Abstract
Campylobacter jejuni is the most frequent cause of human food-borne gastroenteritis and chicken meat is the main source of infection. Recent studies showed that broiler chicken immunization against Campylobacter should be the most efficient way to lower the number of human infections by this pathogen. Induction of the mucosal immune system after oral antigen administration should provide protective immunity to chickens. In this work we tested the usefulness of Lactococcus lactis, the most extensively studied lactic acid bacterium, as a delivery vector for Campylobacter antigens. First we constructed hybrid protein â CjaA antigen presenting CjaD peptide epitopes on its surface. We showed that specific rabbit anti-rCjaAD serum reacted strongly with both CjaA and CjaD produced by a wild type C. jejuni strain. Next, rCjaAD and CjaA were fused to the C-terminus of the L. lactis YndF containing the LPTXG motif. The genes expressing these proteins were transcribed under control of the L. lactis Usp45 promoter and their products contain the Usp45 signal sequences. This strategy ensures a cell surface location of both analyzed proteins, which was confirmed by immunofluorescence assay. In order to evaluate the impact of antigen location on vaccine prototype efficacy, a L. lactis strain producing cytoplasm-located rCjaAD was also generated. Animal experiments showed a decrease of Campylobacter cecal load in vaccinated birds as compared with the control group and showed that the L. lactis harboring the surface-exposed rCjaAD antigen afforded greater protection than the L. lactis producing cytoplasm-located rCjaAD. To the best of our knowledge, this is the first attempt to employ Lactic Acid Bacteria (LAB) strains as a mucosal delivery vehicle for chicken immunization. Although the observed reduction of chicken colonization by Campylobacter resulting from vaccination was rather moderate, the experiments showed that LAB strains can be considered as an alternative vector to deliver heterologous antigens to the bird immune system. Additionally, the analysis of the structure and immunogenicity of the generated rCjaAD hybrid protein showed that the CjaA antigen can be considered as a starting point to construct multiepitope anti-Campylobacter vaccines.
Introduction
Campylobacter sp., members of Epsilonproteobacteria, are intestinal inhabitants of a various animal and avian species and, at the same time, are a major cause of human bacterial food-borne gastroenteritis; each year they are responsible for several 100 million cases of infection worldwide. The number of reported confirmed cases of human campylobacteriosis varies between countries and ranges between ten to more than 100 per 100,000 population (Kaakoush et al., 2015). In the EU in 2013, 214,779 cases were recorded (EFSA and ECDC, 2015). The number of Campylobacter genus species is growing constantly. Among at least 34 (http://www.bacterio.net/campylobacter.html\%20consulted\%20on\%2001/2016) species of the Campylobacter genus which have been described so far, the most prevalent species isolated from clinical cases of human campylobacteriosis are C. jejuni and C. coli (Robyn et al., 2015). Whereas in developing countries, the disease is endemic and affects mainly children, in industrialized countries most cases of the disease are mainly sporadic and are caused by the consumption of pathogen-contaminated, improperly prepared broiler meat. The gastrointestinal tract of infected broiler chickens contains a very high load of C.jejuni (Silva et al., 2011; Hermans et al., 2012; Powell et al., 2012). So, taking into consideration the broad consumption of poultry meat products, it has been established that the chicken reservoir is the main source of human campylobacteriosis. It was calculated that decreasing the count of Campylobacter in chicken intestines by 2 log10-units would lower the number of human campylobacteriosis cases 30-fold, and that a reduction by 3 log units should diminish the public health risk by at least 90% (EFSA Panel on Biological Hazards (BIOHAZ), 2011; Rosenquist et al., 2013).
Reduction of chicken colonization by Campylobacter can be achieved by vaccination, but an effective chicken vaccine against Campylobacter is still lacking. To date, many Campylobacter immunogenic proteins have been identified and tested as protective antigens in chicken animal models using various delivery vehicles and immunization strategies, but only with partial success. The induction of immune responses (specific intestinal IgA and serum IgG) was documented as a result of immunizations, but the generated reductions of chicken intestinal track colonization by C. jejuni were not satisfactory (WyszyĆska et al., 2004; Buckley et al., 2010; Layton et al., 2011; Clark et al., 2012; Neal-McKinney et al., 2012; Theoret et al., 2012) also reviewed in references (de Zoete et al., 2007; Jagusztyn-Krynicka et al., 2009).
The current knowledge indicates that an effective chicken vaccine should induce both a strong and rapid immune response, due to the short life span of broiler chickens. For a short time after hatching, the chicks are protected against Campylobacter infection by a high level of maternal antibodies. The mechanism of this protection is not completely clear (Sahin et al., 2001; Sahin et al., 2003; Cawthraw and Newell, 2010). Therefore, birds should be immunized during the first week of life, when the avian immune system is immature. Given this aspect of immunization, we have to deepen our knowledge about Campylobacter factors involved in chicken colonization, as well as the pathogenâs interaction with the birdâs immune system (Hermans et al., 2011a). Additionally, with the advances in sequencing technologies, it becomes obvious that the development of a universal effective chicken vaccine against Campylobacter is hampered by the Campylobacter genome plasticity and antigenic complexity (Friis et al., 2010; Jeon et al., 2010; Gilbreath et al., 2011; Meric et al., 2014). The genetic diversity among Campylobacter strains finds reflection in chicken infection biology (Chaloner et al., 2014). Additionally, epidemiological studies indicate that there are multiple Campylobacter strains present in broiler flocks at the same time (Newell et al., 2010). So, it is generally thought that only multicomponent subunit vaccines, or using various preparations for the primary vaccination and for the booster, will satisfy immunization requirements.
Recently, the three-dimensional (3D) structures of many antigens have been resolved using mainly two technologies: nuclear magnetic resonance (NMR) spectroscopy and X-ray crystallography, which in combination with bioinformatics strategies allow mapping of the antigen epitopes and can initiate the development of structural vaccinology. This strategy should overcome several limitations in the development of vaccines to protect against pathogens with genetic diversity or antigenic hypervariability (Delany et al., 2014). The first vaccine generated by employing technologies of reverse and structural vaccinology is the 4CMenB multicomponent vaccine against serogroup Neisseria meningitidis approved in 2013 by the European Medicine Agency (Serruto et al., 2012).
In this study, we designed and constructed a hybrid CjaA antigen, named the rCjaAD protein, that displays three CjaD peptide epitopes on its surface. Next, the gene encoding rCjaAD was cloned into a L. lactis strain in a way that ensured the location of its product to the cell surface. The constructed strain was used for chicken immunization to evaluate the induced immune response and the protective effect of immunization.
Materials and Methods
Bacterial Strains, Primers, Plasmids, Media and Growth Conditions
Bacterial strains, plasmids and primers used in this study are listed in Tables 1 and 2. The L. lactis IL1403 strain used in this study was routinely cultured at 30°C in M17 broth (Oxoid) containing 0.5% (wt/vol) glucose (GM17). When needed, media were supplemented with 5 ÎŒg ml-1 erythromycin. The Escherichia coli strain TG1 was used as a host for the construction of recombinant plasmids. The E. coli strain Rosetta (DE3) pLysS was used to overproduce rCjaAD (pUWM1379). E. coli strains were grown under standard conditions unless otherwise indicated. When needed, media were supplemented with antibiotics at the following concentrations: 30 ÎŒg ml-1 kanamycin, 250 ÎŒg ml-1 erythromycin, or 20 ÎŒg ml-1 chloramphenicol. C. jejuni strain 81â176 was the source of the cjaA (cjj81176_1001, cj0982c) gene. C. jejuni 12/2 strain employed in the protection experiment was a broiler-isolated strain labeled with the pUOA18 plasmid containing a cat gene. Previous experiments have shown that the pUOA18 plasmid is stably maintained in Campylobacter (WyszyĆska et al., 2004). C. jejuni strains were routinely grown at 37°C or 42°C for 16â24 h under microaerobic conditions (5% O2, 10% CO2, 85% N2) on Blood Agar Base No. 2 (BA, Merck, Darmstadt, Germany) plates supplemented with 5% horse blood and âCampylobacter Selective Supplement (Blaser-Wang)â (Oxoid, Basingstoke, UK). The medium was supplemented with chloramphenicol (15 ÎŒg ml-1), if necessary.
Table 1
| Strain or plasmid | Relevant phenotype(s) or genotype(s) | Source or reference |
|---|---|---|
| Strains | ||
| L. lactis subsp. lactis IL1403 | Plasmid-free strain | INRA (Chopin et al., 1984) |
| E. coli TG1 | supE thi-1 Î(lac-proAB) Î(mcrB-hsdSM)5 (rK- mK-) Fâ [traD36 proAB+ lacIq lacZ_M15] | Sambrook and Russell, 2001 |
| E. coli Rosetta pLysS (DE3) | F-ompT hsdSB(rB- mB-) gal dcm (DE3) pLysSRARE (CmR) | Novagen |
| C. jejuni 81176 | Wild type; isolated from a child with bloody diarrhea during an outbreak in Minnesota (USA); pVir, pTet (TcR); Lior 5; Penner 23/26 | Korlath et al., 1985 |
| C. jejuni 12/2 | Wild type; isolated from a chicken; good colonizer; pUOA18 (CmR) | WyszyĆska et al., 2004 |
| Plasmids | ||
| pGEM-T Easy | ApR; T vector for cloning PCR products | Promega |
| pET28a | KmR; lacI; overexpression vector | Novagen |
| pBluescript II SK+ | ApR; general cloning vector | Stratagene |
| pIL253 | EmR, lactococcal cloning vector | Simon and Chopin, 1988 |
| pUWM1000 | EmR, L. lactis /E. coli shuttle vector (pIL253 containing ori pBR322) | This study |
| pUWM1371 | rcjaAD in Bluescript II SK+ | This study |
| pUWM1379 | 6xhis-rcjaAD-6xhis fusion in pET28a | This study |
| pUWM1373 | Fragment encoding signal sequence of Usp45 (ssusp45) in pGEM-T easy | This study |
| pUWM1376 | Fragment encoding C-terminal CWA region of YndF (LPXTGY nd) in pGEM-T easy | This study |
| pUWM1381 | Fragment encoding signal sequence of Usp45 (ssusp45) and fragment encoding C-terminal CWA region of YndF (LPXTGY nd) in pBluescript II SK | This study |
| pUWM1384 | ssusp45_cjaA_LPXTGY ndF in pBluescript II SK | This study |
| pUWM1392 | ssusp45_rcjaAD_LPXTGY ndF in pUWM1000 | This study |
| pUWM1395 | ssusp45_cjaA_LPXTGY ndF in pUWM1000 | This study |
| pUWM1412 | rcjaAD in pUWM1000 | This study |
Bacterial strains and plasmids used in this study.
Table 2
| Name of primer | Sequenceâ | Restriction recognition sites |
|---|---|---|
| UspAx | agaggtaccgaattcTGTTTACCAGCTAGCGCCTA | KpnI, EcoRI |
| UspBx | atggcgcatgccgggcccaaTGAATTTGTGTCAGCGTAGA | Sph, ApaI |
| UspCx | AACGCGTTGCTCGAGACAGATCTAGTCGACCGATATCGGATCCCGCGGCCGCCATGGCGCATGCCGGGCCCAA | MluI, XhoI, BglII, SalI, EcoRV, BamHI, SacII, NcoI, SphI, ApaI |
| UspDx | TATATCGATAACGCGTTGCTCGAGACAGA | ClaI |
| YhgE_ClaI_LPXTG | taatcgataGGCTTGAACTTGGTTGATAA | ClaI |
| YhgE_XbaI | agttctagagaattccaGCCATCATCCCCTCCTAA | XbaI, EcoRI |
| YndF_ClaI_LPXTG | ttaatcgaTTGGTAATGCCTCTGGCCAAT | ClaI |
| YndF_XbaI_LPXTG | agttctagagaaTTCCACAACCATTGCCCCTCCTTT | XbaI, EcoRI |
| 1001_Xho_LPXTG | acctcgagtcAATTTTTCCACCTTCAATCAC | XhoI |
| 1001_Bam_LPXTG | acaggatccGGAGGAAATTCTGACTC | BamHI |
| R_CjaAD_inF | agatccccgggaattcttaAATTTTTCCACCTTCAATCAC | EcoRI |
| F_CjaAD_inF | tgattaaatagaattcAGGAATTGTATGGGAGGAAATTCTGACGAAG | EcoRI |
Oligonucleotides used in this study.
âBold letters indicate C. jejuni or L. lactis nucleotide sequences, and the restriction recognition sites introduced for cloning purposes are underlined. Complementary fragments of primers UspBx + UspCx and UspCx + UspDx are marked with italics. Primers were based on the C. jejuni 81176 or L. lactis IL1403 nucleotide sequences.
DNA Manipulations
General DNA Manipulations
Standard DNA manipulations were carried out as described earlier by Sambrook and Russell (2001) or according to the manufacturerâs instructions (A&A Biotechnology, Poland). Chromosomal DNAs of C. jejuni 81â176 and L. lactis used for PCR reactions were isolated using a commercial kit and protocol (A&A Biotechnology, Poland). Polymerase chain reactions (PCRs) were performed with PrimeStar HS DNA Polymerase (TaKaRa) or HotStar HiFidelity Polymerase (Qiagen) under standard conditions. Synthetic oligonucleotide synthesis and DNA sequencing for cloning experiments were performed by Genomed S.A., Warsaw.
Construction of Recombinant Plasmids for Recombinant Protein Overexpression
A DNA fragment encoding rCjaAD was synthesized by Genecust and cloned into pBluescript II SK+ digested with PstI and XhoI, generating plasmid pUWM1371. Thereafter, to prepare the rCjaAD overexpression vector, plasmid pUWM1371 was digested with NheI and XhoI restriction enzymes and a 0.9 kb DNA fragment was inserted into pET28a, generating plasmid pUWM1379. Correct construction of the recombinant plasmid was verified by sequencing. Protein production was confirmed by Western blot, using previously obtained rabbit polyclonal anti-CjaD and anti-CjaA sera, and antiâ6His serum (Pawelec et al., 2000; Ćaniewski et al., 2012). RCjaAD has a 6His tag fused to both the N- and C-termini to allow purification by affinity chromatography.
The construction of the CjaA expression vector (pUWM1146) and CjaD expression vector (pUWM1292) was described previously (Ćaniewski et al., 2014; Kobierecka et al., 2015).
Construction of the Shuttle Vector pUWM1000
The previously described L. lactis plasmid pIL253, based on the pAMÎČ1 replicon, does not replicate autonomously in E. coli (Simon and Chopin, 1988). To circumvent this problem, pIL253 was equipped with an ori pBR replicon. A 1.1 kb XbaI-BglII DNA fragment carrying the pBR origin of replication was ligated to pIL253 digested with XbaI and BamHI. The resulting shuttle vector pUWM1000 replicates in both E. coli and L. lactis.
Construction of the Vectors Carrying the Fusion of the Campylobacter Genes to the DNA Fragment Encoding the Cell Wall Anchor Region of L. lactis YndF
The primers UspAx and UspBx were used to amplify the DNA region encoding the signal sequence of Usp45 (amino acids 1â30) from the chromosome of L. lactis IL1403 [PrimeStar HS DNA Polymerase (TaKaRa)]. This region of DNA includes also promoter of the usp45 gene. The UspBx primer contains a 5âČ nucleotide sequence complementary to UspCx primer. PCR product that was purified using a Gel-Out extraction kit (A&A Biotechnology) and the UspCx primer (in equal amounts) was used as a template in a single PCR reaction, using the primers UspAx and UspDx [HiFidelity Polymerase (Qiagen)]. The resulting PCR product was purified and cloned into pGEM-T Easy to generate pUWM1373 (the scheme of pUWM1373 construction is given in Supplementary Figure S1). Construction of this recombinant plasmid via a 2-step PCR method allowed the introduction specific restriction enzyme recognition sites, which were useful in cloning procedures.
In order to prepare the translational fusion of C. jejuni gene with 3âČend of L. lactis yndF gene, several steps of genetic manipulation were undertaken. First, the nucleotide sequence encoding the C-terminal CWA region of yndF was PCR amplified from the chromosome of L. lactis IL1403 with primers YndF_XbaI_LPXTG and YndF_ClaI_LPXTG. The 0.4 kb amplicon was cloned into pGEM-T Easy to generate plasmid pUWM1376. Next, the KpnI-ClaI DNA fragment of pUWM1373, the XbaI-ClaI DNA fragment of pUWM1376 and pBluescript II SK digested with XbaI and KpnI were ligated. The resulting plasmid, designated pUWM1381, contains DNA fragments encoding the signal sequence of the usp45 gene and a DNA fragment encoding the C-terminal CWA region of YndF in the same transcriptional orientation.
Subsequently, pUWM1381 was used to create the translational fusions of cjaA or rcjaAD genes with a signal sequence of usp45 and a nucleotide sequence encoding the C-terminal CWA region of the yndF gene. Briefly, C. jejuni DNA fragments of 777 bp encoding the cjaA gene that lacks its own signal sequence were PCR-amplified using the primer pair 1001_Bam_LPXTG and 1001_Xho_LPXTG from chromosomal DNA. Next, that fragment was cloned into the pUWM1381 recombinant plasmid using BamHI-XhoI restriction enzymes, to generate the pUWM1384. Construction of a pUWM1382 plasmid containing the translational fusion of the rcjaAD gene with a nucleotide sequence encoding the C-terminal CWA region of YndF was generated by cloning the 0.94 bp XhoI-SphI DNA fragment of pUWM1371 into pUWM1381 linearized with the same restriction enzymes.
Next, the EcoRI-EcoRI fragments containing translational fusions of cjaA or rcjaAD genes with a nucleotide sequence encoding the C-terminal CWA region of YndF were transferred into the pUWM1000 E. coli/L. lactis shuttle vector, generating pUWM1395 and pUWM1392, respectively. Correct construction of the resulting plasmids was confirmed by restriction analysis and sequencing.
Construction of the Vector Encoding Campylobacter Antigens of Cytoplasmic Location
In-FusionÂź HD Cloning technology was employed to generate pUWM1412, the recombinant plasmid containing the rcjaAD gene. The nucleotide sequence encoding the rcjaAD gene that lacks its own signal sequence was PCR amplified from the pUWM1371 with primers R_CjaAD_inF and F_CjaAD_inF. The primers used added 15 bp nucleotide sequences to each end of the PCR amplicon that are complementary to the two ends of an EcoRI linearized pUWM1000 vector. The cloning procedure was carried out according to the manufacturerâs instruction (Clonetech). Correct construction of the resulting plasmid was confirmed by restriction analysis and sequencing.
Transformation of E. coli and Lactococcus lactis
Recombinant plasmids pUWM1392, pUWM1395 and pUWM1412 were introduced into L. lactis IL1403 cells by electroporation as described by Landete et al. (2014). To prepare the competent Lactococcus strains, an overnight culture was inoculated 1:50 in GM17 containing 1% glycine and 0.5 M sucrose and incubated at 30°C until an OD600 of 0.6 was reached. Bacteria were collected (10,000 g, 10 min, 4°C) and the pellet was washed three times in a washing solution [5 mM KH2PO4, 2 mM MgCl2, 10% glycerol (v/v)] containing 0.5 M sucrose. Bacteria were resuspended 1:100 in the same solution and a volume of 40 ΌL was electroporated immediately or kept at -70°C for further use. L. lactis competent cells were electroporated at 2.5 kV, 200 Ω and 25 ΌF in 0.4 cm cuvettes using a BioRad GenePulser (BioRad, Life Science Research Products, Hercules, CA, USA). After electroporation, Lactococcus cells were resuspended in GM17 broth containing 0.5 M sucrose, 20 mM MgCl2 and 2 mM CaCl2 and incubated at 30°C for 2 h. Following the incubation, bacteria were plated on M17 containing 0.5 M sucrose supplemented with erythromycin (5 Όg ml-1). The plates were incubated at 30°C for 2 days.
Escherichia coli was transformed as previously described (Hanahan, 1983).
Recombinant Protein and Polyclonal Antibody Production
Overexpression and Purification of CjaA, CjaD and rCjaAD
rCjaAD was overexpressed and purified from E. coli Rosetta (DE3) pLysS harboring pUWM1379 by autoinduction, as described by Studier (2005). After 24 h growth, the bacterial culture was centrifuged and the cell pellet was suspended in 50 mM sodium phosphate, 300 mM NaCl, 10 mM imidazole, pH 8.0. Cells were disrupted by sonication. Subsequently, the cell lysate was centrifuged and the resulting supernatant was applied onto a HisTrap column (NGC Chromatography system BioRad). The protein was eluted with an imidazole gradient. Fractions containing rCjaAD were pooled and extensively dialyzed against phosphate buffered saline (PBS) and used for rabbit immunization. Rabbit immunization was carried out according to the ethical standards and with the approval (5666/2014) of the Local Ethics Committee No. 1, Warsaw, Poland.
The anti-rCjaAD rabbit serum was specific and recognized rCjaAD, as verified by Western blot analysis. Overexpression and all purification steps were monitored by SDS-PAGE. Overexpression and purification of CjaA and CjaD were performed using identical method as described previously (Ćaniewski et al., 2012; Kobierecka et al., 2015).
SDS-PAGE and Western Blotting
SDS-PAGE and Western blotting procedures were done by standard techniques. Blots were developed with nitro blue tetrazolium chloride/5-bromo-4-chloro-3-indolyl phosphate (SigmaâAldrich) as a substrate, using previously obtained rabbit polyclonal anti-CjaA, anti-CjaD (Pawelec et al., 2000; Ćaniewski et al., 2012), or anti-rCjaAD (this work) sera or anti-His antibodies (SigmaâAldrich) as primary antibodies, and mouse anti-rabbit IgG alkaline phosphatase conjugate (SigmaâAldrich) or goat anti-mouse IgG alkaline phosphatase conjugate as secondary antibodies.
Cellular Localization of the Hybrid Proteins â Immunofluorescence Assay
For the immunofluorescence assay, L. lactis IL1403 cells carrying plasmids encoding CjaA or rCjaAD localized in different areas of the bacteria were used. The immunofluorescence assays were carried out as previously reported (Kobierecka et al., 2015).
Rabbit polyclonal anti-CjaA (Pawelec et al., 2000; Ćaniewski et al., 2012) or anti-rCjaAD (this work) sera were used as primary antibodies and goat anti-rabbit IgG Alexa Fluor A488 as secondary antibodies. Fluorescence was visualized with a NIKON A1R MP microscope (University of Warsaw).
Assessment of the Immune Responses and Chicken Protection
Growth of Carrier Strain (Lactococcus lactis IL1403 Containing C. jejuni rcjaAD or cjaA genes) for Chicken Immunization
To prepare bacterial suspensions for chicken immunization, an overnight culture of bacteria was diluted 1:50 in fresh pre-warmed GM17 broth and grown at 30°C to an optical density A600 = âŒ0.4. The cells were sedimented by centrifugation at 8000 Ă g for 10 min at 4°C, and then suspended in buffered saline with 0.1% gelatin (BSG) to an optical density A600 = âŒ1 (âŒ1 Ă 109 CFU/ml). CFUs were determined by plating serial dilutions of culture on GM17 agar plates supplemented with 5 ÎŒg ml-1 erythromycin.
Immunization and Challenge Regimen
Hy-line chickens were obtained on the day of hatch from a local hatchery. Birds were randomly assigned to experimental groups and housed in an animal facility in separate cages for each group and given water and feed ad libitum. Chickens were confirmed to be culture-negative for Campylobacter by cloacal swabbing. All animal experiments were carried out according to the ethical standards and with the approval (699/2015) of the Local Ethics Committee No. 1, Warsaw, Poland.
Chickens deprived of food and water for 4 h were orally inoculated with 100 ÎŒl of 109 CFU/ml of L. lactis carrying pUWM1392 (SPusp45_rCjaAD_CWAY ndF), pUWM1395 (SPusp45_CjaA_CWAY ndF) or pUWM1412 (rCjaAD of cytoplasmic location). Booster doses were administrated 8 and 17 days after primary immunization. Following vaccination, chickens were observed for development of diarrhea and other potential adverse side effects. A group of birds inoculated with BSG and L. lactis IL1403 were used as a controls. At the 22nd day of life, birds were orally challenged with âŒ104 CFU of C. jejuni wild-type strain 12/2. At 5 and 9 days post challenge, five birds from each group were euthanized and samples of cecum were collected. Dilutions of the contents were made in PBS and plated onto BA plates supplemented with 5% horse blood, âCampylobacter Selective Supplement (Blaser-Wang)â and chloramphenicol (15 ÎŒg ml-1) for enumeration of C. jejuni. Plates were incubated at 37°C for 48 h. Plates that were culture-negative at 48 h were reincubated for an additional 48 h. This procedure permits detection of 103 CFU/g of cecal contents.
To monitor the humoral immune response, three birds from each group were sacrificed on days 7, 14, 21, 27, and 31 post-hatch and samples of serum and gut secretion were collected for the post-mortem examination. On day 1 post hatch, the same number of unvaccinated birds were also euthanized. Blood samples were taken after decapitation. Following centrifugation, sera were collected and stored at -20°C. Samples of gut secretions were collected by intestinal lavage. Secretory IgA antibodies were extracted from lower parts of the intestine with PBS containing 0.05% Tween 20 and soybean trypsin inhibitor (0.1 mg ml-1) (dilution 1:10). Samples were shaken for 2 h at 4°C, centrifuged at 20,000 à g for 30 min at 4°C, and afterward the supernatant was collected and stored at -20°C.
Enzyme-Linked Immunosorbent Assay (ELISA)
Antigen Preparation
The 6xHis-tagged rCjaAD protein purified as described above was also used as a coating antigen.
ELISA Assay
The level of the antibodies against rCjaAD protein in chicken intestinal secretions and blood sera was quantified by ELISA. Briefly, 96-well Maxisorp plates (Nunc, Rochester, NY, USA) were coated with either the purified rCjaAD protein (5 ÎŒg per well) or Campylobacter membrane proteins (30 ÎŒg per well) in PBS and incubated overnight at 4°C. Then, plates were blocked for 1 h at 37°C with PBS containing 0.1% Tween 20 (SigmaâAldrich) and 1% BSA (bovine serum albumin), washed three times with PBS containing 0.1% Tween 20 (SigmaâAldrich) and incubated for 1 h at room temperature with the diluted sera (1:256) or intestinal secretion samples (1:10). Goat anti-chicken IgA horseradish peroxidase conjugate (Thermo Fisher, Scientific) was employed to detect chicken IgA that bound to Campylobacter antigens. The plates were developed with 3,3âČ,5,5âČ-tetramethylbenzidine (SigmaâAldrich), according to the manufacturerâs directions. The reaction was stopped with 3M H2SO4 and optical density was determined at A 490 using an ELISA reader (Tekan). The level of specific serum IgG was measured using rabbit anti-chicken IgY (whole molecule) alkaline phosphatase conjugate (SigmaâAldrich). The reaction was run with p-nitrophenyl phosphate (1 mg ml-1) as substrate and was stopped after 30 min incubation (room temperature) with 3N sodium hydroxide. Optical density was determined at 405 nm using an ELISA reader (Tekan). Each sample was analyzed in triplicate.
Bioinformatics Analyses
Protein Structure Prediction
Secondary structure prediction and tertiary fold-recognition (FR) were carried out via the GeneSilico metaserver gateway (Kurowski and Bujnicki, 2003). Solvent accessibility for the individual residues was predicted with SABLE (Adamczak et al., 2005), ACCPRO2 (Cheng et al., 2005a), and JNET (Cuff and Barton, 2000). Disordered residues were predicted from consensus of results generated with disprot (Dunker et al., 2002), DISpro (Cheng et al., 2005b), DisEMBL (Linding et al., 2003), RONN (Yang et al., 2005), and disopred (Ward et al., 2004) methods. Secondary structure was predicted using a consensus of PSIPRED (Jones, 1999b), PROFsec (Rost et al., 2004), PROF (Ouali and King, 2000), SABLE (Adamczak et al., 2005), JNET (Cuff and Barton, 2000), JUFO (Meiler and Baker, 2003), PORTER (Pollastri and McLysaght, 2005), SSPRO2 (Cheng et al., 2005a), and SAM-T02 (Karplus et al., 2003). In all these cases results generated by independent methods were compared and a consensus result was retrieved as a most probable solution. The FR analysis (attempt to match the query sequence to known protein structures) was carried out using PDBBLAST, HHSEARCH (Soding, 2005), FFAS03 (Jaroszewski et al., 2005), FORTE (Tomii and Akiyama, 2004), SAM-T02 (Karplus et al., 2003), 3DPSSM (Kelley et al., 2000), INBGU (Fischer, 2000), FUGUE (Shi et al., 2001), mGENTHREADER (Jones, 1999a), and SPARKS (Zhou and Zhou, 2004). Target-template alignments reported by these methods were compared, evaluated, and ranked by the PCONS server (Lundstrom et al., 2001) to identify the preferred modeling templates and the consensus alignment. The alignments between the amino acid sequences of CjaA and CjaD and the structures of the best templates identified by FR were used to carry out homology modeling using Modeler (Sali and Blundell, 1993). For the evaluation of models, a MetaMQAP method was used. (Pawlowski et al., 2008), which allows predicting the deviation of individual amino acid residues in the model from their counterparts in the native structure.
Prediction of Epitopes
Epitopes were predicted from sequence using the following methods: Chou and Fasman Beta-Turn Prediction (Chou and Fasman, 1978), Emini Surface Accessibility Prediction (Emini et al., 1985), Karplus and Schulz Flexibility Prediction (Karplus and Schulz, 1985), Kolaskar and Tongaonkar Antigenicity (Kolaskar and Tongaonkar, 1990), Parker Hydrophilicity Prediction (Parker et al., 1986), and Bepipred Linear Epitope Prediction (Larsen et al., 2006). All results were compared and consensus predictions were mapped on homology models of CjaA and CjaD proteins. We considered consensus fragments that were located in loops exposed to the solvent to be the most probable epitopes.
Statistical Analyses
Statistical analyses of colonization results were performed using GraphPad Prism 6 (GraphPad Software, Inc., San Diego, CA, USA). The significance of differences between the obtained values was appraised using one-way analysis of variance (ANOVA) followed by the post hoc Tukey test. Statistical analyses of ELISA test were assessed using the KruskalâWallis test followed by Dunnâs multiple-comparison post hoc test. Statistical analyses were performed using STATISTICA 10PL software (StatSoft, USA). Any p-values <0.05 were considered significant.
Results
Protein Structure Prediction
CjaA
As a starting point for a structural model of CjaA, a protein FR analysis of the CjaA amino acid sequence was performed. FR methods attempt to identify the most appropriate modeling templates for a query sequence and return a set of alternative alignments to proteins of known structure. Most FR methods available in the MetaServer consistently reported the structure of the crystal structure of the cysteine-binding protein from C. jejuni (PDB code: 1xt8) as the potentially best template for modeling the CjaA protein (top matches to 1xt8, with all methods). However, the FR analyses showed no statistically significant similarity to any structurally characterized template for the N terminal part of CjaA (residues 1â25). A model of the central domain (starting from residue 26) was constructed using the âFRankensteinâs Monsterâ protocol (Kosinski et al., 2005), and as expected from comparative modeling, the CjaA revealed features of its templates. The prediction of the quality of the final model yields good scores with MQAP methods. The program MetaMQAP predicted that the whole model exhibits a root mean square deviation from the true structure on the order of 5.2 Ă , and a predicted GDT_TS score of 41.667. These results suggest that our model of CjaA is sufficiently reliable as a framework to interpret sequenceâstructure-function relationships in the CjaA, such as analysis of putative epitopes.
CjaD
As a starting point for a structural model of CjaD, a protein FR analysis of the CjaD amino acid sequence was performed. Most FR methods available in the MetaServer reported two structures: the crystal structure of TolB/Pal complex and the solution structure of peptidoglycan associated lipoprotein from Haemophilus influenzae bound to UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimeloyl-D-alanyl-D-alanine (PDB codes: 2hqs and 2aiz) as the potentially best templates for modeling of the CjaD protein. However, the residues 1â50 were identified as intrinsically disordered by all methods available in the Metaserver. A model of the central domain (starting from residue 50) was constructed using the âFRankensteinâs Monsterâ protocol (Kosinski et al., 2005) based on two template structures. The prediction of the quality of the final model yields good scores with MQAP methods. The program MetaMQAP predicted that the whole model exhibits a root mean square deviation from the true structure on the order of 6.7 Ă , and a predicted GDT_TS score of 34.39. These results suggest that our model of CjaD is sufficiently reliable as a framework to interpret sequenceâstructure-function relationships in the CjaD, such as analysis of its putative epitopes.
Prediction of Epitopes
As a starting point to identify epitopes in CjaA amino acid sequence we performed epitope identification based on amino acid sequence using five methods (references as in Materials and Methods). Then, we mapped amino acid residues identified by all five methods onto the comparative models of CjaA and CjaD built in this work. As putative epitopes, we defined only those from predicted regions of the amino acid sequences that were located on the protein surfaces and visibly exposed to the solvent (Figure 1). The following CjaA fragments were selected as the most probable epitopes: 55â60, 79â82, 111â118, 136â149, 167â171, and 263â268. In the case of CjaD, the 87â91, 99â108, and 139â158 amino acid fragments were indicated as the most probable peptide epitopes.
FIGURE 1
Additionally, based on the aforementioned predictions, six alternative amino acid sequences of CjaA with inserted CjaD epitopes were designed. For this purpose, first we selected five loops in CjaA model that were exposed to the solvent (25â26, 88â89, 189â190, 207â208, 218â219) and inserted three CjaD epitopes (EVSGV, DEWGTDEYN, GETNPVCTEKTKACDAQNRR) in all possible combinations (Supplementary Figure S2). Thus, we obtained six alternative amino acid sequences with three CjaD epitopes each. Finally, we built homology models for all six hybrid amino acid sequences (rCjaAD). The obtained models confirmed that cores of the proteins are unchanged whereas epitopes are inserted into loops exposed to the solvent (Figure 2).
FIGURE 2
Construction of CjaA Protein Displaying CjaD Peptide Epitopes on its Surface; Analysis of its Antigenicity and Immunogenicity
The structure based approach combined with the identification of the CjaA and CjaD epitopes allowed us to construct a CjaA antigen that presents CjaD epitopes on its surface. Three epitope amino acid sequences (EVSGV, DEWGTDEYN, GETNPVCTEKTKACDAQNRR) from CjaD were inserted at positions 25â26, 88â89, 189â190 of CjaA amino acid sequence (Figure 3). The DNA fragment encoding hybrid protein lacking the CjaA signal sequence (rCjaAD) was synthesized by Genecust and cloned into pBluescript II SK+ (see Materials and Methods). Next, it was recloned into pET28a and introduced into E. coli Rosetta (DE3) pLysS. rCjaAD was overproduced and purified by affinity chromatography.
FIGURE 3
Next we checked the specificity of rCjaAD by Western blot experiments. We found that rCjaAD protein reacts with specific rabbit anti-CjaA, as well as with specific rabbit anti-CjaD sera (Figures 4B,C, lane 1). As the hybrid protein was constructed with the aim of vaccination, we also investigated its immunogenicity. We found that the specific serum obtained by rabbit immunization with rCjaAD reacted strongly with both the native CjaA and the native CjaD produced by a wild type C. jejuni strain (Figure 4A, lane 4).
FIGURE 4
Construction of the L. lactis Strains Expressing C. jejuni Genes
We constructed two plasmids expressing a fusion of the C. jejuni CjaA or rCjaAD with the cell wall anchor region of YndF (CWA-YndF): LPETGDKEQGMKKITLFGSFLLILGSLVLFIRFRKVD). YndF (NP_267457) is a substrate for sortase SrtA. Two mucin-binding domains were identified in this protein, which suggests its possible function in adhesion to epithelial cells or possibly other cells (Dieye et al., 2010).
All genetic manipulations were performed in E. coli. To begin, we constructed a shuttle vector pUWM1000 able to replicate in E. coli and L. lactis strains. The shuttle vector is a derivative of a patented L. lactis plasmid carrying erythromycin resistance (pIL253), in which the ori pBR was introduced in order to ensure its replication in E. coli cells. The plasmid was introduced into E. coli by chemotransformation and L. lactis by electroporation.
Next, specific recombinant plasmids to generate fusions of C. jejuni and L. lactis genes were created. First, the promoter and DNA fragment coding for a signal peptide (SP) of Usp45 L. lactis protein (a 45 kDa secreted protein of unknown function) was introduced into pGEM-Easy to allow secretion of produced antigens. At the same time, the PCR-amplified DNA fragment encoding the CWA region of YndF was inserted into pGEM-T Easy. The resulting plasmids (pUWM1373 and pUWM1376, respectively) were the source of fragments, which were connected in the same transcriptional orientation in pBluescript II SK in the next step (pUWM1381). There are different nucleotide sequences recognized by restriction enzymes located at the junction between the 3âČ end of the DNA region encoding the SPUsp45 signal sequence and the 5âČ end of L. lactis DNA encoding the CWA region of YndF. This strategy facilitates cloning of C. jejuni genes. The last stage of the construction work included the insertion of two C. jejuni genes (encoding CjaA and rCjaAD, respectively) in such a way that both are expressed from the Usp45 promoter. The proteins lack the CjaA signal sequence but are equipped with the Usp45 signal sequence and are fused to the C-terminus of YndF. The details of construction are shown in Figure 5 and Supplementary Figure S3.
FIGURE 5
Finally, the DNA fragments of pUWM1384 or pUWM1382 encoding CjaA or rCjaAD fused to C-terminus of YndF were transferred into the pUWM1000 shuttle vector to generate pUWM1395 and pUWM1392, respectively. The correctness of constructed recombinant plasmids was verified by sequencing at every step of work. pUWM1392 and pUWM1395 were introduced into L. lactis by electrotransformation. Next, we confirmed the production of CjaA and rCjaAD by L. lactis by Western blotting experiments. We found that L. lactis contained plasmids harboring the rcjaAD or cjaA genes expressed proteins with approximate molecular masses of âŒ53 or âŒ50 kDa, respectively. Molecular masses of the proteins reacting with specific rabbit sera against CjaA or rCjaAD were consistent with the calculated sizes of the CjaA or rCjaAD fusions with CWA region of YndF (Supplementary Figure S4, lines 1 and 2).
To confirm the impact of the C-terminus of YndF on protein location and subsequently on the efficacy of vaccination, we also constructed two L. lactis strains harboring the recombinant plasmid that encodes Campylobacter rCjaAD antigen with a cytoplasmic localization (pUWM1492). Details of its construction are described in the methods section. The protein produced by this strain, which reacts with anti-rCjaAD serum, has the expected molecular mass (Supplementary Figure S4, line 3).
Localization of CjaA and rCjaAD Proteins
We next investigated the localization of CjaA and rCjaAD by immunofluorescence assay. We found that the L. lactis IL1403 strain bearing the fusion SPUsp45_rCjaAD_CWAY ndF displayed strong fluorescence. Fluorescence was also observed for SPUsp45_CjaA_CWAY ndF protein, though not as intense as the SPUsp45_rCjaAD_CWAY ndF protein. In contrast, no fluorescence was observed in cells of L. lactis strain harboring a recombinant plasmid encoding Campylobacter rCjaAD antigen with a cytoplasmic location. The results are given in Figure 6.
FIGURE 6
Chicken Immunization with L. lactis Producing Surface Exposed Hybrid Protein rCjaAD
Many Lactic Acid Bacteria (LAB) have received Generally Regarded as Safe (GRAS) status, and some of them are recognized as probiotics (Fontana et al., 2013; WyszyĆska et al., 2015). This makes LAB strains such as L. lactis suitable as potential vectors for chicken vaccination against Campylobacter. Our constructed L. lactis strain, expressing surface exposed rCjaAD, was used for chicken immunization in order to evaluate how well it provided protection against Campylobacter infection and to assess the induced immune responses. Additionally, to assess the role of protein localization and to evaluate the impact of a hybrid protein containing epitopes derived from two immunogenic proteins, two additional L. lactis strains were included in the experiment. One (L. lactis /pUWM1412) produces cytoplasm-localized rCjaAD, and the second produces surface-localized CjaA (L. lactis /pUWM1395). The scheme of the experiments is depicted in Table 3.
Table 3
| Day of life | 1 | 7 | 8 | 14 | 17 | 21 | 22 | 27 | 31 |
|---|---|---|---|---|---|---|---|---|---|
| Immunization with Lactococcus | + | + | + | ||||||
| Collection of blood and gut secretion samples for immune response analyses | + | + | + | + | + | + | |||
| Challenge with Campylobacter | + | ||||||||
| Cecum isolation for Campylobacter enumeration | + | + | |||||||
Scheme of immune response and protection experiments.
Note: + indicates when the procedures occurred.
Briefly, three groups of 1-day old chickens (19 per each group) were orally immunized with L. lactis strains expressing C. jejuni antigens (details are given in Materials and Methods). Chickens were boosted with the same doses of the same strains at 8 and 17 days post-hatch. Two groups of birds, one inoculated with BSG and the second inoculated with L. lactis IL1403 were used as a controls. The rationale behind this schedule of immunization is the fact that the immune system of chickens remains immature for the first 2 weeks of life (Mast and Goddeeris, 1999; Bar-Shira et al., 2003). Additionally, maternal antibodies, mainly directed against outer-membrane proteins, may restrict the induction of an immune response.
Serum and Intestinal Antibody Responses
To investigate the immunogenicity of the surface-exposed rCjaAD hybrid protein delivered by L. lactis, serum IgYs and mucosal IgAs were measured by ELISA using rCjaAD as coating antigen. The kinetics of the induction of two kinds of antibodies (specific IgYs and specific IgAs) varies significantly (Figures 7A,B). Systemic IgY responses to Campylobacter antigens were observed at days 7 and 14 (after the first and the second dose of vaccine), decreased at days 21 and 27, and finally increased at day 31 when the experiment was terminated (Figure 7A). The high level of specific IgYs observed during the first 2 weeks of chicken life represents maternal antibodies. The vaccinated groups (with one exception) had higher levels of specific IgYs on days 7 and 14 than the group vaccinated with carrier strain. These results indicate that vaccination may support the protective activity of maternal antibodies. The extremely high level of specific IgG induced by L. lactis/pUWM1392 (surface exposed rCjaAD) and low level induced by L. lactis/pUWM1395 (surface exposed CjaA) observed at day 14 is not clear. The anti-rCjaAD IgY response at day 31 elicited by L. lactis harboring Campylobacter antigens is significantly higher than the control group. The highest titer of the anti-rCjaAD antibodies was detected after immunization with the L. lactis that presented hybrid protein on its surface. Generally, mucosal IgAs are regarded as the first line of immune defense against many pathogens. Anti-rCjaAD mucosal IgA titers increased in all immunized group after the second booster (day 21). In the case of specific anti-rCjaAD mucosal IgAs, no correlation was noticed between the level of the induced immune response and antigen localization. Anti-rCjaAD IgA responses in the three groups immunized with L. lactis strains were similar, both in kinetics and titer at all points of the experiment (Figure 7B).
FIGURE 7
Protection Analysis
To determine whether the rCjaAD delivered by L. lactis provides protection against Campylobacter infection, immunized chickens were challenged orally with 8 Ă 104 bacterial cells of a broiler-isolated C. jejuni strain 5 days after the second booster. The C. jejuni strain used for the challenge experiment was labeled with the pUOA18 plasmid containing a cat gene. Protection was assessed at 5 and 9 days after the challenge by plating to determine the level of birdâs caeca colonization by wild type Campylobacter.
There was a noticeable, though not statistically significant, reduction in the CFUs (colony forming units) of C. jejuni in the cecal contents of birds immunized with L. lactis that produced surface-exposed rCjaAD (pUWM1392), as compared to control group (Figure 8). The mean CFU/gram of cecal content observed in this group was about 1 Ă 107 whereas the mean level of colonization in the control group was 1 Ă 108 CFU/gram. In the control group receiving L. lactis vector strain, no reduction in the colonization level was noticed, as compared to group receiving BSG, especially 9 days after the challenge. It should be noted that among three vaccinated groups, the group immunized with L. lactis producing surface-located rCjaAD displayed the lowest range in the level of colonization. Additionally in this group, the immunization of two out of six birds resulted in reduction of cecal C. jejuni by about 2 log10 units compared to birds receiving BSG at 9 days after challenge. Based on the mean level of colonization, vaccination with L. lactis/pUWM1395 (surface-exposed CjaA) does not result in protection against C. jejuni colonization. However, in this case the highest range of colonization levels was observed between individual chickens. While vaccination with L. lactis/pUWM1392 producing surface-located rCjaAD resulted in reduction of C. jejuni colonization at 5 and 9 days post-challenge, the reduction observed after immunization with an L. lactis strain producing the same antigen, but cytoplasmically located, is noted only for a short time. At day 9 post-challenge, the mean level of colonization was even slightly higher compared to the non-vaccination group. However, this group also had significant differences in the level of colonization between individual birds.
FIGURE 8
Discussion
Campylobacter sp. infection remains the leading cause of human food-borne gastroenteritis in industrialized countries. The occurrence of high loads of Campylobacter cells in the chicken digestive tract is still prevalent in broiler flocks (EFSA and ECDC, 2015). So there is an urgent need to control chicken contamination by Campylobacter. Many interventions aimed at lowering the level of chicken-carcass contamination during the poultry production cycle have recently been proposed and tested. However, the currently available interventions are of limited effectiveness or difficult to sustain (Hermans et al., 2011b; Josefsen et al., 2015). Thus, the market needs an effective anti-Campylobacter chicken vaccine. Recent progress has been made to understand the complex Campylobacter biology during chick colonization, as well as improvements in the technologies used for identifying the immunodominant proteins (Hermans et al., 2011a; Hoppe et al., 2014; Hu et al., 2014); both of these facilitate the selection of antigens for immunization.
Based on the results of chicken vaccination experiments presented by us and others (WyszyĆska et al., 2004; Buckley et al., 2010; Layton et al., 2011), and also on known facts about Campylobacter physiology and genomics, we decided to use two conserved, extracytoplasmic and highly immunogenic proteins, CjaA and CjaD (Konkel et al., 1996; Pawelec et al., 1997; Pawelec et al., 2000), for the experiments in this paper. CjaA is a periplasmic, cysteine binding protein (Muller et al., 2005), and CjaD is a peptidoglycan-associated essential protein (PAL) responsible for the integrity of bacterial cell wall (Godlewska et al., 2009). Additionally, CjaA was found among the proteins recognized by maternal antibodies that protect young chicks against Campylobacter infection (Shoaf-Sweeney et al., 2008). Analysis of the genomes of members of the Campylobacter genus, species other than C. jejuni, indicate CjaA as a core-virulence factor and potential candidate for subunit vaccine development (Ali et al., 2012). Given that several Campylobacter species have recently been recognized as emerging animal or human pathogens, this particular characteristic of CjaA is significant (Kaakoush et al., 2015). To facilitate antigen production by the vector strain and to overcome, at least partially, the problem created by the various Campylobacter genotypes, we constructed a hybrid protein: a CjaA that presents CjaD epitopes on its surface. Detailed bioinformatics analysis allowed us to determine the CjaD epitopes and specify the appropriate places to introduce them into the CjaA amino acid sequence. Structural modeling verified the construction of the hybrid protein. It showed that the CjaA structure was not disturbed and that the selected CjaD epitopes were present on the CjaA surface. The immunogenicity of rCjaAD was documented by rabbit immunization; the rabbit serum obtained after immunization with rCjaAD reacted with CjaA or CjaD present in a wild type Campylobacter strain. A similar approach has recently been presented by Konkel et al. (1996) who showed that intramuscular immunization with a subunit vaccine that consists of epitopes from three surface-exposed colonization proteins (CadF-FlaA-FlpA), combined with adjuvant, gave a significant reduction of Campylobacter colonization (Neal-McKinney et al., 2014). However, due to the biology of Campylobacter infection it is generally considered that oral antigen administration will be the most effective way to immunize chickens. As shown by Theoret et al. (2012) the mode of antigen delivery is sometimes crucial for immunization. They noticed that subcutaneous vaccination with purified rDps (DNA binding protein from starved cells) did not reduce colonization of chickens by Campylobacter, whereas the same protein delivered by an attenuated Salmonella appeared to be effective (Theoret et al., 2012). The importance of humoral immune response in preventing chicken colonization by Campylobacter has been recently documented by Hermans et al. (2014). They showed that passive immunization of 6 days old chicks with IgY obtained from egg yolks of hens immunized with C. jejuni lysates or fraction of C. jejuni hydrophobic proteins resulted not only in reduction their colonization by homologous C. jejuni strain but also reduce the pathogen transmission to not infected birds (Hermans et al., 2014). More and more LAB, mainly members of the Lactococcus and Lactobacillus genera, have been tested as vehicles for the delivery of heterologous bacterial or viral antigens into animal mucosal immune systems (Marelli et al., 2011; Villena et al., 2011; Kajikawa et al., 2012; Fontana et al., 2013; Li et al., 2014). In this work, we employed L. lactis because genetic engineering tools for this bacterium have been worked out in detail (Fontana et al., 2013). To the best of our knowledge, our work is the first attempt to use an LAB strain as a Campylobacter antigen delivery vehicle for chicken immunization. Although we observed a positive result from immunization, the reduction of chicken digestive tract colonization by Campylobacter after vaccination was not significant and was lower than that described previously by us and others (WyszyĆska et al., 2004; Layton et al., 2011). The median reduction in C. jejuni cecal contents observed after vaccination with surface-exposed hybrid protein was 1 log10 However, it should be noted than there was about a 2 log10 reduction in the level of colonization for four out of 10 birds. The main drawback of the L. lactis delivery vehicle is the lack of long-lasting colonization in the chick digestive tract. Thus, we postulate that it may be necessary to optimize the number of vaccine doses to improve the effectiveness of vaccination. Alternatively, using Lactobacillus sp. that colonize bird intestines should result in more efficient induction of the immune response (WyszyĆska et al., 2015).
The significant differences among published results of chicken vaccination against Campylobacter are apparent. The reduction in chicken colonization observed in protection experiments varies between 6 log10 to 1 log10 when compared to control groups (WyszyĆska et al., 2004; Buckley et al., 2010; Layton et al., 2011; Theoret et al., 2012). However, those various experiments differ substantially. Comparison of the experiments is difficult, if not impossible, because of differences in the nature of the antigens, the routes of antigen administration, the use of adjuvant, and the schemes of immunization or challenge experiments. Additionally, recent progress in chicken genome sequencing has revealed enormous differences among commercial breeds of broiler chickens (Rubin et al., 2010; Yan et al., 2014; Yi et al., 2014). These differences may have an impact on the bird immune system functioning and on colonization by Campylobacter (Humphrey et al., 2014). Differences in the immune responses to infection were observed not only among various breeds of chickens but also between among individual birds of the same population (Connell et al., 2012), which may explain the varying levels of colonization observed between individual birds in our protection experiments (see Figure 8). Also, the gastrointestinal microbiome of chickens differs for genetically diverse birds (Oakley et al., 2014; Schokker et al., 2015). Thus, in the light of the knowledge from the global analysis of chicken genomes or transcriptomes, it is apparent that the chicken line is of great importance when vaccine prototypes are evaluated. Also, the presence of maternal antibodies should be taken into account when results of immunization are evaluated. To exclude the impact of maternal antibodies, some experiments have been conducted on SPF chickens (Buckley et al., 2010; Hodgins et al., 2015).
Many recent experiments have sought to clarify how the location of antigen delivered by LAB strains affects the efficacy of vaccination (Reveneau et al., 2002; WyszyĆska et al., 2015). Generally, surface located antigens work more efficiently than those located in the cytoplasm; however, some exceptions were also observed (Shaw et al., 2000). Thus, this issue needs to be evaluated individually for each antigen and delivery vector. Our protection experiments demonstrated that the hybrid protein, equipped with a cell-wall anchored motif and delivered orally using L. lactis as a vehicle, acted more effectively than cytoplasm-located protein administered by the same strain. Also, using the hybrid rCjAD protein resulted in a higher level of protection when compared to surface-located CjaA. It should be noted that one of the CjaD epitopes inserted into CjaA was the same as that used by Layton et al. (2011). However, Layton et al. (2011) demonstrated a much higher level of protection. The reasons for the discrepancy are difficult to identify as both vaccination experiments differ substantially. One notable difference is that the Salmonella strain used by the Layton group as the carrier strain co-expressed the immune-enhancing region of the CD154 ligand (Layton et al., 2011).
Overall, our work demonstrates the possibility of delivering foreign antigens via an LAB vector for chicken immunization against Campylobacter, and it also documents that CjaA is a good starting point for constructing a multi-epitope hybrid protein taking into account recently identified immunogenic C. jejuni proteins present in egg yolks of immunized hens (Hermans et al., 2014). Hybrid proteins containing epitopes of several immunogenic proteins may ensure higher levels of protection than vaccination with individual proteins.
Statements
Author contributions
EJ-K, AW, and PK conceived and designed the study. PK, AW, BO, MK, and KD carried out the laboratory work. AW, PK, PM, IA carried out animal experiment. EJ-K, PK, and AW analyzed the data. EJ-K, AW, and PK wrote the manuscript. All authors read and approved the final manuscript.
Funding
The work was supported by grants from the National Science Center, Poland (grants No 2011/03/B/NZ1/00592).
Acknowledgments
We thank Dr. J. Hansen for his critical reading of the manuscript. Bioinformatic analyses were performed by VitaInSilica Sp. z o. o., Zlotniki, Poland.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: http://journal.frontiersin.org/article/10.3389/fmicb.2016.00165
FIGURE S1 | The scheme of pUWM1373 construction.FIGURE S2 | Amino acid sequence of CjaA containing inserted three CjaD peptide epitopes (EVSGV, DEWGTDEYN, GETNPVCTEKTKACDAQNRR) in all possible combinations. Amino acids between which epitopes of CjaD protein were inserted are indicated in red.FIGURE S3 | The scheme of pUWM1392 and pUWM1395 construction.FIGURE S4 | The production of CjaA and rCjaAD by L. lactis. Protein extracts were separated by 12% SDS-PAGE under reducing conditions and probed with anti-rCjaAD antibodies. Lanes: M - protein molecular-weight marker, 1 â L. lactis/pUWM1392, 2 â L. lactis/pUWM1395; 3 â L. lactis/pUWM1412.References
1
AdamczakR.PorolloA.MellerJ. (2005). Combining prediction of secondary structure and solvent accessibility in proteins.Proteins59467â475. 10.1002/prot.20441
2
AliA.SoaresS. C.SantosA. R.GuimaraesL. C.BarbosaE.AlmeidaS. S.et al (2012). Campylobacter fetus subspecies: comparative genomics and prediction of potential virulence targets.Gene508145â156. 10.1016/j.gene.2012.07.070
3
Bar-ShiraE.SklanD.FriedmanA. (2003). Establishment of immune competence in the avian GALT during the immediate post-hatch period.Dev. Comp. Immunol.27147â157. 10.1016/S0145-305X(02)00076-9
4
BuckleyA. M.WangJ.HudsonD. L.GrantA. J.JonesM. A.MaskellD. J.et al (2010). Evaluation of live-attenuated Salmonella vaccines expressing Campylobacter antigens for control of C. jejuni in poultry.Vaccine281094â1105. 10.1016/j.vaccine.2009.10.018
5
CawthrawS. A.NewellD. G. (2010). Investigation of the presence and protective effects of maternal antibodies against Campylobacter jejuni in chickens.Avian Dis.5486â93. 10.1637/9004-072709-Reg.1
6
ChalonerG.WigleyP.HumphreyS.KemmettK.Lacharme-LoraL.HumphreyT.et al (2014). Dynamics of dual infection with Campylobacter jejuni strains in chickens reveals distinct strain-to-strain variation in infection ecology.Appl. Environ. Microbiol.806366â6372. 10.1128/AEM.01901-14
7
ChengJ.RandallA. Z.SweredoskiM. J.BaldiP. (2005a). SCRATCH: a protein structure and structural feature prediction server.Nucleic Acids Res.33W72âW76. 10.1093/nar/gki396
8
ChengJ.SweredoskiM.BaldiP. (2005b). Accurate prediction of protein disordered regions by mining protein structure data.Data Min. Knowl. Discov.11213â222. 10.1016/j.phrp.2014.06.006
9
ChopinA.ChopinM. C.Moillo-BattA.LangellaP. (1984). Two plasmid-determined restriction and modification systems in Streptococcus lactis.Plasmid11260â263. 10.1016/0147-619X(84)90033-7
10
ChouP. Y.FasmanG. D. (1978). Prediction of the secondary structure of proteins from their amino acid sequence.Adv. Enzymol. Relat. Areas Mol. Biol.4745â148.
11
ClarkJ. D.OakesR. D.RedheadK.CrouchC. F.FrancisM. J.TomleyF. M.et al (2012). Eimeria species parasites as novel vaccine delivery vectors: anti-Campylobacter jejuni protective immunity induced by Eimeria tenella-delivered CjaA.Vaccine302683â2688. 10.1016/j.vaccine.2012.02.002
12
ConnellS.MeadeK. G.AllanB.LloydA. T.KennyE.CormicanP.et al (2012). Avian resistance to Campylobacter jejuni colonization is associated with an intestinal immunogene expression signature identified by mRNA sequencing.PLoS ONE7:e40409. 10.1371/journal.pone.0040409
13
CuffJ. A.BartonG. J. (2000). Application of multiple sequence alignment profiles to improve protein secondary structure prediction.Proteins40502â511. 10.1002/1097-0134(20000815)40:3<502::AID-PROT170>3.0.CO;2-Q
14
de ZoeteM. R.van PuttenJ. P.WagenaarJ. A. (2007). Vaccination of chickens against Campylobacter.Vaccine255548â5557. 10.1016/j.vaccine.2006.12.002
15
DelanyI.RappuoliR.De GregorioE. (2014). Vaccines for the 21st century.EMBO Mol. Med.6708â720. 10.1002/emmm.201403876
16
DieyeY.OxaranV.Ledue-ClierF.AlkhalafW.BuistG.JuillardV.et al (2010). Functionality of sortase A in Lactococcus lactis.Appl. Environ. Microbiol.767332â7337. 10.1128/AEM.00928-10
17
DunkerA. K.BrownC. J.LawsonJ. D.IakouchevaL. M.ObradovicZ. (2002). Intrinsic disorder and protein function.Biochemistry416573â6582. 10.1021/bi012159
18
EFSA and ECDC (2015). The european union summary report on trends, and sources. (of) zoonoses, zoonotic agents and foodborne outbreaks in 2013.EFSA J.13:3991. 10.2903/j.efsa.2015.3991
19
EFSA Panel on Biological Hazards (BIOHAZ) (2011). Scientific opinion on Campylobacter in broiler meat production: control options, and performance objectives, and/or targets. (at)different stages of the food chain.EFSA J.9:2105. 10.2903/j.efsa.-2011.2105
20
EminiE. A.HughesJ. V.PerlowD. S.BogerJ. (1985). Induction of hepatitis A virus-neutralizing antibody by a virus-specific synthetic peptide.J. Virol.55836â839.
21
FischerD. (2000). Hybrid fold recognition: combining sequence derived properties with evolutionary information.Pac. Symp. Biocomput.5119â130. 10.1142/9789814447331_0012
22
FontanaL.Bermudez-BritoM.Plaza-DiazJ.Munoz-QuezadaS.GilA. (2013). Sources, isolation, characterisation and evaluation of probiotics.Br. J. Nutr.109(Suppl. 2), S35âS50. 10.1017/S0007114512004011
23
FriisC.WassenaarT. M.JavedM. A.SnipenL.LagesenK.HallinP. F.et al (2010). Genomic characterization of Campylobacter jejuni strain M1.PLoS ONE5:e12253. 10.1371/journal.pone.0012253
24
GilbreathJ. J.CodyW. L.MerrellD. S.HendrixsonD. R. (2011). Change is good: variations in common biological mechanisms in the epsilonproteobacterial genera Campylobacter and Helicobacter.Microbiol. Mol. Biol. Rev.7584â132. 10.1128/MMBR.00035-10
25
GodlewskaR.WiĆniewskaK.PietrasZ.Jagusztyn-KrynickaE. K. (2009). Peptidoglycan-associated lipoprotein (Pal) of Gram-negative bacteria: function, structure, role in pathogenesis and potential application in immunoprophylaxis.FEMS Microbiol. Lett.2981â11. 10.1111/j.1574-6968.2009.01659.x
26
HanahanD. (1983). Studies on transformation of Escherichia coli with plasmids.J. Mol. Biol.166557â580. 10.1016/S0022-2836(83)80284-8
27
HermansD.PasmansF.MessensW.MartelA.Van ImmerseelF.RasschaertG.et al (2012). Poultry as a host for the zoonotic pathogen Campylobacter jejuni.Vector Borne Zoonotic Dis.1289â98. 10.1089/vbz.2011.0676
28
HermansD.Van DeunK.MartelA.Van ImmerseelF.MessensW.HeyndrickxM.et al (2011a). Colonization factors of Campylobacter jejuni in the chicken gut.Vet. Res.42:82. 10.1186/1297-9716-42-82
29
HermansD.Van DeunK.MessensW.MartelA.Van ImmerseelF.HaesebrouckF.et al (2011b). Campylobacter control in poultry by current intervention measures ineffective: urgent need for intensified fundamental research.Vet. Microbiol.152219â228. 10.1016/j.vetmic.2011.03.010
30
HermansD.Van SteendamK.VerbruggheE.VerlindenM.MartelA.SeliwiorstowT.et al (2014). Passive immunization to reduce Campylobacter jejuni colonization and transmission in broiler chickens.Vet. Res.45:27. 10.1186/1297-9716-45-27
31
HodginsD. C.BarjestehN.St PaulM.MaZ.MonteiroM. A.SharifS. (2015). Evaluation of a polysaccharide conjugate vaccine to reduce colonization by Campylobacter jejuni in broiler chickens.BMC Res. Notes8:204. 10.1186/s13104-015-1203-z
32
HoppeS.BierF. F.von Nickisch-RosenegkM. (2014). Identification of antigenic proteins of the nosocomial pathogen Klebsiella pneumoniae.PLoS ONE9:e110703. 10.1371/journal.pone.0110703
33
HuY.HuangJ.JiaoX. A. (2014). Screening of genes expressed in vivo during interaction between chicken and Campylobacter jejuni.J. Microbiol. Biotechnol.24217â224. 10.4014/jmb.1308.08092
34
HumphreyS.ChalonerG.KemmettK.DavidsonN.WilliamsN.KiparA.et al (2014). Campylobacter jejuni is not merely a commensal in commercial broiler chickens and affects bird welfare.MBio5:e1364â14. 10.1128/mBio.01364-14
35
Jagusztyn-KrynickaE. K.LaniewskiP.WyszyĆskaA. (2009). Update on Campylobacter jejuni vaccine development for preventing human campylobacteriosis.Exp. Rev. Vaccines8625â645. 10.1586/erv.09.21
36
JaroszewskiL.RychlewskiL.LiZ.LiW.GodzikA. (2005). FFAS03: a server for profileâprofile sequence alignments.Nucleic Acids Res.33W284âW288. 10.1093/nar/gki418
37
JeonB.MuraokaW. T.ZhangQ. (2010). Advances in Campylobacter biology and implications for biotechnological applications.Microb. Biotechnol.3242â258. 10.1111/j.1751-7915.2009.00118.x
38
JonesD. T. (1999a). GenTHREADER: an efficient and reliable protein fold recognition method for genomic sequences.J. Mol. Biol.287797â815. 10.1006/jmbi.1999.2583
39
JonesD. T. (1999b). Protein secondary structure prediction based on position-specific scoring matrices.J. Mol. Biol.292195â202. 10.1006/jmbi.1999.3091
40
JosefsenM. H.AndersenS. C.ChristensenJ.HoorfarJ. (2015). Microbial food safety: potential of DNA extraction methods for use in diagnostic metagenomics.J. Microbiol. Methods11430â34. 10.1016/j.mimet.2015.04.016
41
KaakoushN. O.Castano-RodriguezN.MitchellH. M.ManS. M. (2015). Global epidemiology of Campylobacter infection.Clin. Microbiol. Rev.28687â720. 10.1128/CMR.00006-15
42
KajikawaA.ZhangL.LongJ.NordoneS.StoekerL.LaVoyA.et al (2012). Construction and immunological evaluation of dual cell surface display of HIV-1 gag and Salmonella enterica serovar Typhimurium FliC in Lactobacillus acidophilus for vaccine delivery.Clin. Vaccine Immunol.191374â1381. 10.1128/CVI.00049-12
43
KarplusK.KarchinR.DraperJ.CasperJ.Mandel-GutfreundY.DiekhansM.et al (2003). Combining local-structure, fold-recognition, and new fold methods for protein structure prediction.Proteins53(Suppl. 6), 491â496. 10.1002/prot.10540
44
KarplusP. A.SchulzG. E. (1985). Prediction of chain flexibility in proteins - a tool for the selection of peptide antigens.Naturwissenschafren72212â213. 10.1007/BF01195768
45
KelleyL. A.MacCallumR. M.SternbergM. J. (2000). Enhanced genome annotation using structural profiles in the program 3D-PSSM.J. Mol. Biol.299499â520. 10.1006/jmbi.2000.3741
46
KobiereckaP.WyszyĆskaA.MaruszewskaM.WojtaniaA.Ć»ylinskaJ.BardowskiJ.et al (2015). Lactic acid bacteria as a surface display platform for Campylobacter jejuni antigens.J. Mol. Microbiol. Biotechnol.251â10. 10.1159/000368780
47
KolaskarA. S.TongaonkarP. C. (1990). A semi-empirical method for prediction of antigenic determinants on protein antigens.FEBS Lett.276172â174. 10.1016/0014-5793(90)80535-Q
48
KonkelM. E.MeadD. J.CieplakW.Jr. (1996). Cloning, sequencing, and expression of a gene from Campylobacter jejuni encoding a protein (Omp18) with similarity to peptidoglycan-associated lipoproteins.Infect. Immun.641850â1853.
49
KorlathJ. A.OsterholmM. T.JudyL. A.ForfangJ. C.RobinsonR. A. (1985). A point-source outbreak of campylobacteriosis associated with consumption of raw milk.J. Infect. Dis.152592â596. 10.1093/infdis/152.3.592
50
KosinskiJ.GajdaM. J.CymermanI. A.KurowskiM. A.PawlowskiM.BonieckiM.et al (2005). FRankenstein becomes a cyborg: the automatic recombination and realignment of fold recognition models in CASP6.Proteins61(Suppl. 7), 106â113. 10.1002/prot.20726
51
KurowskiM. A.BujnickiJ. M. (2003). GeneSilico protein structure prediction meta-server.Nucleic Acids Res.313305â3307. 10.1093/nar/gkg557
52
LandeteJ. M.ArquesJ. L.PeirotenA.LangaS.MedinaM. (2014). An improved method for the electrotransformation of lactic acid bacteria: a comparative survey.J. Microbiol. Methods105130â133. 10.1016/j.mimet.2014.07.022
53
ĆaniewskiP.KuczkowskiM.ChrzkÄ stekK.WoĆșniakA.WyszyĆskaA.WieliczkoA.et al (2014). Evaluation of the immunogenicity of Campylobacter jejuni CjaA protein delivered by Salmonella enterica sv. Typhimurium strain with regulated delayed attenuation in chickens.World J. Microbiol. Biotechnol.30281â292. 10.1007/s11274-013-14475
54
ĆaniewskiP.LisM.WyszyĆskaA.MajewskiP.GodlewskaR.Jagusztyn-KrynickaE. K. (2012). Assessment of chicken protection against Campylobacter jejuni infection by immunization with avirulent Salmonella enterica sv. Typhimurium strain producing Campylobacter CjaD/Pal protein.Vaccine Dev. Ther.243â50. 10.2147/VDT.S33742
55
LarsenJ. E.LundO.NielsenM. (2006). Improved method for predicting linear B-cell epitopes.Immunome Res.2:2. 10.1186/1745-7580-2-2
56
LaytonS. L.MorganM. J.ColeK.KwonY. M.DonoghueD. J.HargisB. M.et al (2011). Evaluation of Salmonella-vectored Campylobacter peptide epitopes for reduction of Campylobacter jejuni in broiler chickens.Clin. Vaccine Immunol.18449â454. 10.1128/CVI.00379-10
57
LiX.XingY.GuoL.LvX.SongH.XiT. (2014). Oral immunization with recombinant Lactococcus lactis delivering a multi-epitope antigen CTB-UE attenuates Helicobacter pylori infection in mice.Pathog. Dis.7278â86. 10.1111/2049-632X.12173
58
LindingR.JensenL. J.DiellaF.BorkP.GibsonT. J.RussellR. B. (2003). Protein disorder prediction: implications for structural proteomics.Structure111453â1459. 10.1016/j.str.2003.10.002
59
LundstromJ.RychlewskiL.BujnickiJ.ElofssonA. (2001). Pcons: a neural-network-based consensus predictor that improves fold recognition.Protein Sci.102354â2362. 10.1110/ps.08501
60
MarelliB.PerezA. R.BanchioC.de MendozaD.MagniC. (2011). Oral immunization with live Lactococcus lactis expressing rotavirus VP8 subunit induces specific immune response in mice.J. Virol. Methods17528â37. 10.1016/j.jviromet.2011.04.011
61
MastJ.GoddeerisB. M. (1999). Development of immunocompetence of broiler chickens.Vet. Immunol. Immunopathol.70245â256. 10.1016/S0165-2427(99)00079-3
62
MeilerJ.BakerD. (2003). Coupled prediction of protein secondary and tertiary structure.Proc. Natl. Acad. Sci. U.S.A.10012105â12110. 10.1073/pnas.1831973100
63
MericG.YaharaK.MageirosL.PascoeB.MaidenM. C.JolleyK. A.et al (2014). A reference pan-genome approach to comparative bacterial genomics: identification of novel epidemiological markers in pathogenic Campylobacter.PLoS ONE9:e92798. 10.1371/journal.pone.0092798
64
MullerA.ThomasG. H.HorlerR.BranniganJ. A.BlagovaE.LevdikovV. M.et al (2005). An ATP-binding cassette-type cysteine transporter in Campylobacter jejuni inferred from the structure of an extracytoplasmic solute receptor protein.Mol. Microbiol.57143â155. 10.1111/j.1365-2958.2005.04691.x
65
Neal-McKinneyJ. M.LuX.DuongT.LarsonC. L.CallD. R.ShahD. H.et al (2012). Production of organic acids by probiotic lactobacilli can be used to reduce pathogen load in poultry.PLoS ONE7:e43928. 10.1371/journal.pone.0043928
66
Neal-McKinneyJ. M.SamuelsonD. R.EuckerT. P.NissenM. S.CrespoR.KonkelM. E. (2014). Reducing Campylobacter jejuni colonization of poultry via vaccination.PLoS ONE9:e114254. 10.1371/journal.pone.0114254
67
NewellD. G.KoopmansM.VerhoefL.DuizerE.Aidara-KaneA.SprongH.et al (2010). Food-borne diseases - the challenges of 20 years ago still persist while new ones continue to emerge.Int. J. Food Microbiol.139(Suppl. 1), S3âS15. 10.1016/j.ijfoodmicro.2010.01.021
68
OakleyB. B.LillehojH. S.KogutM. H.KimW. K.MaurerJ. J.PedrosoA.et al (2014). The chicken gastrointestinal microbiome.FEMS Microbiol. Lett.360100â112. 10.1111/1574-6968.12608
69
OualiM.KingR. D. (2000). Cascaded multiple classifiers for secondary structure prediction.Protein Sci.91162â1176. 10.1110/ps.9.6.1162
70
ParkerJ. M.GuoD.HodgesR. S. (1986). New hydrophilicity scale derived from high-performance liquid chromatography peptide retention data: correlation of predicted surface residues with antigenicity and X-ray-derived accessible sites.Biochemistry255425â5432. 10.1021/bi00367a013
71
PawelecD. P.KorsakD.WyszyĆskaA. K.RozynekE.PopowskiJ.Jagusztyn-KrynickaE. K. (2000). Genetic diversity of the Campylobacter genes coding immunodominant proteins.FEMS Microbiol. Lett.18543â49. 10.1111/j.1574-6968.2000.tb09038.x
72
PawelecD.RozynekE.PopowskiJ.Jagusztyn-KrynickaE. K. (1997). Cloning and characterization of a Campylobacter jejuni 72Dz/92 gene encoding a 30 kDa immunopositive protein, component of the ABC transport system; expression of the gene in avirulent Salmonella typhimurium.FEMS Immunol. Med. Microbiol.19137â150. 10.1111/j.1574-695X.1997.tb01083.x
73
PawlowskiM.GajdaM. J.MatlakR.BujnickiJ. M. (2008). MetaMQAP: a meta-server for the quality assessment of protein models.BMC Bioinformatics9:403. 10.1186/1471-2105-9-403
74
PollastriG.McLysaghtA. (2005). Porter: a new, accurate server for protein secondary structure prediction.Bioinformatics211719â1720. 10.1093/bioinformatics/bti203
75
PowellL. F.LawesJ. R.Clifton-HadleyF. A.RodgersJ.HarrisK.EvansS. J.et al (2012). The prevalence of Campylobacter spp. in broiler flocks and on broiler carcases, and the risks associated with highly contaminated carcases.Epidemiol. Infect.1402233â2246. 10.1017/S0950268812000040
76
ReveneauN.GeoffroyM. C.LochtC.ChagnaudP.MercenierA. (2002). Comparison of the immune responses induced by local immunizations with recombinant Lactobacillus plantarum producing tetanus toxin fragment C in different cellular locations.Vaccine201769â1777. 10.1016/S0264-410X(02)00027-0
77
RobynJ.RasschaertG.PasmansF.HeyndrickxM. (2015). Thermotolerant Campylobacter during broiler rearing: risk factors and intervention.Compr. Rev. Food Sci. Food Saf.1481â105. 10.1111/1541-4337.12124
78
RosenquistH.BoysenL.KroghA. L.JensenA. N.NautaM. (2013). Campylobacter contamination and the relative risk of illness from organic broiler meat in comparison with conventional broiler meat.Int. J. Food Microbiol.162226â230. 10.1016/j.ijfoodmicro.2013.01.022
79
RostB.YachdavG.LiuJ. (2004). The predictprotein server.Nucleic Acids Res.32W321âW326. 10.1093/nar/gkh377
80
RubinC. J.ZodyM. C.ErikssonJ.MeadowsJ. R.SherwoodE.WebsterM. T.et al (2010). Whole-genome resequencing reveals loci under selection during chicken domestication.Nature464587â591. 10.1038/nature08832
81
SahinO.LuoN.HuangS.ZhangQ. (2003). Effect of Campylobacter-specific maternal antibodies on Campylobacter jejuni colonization in young chickens.Appl. Environ. Microbiol.695372â5379. 10.1128/AEM.69.9.5372-5379.2003
82
SahinO.ZhangQ.MeitzlerJ. C.HarrB. S.MorishitaT. Y.MohanR. (2001). Prevalence, antigenic specificity, and bactericidal activity of poultry anti-Campylobacter maternal antibodies.Appl. Environ. Microbiol.673951â3957. 10.1128/AEM.67.9.3951-3957.2001
83
SaliA.BlundellT. L. (1993). Comparative protein modelling by satisfaction of spatial restraints.J. Mol. Biol.234779â815. 10.1006/jmbi.1993.1626
84
SambrookJ.RussellD. W. (2001). Molecular Cloning: A Laboratory Manual.New York, NY: Cold Spring Harbor Laboratory Press.
85
SchokkerD.VeningaG.VastenhouwS. A.BossersA.de BreeF. M.Kaal-LansbergenL. M.et al (2015). Early life microbial colonization of the gut and intestinal development differ between genetically divergent broiler lines.BMC Genomics16:418. 10.1186/s12864-015-1646-6
86
SerrutoD.BottomleyM. J.RamS.GiulianiM. M.RappuoliR. (2012). The new multicomponent vaccine against meningococcal serogroup B, 4CMenB: immunological, functional and structural characterization of the antigens.Vaccine30(Suppl. 2), B87âB97. 10.1016/j.vaccine.2012.01.033
87
ShawD. M.GaertheB.LeerR. J.Van Der StapJ. G.SmittenaarC.Heijne Den Bak-GlashouwerM.et al (2000). Engineering the microflora to vaccinate the mucosa: serum immunoglobulin G responses and activated draining cervical lymph nodes following mucosal application of tetanus toxin fragment C-expressing lactobacilli.Immunology100510â518. 10.1046/j.1365-2567.2000.00069.x
88
ShiJ.BlundellT. L.MizuguchiK. (2001). FUGUE: sequence-structure homology recognition using environment-specific substitution tables and structure-dependent gap penalties.J. Mol. Biol.310243â257. 10.1006/jmbi.2001.4762
89
Shoaf-SweeneyK. D.LarsonC. L.TangX.KonkelM. E. (2008). Identification of Campylobacter jejuni proteins recognized by maternal antibodies of chickens.Appl. Environ. Microbiol.746867â6875. 10.1128/AEM.01097-08
90
SilvaJ.LeiteD.FernandesM.MenaC.GibbsP. A.TeixeiraP. (2011). Campylobacter spp. as a foodborne pathogen: a review.Front. Microbiol.2:200. 10.3389/fmicb.2011.00200
91
SimonD.ChopinA. (1988). Construction of a vector plasmid family and its use for molecular cloning in Streptococcus lactis.Biochimie70559â566. 10.1016/0300-9084(88)90093-4
92
SodingJ. (2005). Protein homology detection by HMM-HMM comparison.Bioinformatics21951â960. 10.1093/bioinformatics/bti125
93
StudierF. W. (2005). Protein production by auto-induction in high density shaking cultures.Protein Expr. Purif.41207â234. 10.1016/j.pep.2005.01.016
94
TheoretJ. R.CooperK. K.ZekariasB.RolandK. L.LawB. F.CurtissR.IIIet al (2012). The Campylobacter jejuni Dps homologue is important for in vitro biofilm formation and cecal colonization of poultry and may serve as a protective antigen for vaccination.Clin. Vaccine Immunol.191426â1431. 10.1128/CVI.00151-12
95
TomiiK.AkiyamaY. (2004). FORTE: a profile-profile comparison tool for protein fold recognition.Bioinformatics20594â595. 10.1093/bioinformatics/btg474
96
van AsseldonkM.RuttenG.OtemanM.SiezenR. J.de VosW. M.SimonsG. (1990). Cloning of usp45, a gene encoding a secreted protein from Lactococcus lactis subsp. lactis MG1363.Gene95155â160. 10.1016/0378-1119(90)90428-T
97
van der VossenJ. M.van der LelieD.VenemaG. (1987). Isolation and characterization of Streptococcus cremoris Wg2-specific promoters.Appl. Environ. Microbiol.532452â2457.
98
VillenaJ.OliveiraM. L.FerreiraP. C.SalvaS.AlvarezS. (2011). Lactic acid bacteria in the prevention of pneumococcal respiratory infection: future opportunities and challenges.Int. Immunopharmacol.111633â1645. 10.1016/j.intimp.2011.06.004
99
WardJ. J.McGuffinL. J.BrysonK.BuxtonB. F.JonesD. T. (2004). The DISOPRED server for the prediction of protein disorder.Bioinformatics202138â2139. 10.1093/bioinformatics/bth195
100
WyszyĆskaA.KobiereckaP.BardowskiJ.Jagusztyn-KrynickaE. K. (2015). Lactic acid bacteriaâ20 years exploring their potential as live vectors for mucosal vaccination.Appl. Microbiol. Biotechnol.992967â2977. 10.1007/s00253-015-6498-0
101
WyszyĆskaA.RaczkoA.LisM.Jagusztyn-KrynickaE. K. (2004). Oral immunization of chickens with avirulent Salmonella vaccine strain carrying C. jejuni 72Dz/92 cjaA gene elicits specific humoral immune response associated with protection against challenge with wild-type Campylobacter.Vaccine221379â1389. 10.1016/j.vaccine.2003.11.001
102
YanY.YiG.SunC.QuL.YangN. (2014). Genome-wide characterization of insertion and deletion variation in chicken using next generation sequencing.PLoS ONE9:e104652. 10.1371/journal.pone.0104652
103
YangZ. R.ThomsonR.McNeilP.EsnoufR. M. (2005). RONN: the bio-basis function neural network technique applied to the detection of natively disordered regions in proteins.Bioinformatics213369â3376. 10.1093/bioinformatics/bti534
104
YiG.QuL.LiuJ.YanY.XuG.YangN. (2014). Genome-wide patterns of copy number variation in the diversified chicken genomes using next-generation sequencing.BMC Genomics15:962. 10.1186/1471-2164-15-962
105
ZhouH.ZhouY. (2004). Single-body residue-level knowledge-based energy score combined with sequence-profile and secondary structure information for fold recognition.Proteins551005â1013. 10.1002/prot.20007
Summary
Keywords
Lactococcus lactis, LPXTG cell wall anchor domain, Campylobacter, vaccine, chicken immunization
Citation
Kobierecka PA, Olech B, KsiÄ ĆŒek M, Derlatka K, Adamska I, Majewski PM, Jagusztyn-Krynicka EK and WyszyĆska AK (2016) Cell Wall Anchoring of the Campylobacter Antigens to Lactococcus lactis. Front. Microbiol. 7:165. doi: 10.3389/fmicb.2016.00165
Received
04 December 2015
Accepted
01 February 2016
Published
18 February 2016
Volume
7 - 2016
Edited by
Amit Kumar Tyagi, The University of Texas MD Anderson Cancer Center, USA
Reviewed by
Odile Tresse, French National Institute for Agricultural Research/Nantes-Atlantic National College of Veterinary Medicine, Food Science and Engineering, France; Annikka Polster, University of Gothenburg, Sweden
Updates
Copyright
© 2016 Kobierecka, Olech, KsiÄ ĆŒek, Derlatka, Adamska, Majewski, Jagusztyn-Krynicka and WyszyĆska.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Agnieszka K. WyszyĆska, agawysz@biol.uw.edu.pl
This article was submitted to Food Microbiology, a section of the journal Frontiers in Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.