± 0.0183 (12.0)

PI susceptibility assays of recombinant viruses.

*

IC50 (μM).

Fold changes from IC50 of HIV-1 NL4-3 are written in parentheses.

We also measured the resistance to seven other PIs: amprenavir (APV), lopinavir (LPV), ritonavir (RTV), nelfinavir (NFV), tipranavir (TPV), atazanavir (ATV), and saquinavir (SQV). The rFS5929 and rFS5929R1 viruses exhibited 16.0- and >35.9-fold resistance, respectively, to the DRV-analog APV. Both viruses exhibited high-level resistance to LPV (>54.9 fold), RTV (>28.8 fold), and NFV (>83.1 fold). Interestingly, both viruses were susceptible to TPV (< 0.5 fold) and exhibited 3- to 15-fold resistance to ATV and SQV, suggesting that the mutations induced by the in vitro selection with DRV scarcely affected the susceptibilities to TPV, ATV, and SQV.

Determination of the high-resolution crystal structure of the ligand-free state of FS5929R1 PR

To investigate the mechanism underlying the DRV resistance of FS5929R1, we determined the crystal structure of the ligand-free state of the inactive FS5929R1 PR homodimer at a 1.8 Å resolution (Figure 3 and Table 5). Our crystal structure had a conformation similar to that of the open forms (Figure 3D), as seen in the previous crystal structures of ligand-free PRs (PDB IDs: 2PC0, 1TW7, 4NPU, and 3UF3; Martin et al., 2005; Heaslet et al., 2007; Agniswamy et al., 2012; Zhang et al., 2014). Although two additional PR conformations have been reported [a semi-open form favored by the ligand-free state of the WT PR (PDB ID: 1HHP) (Spinelli et al., 1991; Hornak et al., 2006b; Deng et al., 2011) and a closed form favored by the ligand-bound state of PR (e.g., PDB ID: 1HVR) (Lam et al., 1994)], few contacts existed between the flap regions of the two monomers in our structure, which was in contrast to these semi-open or closed forms. The root mean squared deviation (RMSD) values of all Cα atoms in our crystal structure compared with those in the open-form structures (2PC0, 1TW7, 4NPU, and 3UF3) were 1.36, 1.42, 1.42, and 1.33 Å, respectively (Figure 4). Contrastingly, the crystal structures of the semi-open and closed forms (1HHP and 1HVR) showed higher RMSD values (1.62 and 1.76 Å) than for the open-form structures (Figure 3E). Notably, two of the open-form structures (4NPU and 3UF3) were the previously reported crystal structures of other PRs with high-level resistance to DRV, suggesting that PRs with high-level resistance to DRV commonly favor configurations that resemble the open form.

Figure 3

Table 5

ParameterValue(s) for HIV-1 PR
DATA COLLECTION
Space groupP1
Unit cell dimensions
a (Å)37.1
b (Å)48.7
c (Å)54.2
   α (degree)89.9
   β (degree)74.0
   γ (degree)86.7
Wave length (Å)1.0
Resolution (Å)50–1.80 (1.86–1.80)
Rmerge (%)4.4 (19.4)
Average I/σ (I)26.9 (3.7)
Completeness (%)96.0 (92.7)
Multiplicity1.9 (1.9)
REFINEMENT
Unique reflections30928
Rwork (%)/Rfree (%)19.6/24.0
No. of non-H atoms
   Protein3174
   Chloride ion5
   Water molecules142
RMS deviation from ideality
   Bonds (Å)0.019
   Angle distance (degree)2.06
Ramachandran plot
   Preferred region (%)95.2
   Allowed region (%)4.0
   Outlier regions (%)0.8
Average B-factors (Å2)
   Main chain25.3
   Side chain28.0
   Solvent33.9

Crystallographic data collection and refinement statistics.

Values in parentheses correspond to the highest resolution shell. The structure has been deposited as 5B18 in Protein Data Bank (PDB).

Figure 4

Our crystal structure had a distinct conformation at the flap regions and the 80s loops that was absent in the open-form structures. The flap tip that are around the 50th residue curled inward in our crystal structure, whereas the 80s loops were slightly shifted inside of the PR. Therefore, the flap tips approached the 80s loop within the same monomer. The distance between the Cα atoms of the 50th and 80th residues within the same monomer of our crystal structure was approximately 8.9 Å, whereas the distances were approximately 14.1 and 14.0 Å in the open-form crystal structures (4NPU and 3UF3, respectively). Interestingly, the regions included the two major DRV resistance mutations (I47V and I50V) and one minor mutation (V32I), which were induced by the in vitro selection (Figure 3C). Hence, the unique curling structure at the flap regions was likely associated with the DRV resistance of FS5929R1.

To assess the stability of the unique curling conformation at the mobile flap regions of the FS5929R1 PR (Figure 5A), we performed 30.0 ns-timescale MD simulations using the determined structure as the initial structure. The MD simulations suggested that the FS5929R1 PR favored conformations in which the flaps in each monomer were separated, which was in contrast to the WT PR (Figure 5B and Supplemental Movies S1, S2). Furthermore, constant curling at the flap region was observed in one monomer but not the second monomer (Figure 5C). These observations suggested that the flap in at least one monomer would frequently adopt the curling conformation despite the high mobility of the flap.

Figure 5

Structure prediction of the FS5929R1 PR in complex with DRV

Finally, to evaluate the binding mode of DRV to the FS5929R and FS5929R1 PRs, we predicted the interactions of both PRs with DRV, from a crystal structure of the WT PR in complex with DRV, by MD simulations (Figure 6) as described in our previous reports (Ode et al., 2007a,b). The MD simulations indicated that a flap region of FS5929R1 PR in complex with DRV shifts outward compared with that of the WT PR in complex with DRV; this change was not observed in FS5929 PR in complex with DRV. Furthermore, the FS5929R1 PR could not create direct hydrogen bonds with the DRV bis-tetrahydrofuran (bis-THF) moiety and the central hydroxyl group (Figure 7). In contrast, FS5929 PR could create hydrogen bonds with DRV that were similar to those of the WT PR despite slight differences in the PR-DRV hydrogen bond networks between the WT and FS5929 PRs. The binding energy calculations indicated a 10.9 kcal mol−1 loss of the binding energy with DRV for each FS5929R1 PR and a 0.8 kcal mol−1 loss for FS5929 PR compared with the WT PR in complex with DRV. These results were consistent with the DRV susceptibility results shown in Table 4, suggesting that the conformational change in the flap likely affected the binding of DRV to PR.

Figure 6

Figure 7

Discussion

The virus with high-level resistance to DRV that was generated in this study (referred to as FS5929R1) harbored 6 DRV resistance-associated mutations in its PR region. The drug susceptibility tests with the recombinant virus variants suggested that the in vitro selection specifically increased the resistance to DRV and its structural analog APV (Table 4). The two major mutations (especially I50V) greatly contributed to the resistance of the PR, which was in agreement with the effects of single substitutions on the binding of DRV to the WT PR (De Meyer et al., 2006; Tremblay, 2008).

Notably, the crystal structure of the ligand-free FS5929R1 PR showed an open-form configuration that was similar to those of the two previously reported ligand-free structures of PRs with high-level resistance to DRV (PDB IDs: 4NPU and 3UF3). However, the FS5929R1 PR exhibited a unique curling conformation at the flaps (Figure 3). Because the FS5929R1 PR harbored the major mutation I50V, which was absent in the other two PRs, the unique flap conformation is likely attributable to I50V. The curled flap conformations in the FS5929R1 PR might hinder the DRV access to the active site of dimeric PR because the flap tips tended to curl toward the active site. Furthermore, the unique flap conformation of the FS5929R1 PR would influence DRV resistance through the change in flexibility of the flap in the dimeric PR suggested by our MD simulations (Figure 5) and proposed in previous MD and NMR studies of other PI-resistant mutants (Perryman et al., 2004; Cai et al., 2012). The high mobility of the flaps of the FS5929R1 PR would provide little opportunity for the formation of PI-binding pockets, resulting in reduced opportunity to bind to DRV. Moreover, when the PR binds DRV, the high flap mobility coupled with effects of active site mutations, such as V32I, I47V, and I50V (Kovalevsky et al., 2006; Liu et al., 2008; Mittal et al., 2013), may result in instability of the complex due to the expansion of the PI-binding pocket (Cai et al., 2014; Figure 6).

It is also plausible that the preference for the unique conformation in FS5929R1 PR would reduce the PR dimerization inhibition activity of DRV, which is the second inhibitory mechanism of DRV (Koh et al., 2007, 2011). DRV appears to bind the region around the 32nd, 33rd, 54th, and 82nd residues in monomeric PR (Koh et al., 2011; Huang and Caflisch, 2012; Hayashi et al., 2014). These four residues are positioned close to the flap tips on the FS5929R1 PR structure. Therefore, the curling conformation would also shield these residues, resulting in the inhibition of DRV binding to monomeric PR; in contrast, the presence of four mutations (V32I, L33F, I54V, and V82F) in FS5929R1 PR might directly impair the DRV binding to monomeric PR.

The DRV-resistant FS5929R1 PR remained susceptible to TPV and exhibited low-to-intermediate resistance to ATV and SQV, which was similar to the results of previous reports on distinct DRV-resistant viruses (Dierynck et al., 2007; Saskova et al., 2009; Rhee et al., 2010). Furthermore, the DRV resistance mutation I50V was related to hypersusceptibility to TPV (Schapiro et al., 2010; Bethell et al., 2012), whereas I50V had the potential to increase susceptibility to ATV (Mittal et al., 2013). Together with our structural information, this information suggests that the distinct susceptibilities might be attributed to the strength of the interactions between the flaps in the PR and these PIs. Crystal structures of the WT PR with TPV, ATV, and SQV (PDB IDs: 1D4Y, 2AQU, and 1HXB, respectively) (Krohn et al., 1991; Thaisrivongs et al., 1996; Clemente et al., 2006) indicate that these PIs commonly have strong interactions with the flaps, which differ from the other PIs. TPV has direct interactions with the main chains of I50 in the flaps, whereas the bulky aromatic rings in ATV and SQV largely interact with the flaps. DRV creates water molecule-mediated hydrogen bonds with the flaps. Therefore, the conformational changes at the flaps may scarcely affect the binding of TPV, ATV, and SQV but not DRV. Obtaining information on the interactions between PR and PIs will aid in the development of PIs that are more potent than DRV against PRs with accumulated mutations at the flap.

In conclusion, we identified a novel structural feature that influences DRV resistance via in vitro selection of HIV-1 variants with high-level resistance to DRV and subsequent determination of a crystal structure and a MD simulation of its PR. The information will aid in the development of potent PIs against DRV-resistant viruses.

Accession number

Coordinates and structure factors have been deposited into the Protein Data Bank (PDB) with the accession code 5B18.

Funding

This study was supported by the Japan Society for the Promotion of Science (JSPS) fellows (MN) under grant number 15J12567, by the JSPS (YI) under grant number 15H04740, and by the Japan Agency for Medical Research and Development (AMED) (YI and NW).

Conflict of interest statement

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest. The reviewer YTY declared a shared affiliation, though no other collaboration, with one of the authors MF to the handling Editor, who ensured that the process nevertheless met the standards of a fair and objective review.

Statements

Author contributions

Conceived and designed the experiments: WS and YI. Performed the experiments: MN, HO, KS, MF, MMaejima, YK, TM, JH, MMatsuda, AH, and YI. Analyzed the data: MN, HO, KS, MF, MMaejima, and YI. Contributed reagents/materials/analysis tools: YY, AS, NW, WS, and YI. Wrote the paper: MN, HO, and YI.

Acknowledgments

The synchrotron radiation experiments were performed at the BL38B1 of SPring-8 with the approval of the Japan Synchrotron Radiation Research Institute (JASRI) (Proposal No. 2011B1255).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest. The reviewer YTY declared a shared affiliation, though no other collaboration, with one of the authors MF to the handling Editor, who ensured that the process nevertheless met the standards of a fair and objective review.

Supplementary material

The Supplementary Material for this article can be found online at: http://journal.frontiersin.org/article/10.3389/fmicb.2016.00061

Supplemental Movie S1

Flap dynamics in WT PR at ligand-free states.

Supplemental Movie S2

Flap dynamics in FS5929R1 PR at ligand-free states.

References

  • 1

    AgniswamyJ.ShenC. H.AnianaA.SayerJ. M.LouisJ. M.WeberI. T. (2012). HIV-1 protease with 20 mutations exhibits extreme resistance to clinical inhibitors through coordinated structural rearrangements. Biochemistry51, 28192828. 10.1021/bi2018317

  • 2

    BethellR.SchererJ.WitvrouwM.PaquetA.CoakleyE.HallD. (2012). Short communication: phenotypic protease inhibitor resistance and cross-resistance in the clinic from 2006 to 2008 and mutational prevalences in HIV from patients with discordant tipranavir and darunavir susceptibility phenotypes. AIDS Res. Hum. Retrovirus.28, 10191024. 10.1089/AID.2011.0242

  • 3

    CaiY.MyintW.PaulsenJ. L.SchifferC. A.IshimaR.Kurt YilmazN. (2014). Drug resistance mutations alter dynamics of inhibitor-bound HIV-1 protease. J. Chem. Theory Comput.10, 34383448. 10.1021/ct4010454

  • 4

    CaiY.YilmazN. K.MyintW.IshimaR.SchifferC. A. (2012). Differential flap dynamics in wild-type and a drug resistant variant of HIV-1 protease revealed by molecular dynamics and NMR relaxation. J. Chem. Theory Comput.8, 34523462. 10.1021/ct300076y

  • 5

    CaseD. A.DardenT. A.CheathamT. E. I.SimmerlingC. L.WangJ.DukeR. E.et al. (2006). AMBER 9. San Francisco, CA: University of California.

  • 6

    Chiba-MizutaniT.MiuraH.MatsudaM.MatsudaZ.YokomakuY.MiyauchiK.et al. (2007). Use of new T-cell-based cell lines expressing two luciferase reporters for accurately evaluating susceptibility to anti-human immunodeficiency virus type 1 drugs. J. Clin. Microbiol.45, 477487. 10.1128/JCM.01708-06

  • 7

    ClementeJ. C.ComanR. M.ThiavilleM. M.JankaL. K.JeungJ. A.NukoolkarnS.et al. (2006). Analysis of HIV-1 CRF_01 A/E protease inhibitor resistance: structural determinants for maintaining sensitivity and developing resistance to atazanavir. Biochemistry45, 54685477. 10.1021/bi051886s

  • 8

    DelaugerreC.PavieJ.PalmerP.GhosnJ.BlancheS.RoudiereL.et al. (2008). Pattern and impact of emerging resistance mutations in treatment experienced patients failing darunavir-containing regimen. AIDS22, 18091813. 10.1097/QAD.0b013e328307f24a

  • 9

    De MeyerS.AzijnH.SurlerauxD.JochmansD.TahriA.PauwelsR.et al. (2005). TMC114, a novel human immunodeficiency virus type 1 protease inhibitor active against protease inhibitor-resistant viruses, including a broad range of clinical isolates. Antimicrob. Agents Chemother.49, 23142321. 10.1128/AAC.49.6.2314-2321.2005

  • 10

    De MeyerS.LefebvreE.AzjinH.de BaereI.van BaelenB.de BethuneM. P. (2006). Phenotypic and genotypic determinants of resistance to TMC 114: pooled analysis of POWER 1, 2 and 3, in 15th International HIV Drug Resistance Workshop (Sitges).

  • 11

    DengN. J.ZhengW.GallicchioE.LevyR. M. (2011). Insights into the dynamics of HIV-1 protease: a kinetic network model constructed from atomistic simulations. J. Am. Chem. Soc.133, 93879394. 10.1021/ja2008032

  • 12

    DierynckI.de WitM.GustinE.KeuleersI.VandersmissenJ.HallenbergerS.et al. (2007). Binding kinetics of darunavir to human immunodeficiency virus type 1 protease explain the potent antiviral activity and high genetic barrier. J. Virol.81, 1384513851. 10.1128/JVI.01184-07

  • 13

    DierynckI.van MarckH.van GinderenM.JonckersT. H.NalamM. N.SchifferC. A.et al. (2011). TMC310911, a novel human immunodeficiency virus type 1 protease inhibitor, shows in vitro an improved resistance profile and higher genetic barrier to resistance compared with current protease inhibitors. Antimicrob. Agents Chemother.55, 57235731. 10.1128/AAC.00748-11

  • 14

    EmsleyP.LohkampB.ScottW. G.CowtanK. (2010). Features and development of Coot. Acta Crystallogr. D Biol. Crystallogr.66, 486501. 10.1107/S0907444910007493

  • 15

    GhoshA. K.SridharP. R.LeshchenkoS.HussainA. K.LiJ.KovalevskyA. Y.et al. (2006). Structure-based design of novel HIV-1 protease inhibitors to combat drug resistance. J. Med. Chem.49, 52525261. 10.1021/jm060561m

  • 16

    HattoriJ.ShiinoT.GatanagaH.YoshidaS.WatanabeD.MinamiR.et al. (2010). Trends in transmitted drug-resistant HIV-1 and demographic characteristics of newly diagnosed patients: nationwide surveillance from 2003 to 2008 in Japan. Antiviral Res.88, 7279. 10.1016/j.antiviral.2010.07.008

  • 17

    HayashiH.TakamuneN.NirasawaT.AokiM.MorishitaY.DasD.et al. (2014). Dimerization of HIV-1 protease occurs through two steps relating to the mechanism of protease dimerization inhibition by darunavir. Proc. Natl. Acad. Sci. U.S.A.111, 1223412239. 10.1073/pnas.1400027111

  • 18

    HeasletH.RosenfeldR.GiffinM.LinY. C.TamK.TorbettB. E.et al. (2007). Conformational flexibility in the flap domains of ligand-free HIV protease. Acta Crystallogr. D Biol. Crystallogr.63, 866875. 10.1107/S0907444907029125

  • 19

    HornakV.AbelR.OkurA.StrockbineB.RoitbergA.SimmerlingC. (2006a). Comparison of multiple Amber force fields and development of improved protein backbone parameters. Proteins65, 712725. 10.1002/prot.21123

  • 20

    HornakV.OkurA.RizzoR. C.SimmerlingC. (2006b). HIV-1 protease flaps spontaneously open and reclose in molecular dynamics simulations. Proc. Natl. Acad. Sci. U.S.A.103, 915920. 10.1073/pnas.0508452103

  • 21

    HuangD.CaflischA. (2012). How does darunavir prevent HIV-1 protease dimerization?J. Chem. Theory Comput.8, 17861794. 10.1021/ct300032r

  • 22

    KingN. M.MelnickL.Prabu-JeyabalanM.NalivaikaE. A.YangS. S.GaoY.et al. (2002). Lack of synergy for inhibitors targeting a multi-drug-resistant HIV-1 protease. Protein Sci.11, 418429. 10.1110/ps.25502

  • 23

    KohY.AmanoM.TowataT.DanishM.Leshchenko-YashchukS.DasD.et al. (2010). In vitro selection of highly darunavir-resistant and replication-competent HIV-1 variants by using a mixture of clinical HIV-1 isolates resistant to multiple conventional protease inhibitors. J. Virol.84, 1196111969. 10.1128/JVI.00967-10

  • 24

    KohY.AokiM.DanishM. L.Aoki-OgataH.AmanoM.DasD.et al. (2011). Loss of protease dimerization inhibition activity of darunavir is associated with the acquisition of resistance to darunavir by HIV-1. J. Virol.85, 1007910089. 10.1128/JVI.05121-11

  • 25

    KohY.MatsumiS.DasD.AmanoM.DavisD. A.LiJ.et al. (2007). Potent inhibition of HIV-1 replication by novel non-peptidyl small molecule inhibitors of protease dimerization. J. Biol. Chem.282, 2870928720. 10.1074/jbc.M703938200

  • 26

    KohY.NakataH.MaedaK.OgataH.BilcerG.DevasamudramT.et al. (2003). Novel bis-tetrahydrofuranylurethane-containing nonpeptidic protease inhibitor (PI) UIC-94017 (TMC114) with potent activity against multi-PI-resistant human immunodeficiency virus in vitro. Antimicrob. Agents Chemother.47, 31233129. 10.1128/AAC.47.10.3123-3129.2003

  • 27

    KovalevskyA. Y.TieY.LiuF.BorossP. I.WangY. F.LeshchenkoS.et al. (2006). Effectiveness of nonpeptide clinical inhibitor TMC-114 on HIV-1 protease with highly drug resistant mutations D30N, I50V, and L90M. J. Med. Chem.49, 13791387. 10.1021/jm050943c

  • 28

    KrohnA.RedshawS.RitchieJ. C.GravesB. J.HatadaM. H. (1991). Novel binding mode of highly potent HIV-proteinase inhibitors incorporating the (R)-hydroxyethylamine isostere. J. Med. Chem.34, 33403342.

  • 29

    LamP. Y.JadhavP. K.EyermannC. J.HodgeC. N.RuY.BachelerL. T.et al. (1994). Rational design of potent, bioavailable, nonpeptide cyclic ureas as HIV protease inhibitors. Science263, 380384.

  • 30

    LiuF.BorossP. I.WangY. F.TozserJ.LouisJ. M.HarrisonR. W.et al. (2005). Kinetic, stability, and structural changes in high-resolution crystal structures of HIV-1 protease with drug-resistant mutations L24I, I50V, and G73S. J. Mol. Biol.354, 789800. 10.1016/j.jmb.2005.09.095

  • 31

    LiuF.KovalevskyA. Y.TieY.GhoshA. K.HarrisonR. W.WeberI. T. (2008). Effect of flap mutations on structure of HIV-1 protease and inhibition by saquinavir and darunavir. J. Mol. Biol.381, 102115. 10.1016/j.jmb.2008.05.062

  • 32

    MaguireM. F.GuineaR.GriffinP.MacManusS.ElstonR. C.WolframJ.et al. (2002). Changes in human immunodeficiency virus type 1 Gag at positions L449 and P453 are linked to I50V protease mutants in vivo and cause reduction of sensitivity to amprenavir and improved viral fitness in vitro. J. Virol.76, 73987406. 10.1128/JVI.76.15.7398-7406.2002

  • 33

    MartinP.VickreyJ. F.ProteasaG.JimenezY. L.WawrzakZ.WintersM. A.et al. (2005). “Wide-open” 1.3 A structure of a multidrug-resistant HIV-1 protease as a drug target. Structure13, 18871895. 10.1016/j.str.2005.11.005

  • 34

    MittalS.BandaranayakeR. M.KingN. M.Prabu-JeyabalanM.NalamM. N.NalivaikaE. A.et al. (2013). Structural and thermodynamic basis of amprenavir/darunavir and atazanavir resistance in HIV-1 protease with mutations at residue 50. J. Virol.87, 41764184. 10.1128/JVI.03486-12

  • 35

    MurshudovG. N.VaginA. A.DodsonE. J. (1997). Refinement of macromolecular structures by the maximum-likelihood method. Acta Crystallogr. D Biol. Crystallogr.53, 240255. 10.1107/S0907444996012255

  • 36

    OdeH.MatsuyamaS.HataM.HoshinoT.KakizawaJ.SugiuraW. (2007a). Mechanism of drug resistance due to N88S in CRF01_AE HIV-1 protease, analyzed by molecular dynamics simulations. J. Med. Chem.50, 17681777. 10.1021/jm061158i

  • 37

    OdeH.MatsuyamaS.HataM.NeyaS.KakizawaJ.SugiuraW.et al. (2007b). Computational characterization of structural role of the non-active site mutation M36I of human immunodeficiency virus type 1 protease. J. Mol. Biol.370, 598607. 10.1016/j.jmb.2007.04.081

  • 38

    OtwinowskiZ.MinorW. (1997). Processing of X-Ray diffraction data collected in oscillation mode. Meth. Enzymol. 276, 307326.

  • 39

    PazhanisamyS.StuverC. M.CullinanA. B.MargolinN.RaoB. G.LivingstonD. J. (1996). Kinetic characterization of human immunodeficiency virus type-1 protease-resistant variants. J. Biol. Chem.271, 1797917985.

  • 40

    PerrymanA. L.LinJ. H.McCammonJ. A. (2004). HIV-1 protease molecular dynamics of a wild-type and of the V82F/I84V mutant: possible contributions to drug resistance and a potential new target site for drugs. Protein Sci.13, 11081123. 10.1110/ps.03468904

  • 41

    Prabu-JeyabalanM.NalivaikaE.SchifferC. A. (2002). Substrate shape determines specificity of recognition for HIV-1 protease: analysis of crystal structures of six substrate complexes. Structure10, 369381. 10.1016/S0969-2126(02)00720-7

  • 42

    PradoJ. G.WrinT.BeauchaineJ.RuizL.PetropoulosC. J.FrostS. D.et al. (2002). Amprenavir-resistant HIV-1 exhibits lopinavir cross-resistance and reduced replication capacity. AIDS16, 10091017. 10.1097/00002030-200205030-00007

  • 43

    RheeS. Y.TaylorJ.FesselW. J.KaufmanD.TownerW.TroiaP.et al. (2010). HIV-1 protease mutations and protease inhibitor cross-resistance. Antimicrob. Agents Chemother.54, 42534261. 10.1128/AAC.00574-10

  • 44

    SaskovaK. G.KozisekM.RezacovaP.BryndaJ.YashinaT.KaganR. M.et al. (2009). Molecular characterization of clinical isolates of human immunodeficiency virus resistant to the protease inhibitor darunavir. J. Virol.83, 88108818. 10.1128/JVI.00451-09

  • 45

    SchapiroJ. M.SchererJ.BoucherC. A.BaxterJ. D.TilkeC.PernoC. F.et al. (2010). Improving the prediction of virological response to tipranavir: the development and validation of a tipranavir-weighted mutation score. Antivir. Ther.15, 10111019. 10.3851/IMP1670

  • 46

    ShibataJ.SugiuraW.OdeH.IwataniY.SatoH.TsangH.et al. (2011). Within-host co-evolution of Gag P453L and protease D30N/N88D demonstrates virological advantage in a highly protease inhibitor-exposed HIV-1 case. Antiviral Res.90, 3341. 10.1016/j.antiviral.2011.02.004

  • 47

    SpinelliS.LiuQ. Z.AlzariP. M.HirelP. H.PoljakR. J. (1991). The three-dimensional structure of the aspartyl protease from the HIV-1 isolate BRU. Biochimie73, 13911396.

  • 48

    SurlerauxD. L.TahriA.VerschuerenW. G.PilleG. M.de KockH. A.JonckersT. H.et al. (2005). Discovery and selection of TMC114, a next generation HIV-1 protease inhibitor. J. Med. Chem.48, 18131822. 10.1021/jm049560p

  • 49

    ThaisrivongsS.SkulnickH. I.TurnerS. R.StrohbachJ. W.TommasiR. A.JohnsonP. D.et al. (1996). Structure-based design of HIV protease inhibitors: sulfonamide-containing 5,6-dihydro-4-hydroxy-2-pyrones as non-peptidic inhibitors. J. Med. Chem.39, 43494353. 10.1021/jm960541s

  • 50

    TremblayC. L. (2008). Combating HIV resistance–focus on darunavir. Ther. Clin. Risk Manag.4, 759766.

  • 51

    VarginA.TeplyakovA. (1997). MOLREP: an automated program for molecular replacement. J. Appl. Crystallogr.30, 10221025.

  • 52

    WangJ.WolfR. M.CaldwellJ. W.KollmanP. A.CaseD. A. (2004). Development and testing of a general amber force field. J. Comput. Chem.25, 11571174. 10.1002/jcc.20035

  • 53

    WensingA. M.CalvezV.GunthardH. F.JohnsonV. A.ParedesR.PillayD.et al. (2014). 2014 Update of the drug resistance mutations in HIV-1. Top. Antivir. Med.22, 642650.

  • 54

    WinnM. D.BallardC. C.CowtanK. D.DodsonE. J.EmsleyP.EvansP. R.et al. (2011). Overview of the CCP4 suite and current developments. Acta Crystallogr. D Biol. Crystallogr.67, 235242. 10.1107/S0907444910045749

  • 55

    ZhangY.ChangY. C.LouisJ. M.WangY. F.HarrisonR. W.WeberI. T. (2014). Structures of darunavir-resistant HIV-1 protease mutant reveal atypical binding of darunavir to wide open flaps. ACS Chem. Biol.9, 13511358. 10.1021/cb4008875

Summary

Keywords

Darunavir, HIV-1 protease, drug resistance, crystal structure, flap, I50V, protease inhibitor, molecular dynamics simulation

Citation

Nakashima M, Ode H, Suzuki K, Fujino M, Maejima M, Kimura Y, Masaoka T, Hattori J, Matsuda M, Hachiya A, Yokomaku Y, Suzuki A, Watanabe N, Sugiura W and Iwatani Y (2016) Unique Flap Conformation in an HIV-1 Protease with High-Level Darunavir Resistance. Front. Microbiol. 7:61. doi: 10.3389/fmicb.2016.00061

Received

14 December 2015

Accepted

14 January 2016

Published

03 February 2016

Volume

7 - 2016

Edited by

Akio Adachi, University of Tokushima Graduate School of Medicine, Japan

Reviewed by

Youichi Suzuki, Osaka Medical College, Japan; Yasuko Tsunetsugu Yokota, National Institute of Infectious Diseases, Japan

Updates

Copyright

*Correspondence: Yasumasa Iwatani

†Present Address: Wataru Sugiura, GlaxoSmithKline, Tokyo, Japan

This article was submitted to Virology, a section of the journal Frontiers in Microbiology

‡These authors have contributed equally to this work.

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics