Abstract
Cell division protein FtsZ is the organizer of the cytokinetic ring in almost all bacteria and a target for the discovery of new antibacterial agents that are needed to counter widespread antibiotic resistance. Bacterial cytological profiling, using quantitative microscopy, is a powerful approach for identifying the mechanism of action of antibacterial molecules affecting different cellular pathways. We have determined the cytological profile on Bacillus subtilis cells of a selection of small molecule inhibitors targeting FtsZ on different binding sites. FtsZ inhibitors lead to long undivided cells, impair the normal assembly of FtsZ into the midcell Z-rings, induce aberrant ring distributions, punctate FtsZ foci, membrane spots and also modify nucleoid length. Quantitative analysis of cell and nucleoid length combined, or the Z-ring distribution, allows categorizing FtsZ inhibitors and to distinguish them from antibiotics with other mechanisms of action, which should be useful for identifying new antibacterial FtsZ inhibitors. Biochemical assays of FtsZ polymerization and GTPase activity combined explain the cellular effects of the FtsZ polymer stabilizing agent PC190723 and its fragments. MciZ is a 40-aminoacid endogenous inhibitor of cell division normally expressed during sporulation in B. subtilis. Using FtsZ cytological profiling we have determined that exogenous synthetic MciZ is an effective inhibitor of B. subtilis cell division, Z-ring formation and localization. This finding supports our cell-based approach to screen for FtsZ inhibitors and opens new possibilities for peptide inhibitors of bacterial cell division.
Introduction
Cell division protein FtsZ, a tubulin-like GTPase conserved in most bacteria, is a target for new antibiotics. At the earliest step of cell division, FtsZ undergoes assembly at mid-cell forming a dynamic membrane-attached ring structure (Bi and Lutkenhaus, 1991). Other bacterial division proteins are then recruited to this Z-ring to form the divisome, a complex that constricts between the future daughter cells (Adams and Errington, 2009; Lutkenhaus et al., 2012; Egan and Vollmer, 2013; Meier and Goley, 2014; Haeusser and Margolin, 2016). FtsZ assembles into polar tubulin-like protofilaments in which the GTP-binding site of one monomer is at the association interface with the next monomer completing the GTPase site (Oliva et al., 2004; Matsui et al., 2012). Dynamic FtsZ filaments laterally associate in different fashions including double filaments, bundles, and ribbons (Erickson et al., 2010; Buske and Levin, 2012, Buske et al., 2015). Electron cryotomography studies have shown a small band of individual, laterally connected FtsZ filaments forming a ring parallel to the membrane (Szwedziak et al., 2014). However, super resolution fluorescence microscopy in different organisms suggests that the Z-ring is a patchy scaffold made of disordered FtsZ protofilaments (Fu et al., 2010; Biteen et al., 2012; Strauss et al., 2012; Si et al., 2013; Holden et al., 2014; Rowlett and Margolin, 2014). The Z-ring is stabilized by a protein network connecting the cell membrane to the chromosome in Escherichia coli cells (Buss et al., 2015), where the constriction force has been suggested to come mainly from the septal cell wall synthesis (Coltharp et al., 2016).
The functional inhibition of FtsZ blocks cell division and induces the formation of long, multi-nucleoid cell filaments via uncoupling growth and division. Mutations in ftsZ affect cell division, FtsZ polymerization and GTPase activity (Stricker and Erickson, 2003; Feucht and Errington, 2005; Redick et al., 2005). Several protein inhibitors and physiological mechanisms inhibit FtsZ directly and block cell division (Margolin, 2005). For example, DNA damage initiates the SOS response and triggers expression of SulA, which blocks the FtsZ minus-end for assembly and stalls division for DNA damage repair (Bi and Lutkenhaus, 1993; Cordell et al., 2003). Another mechanism is provided by the nucleoid occlusion machinery that prevents the assembly of functional Z-rings in membrane areas in close proximity to the nucleoid (Bernhardt and de Boer, 2005; Wu et al., 2009; Adams et al., 2015). The loss of the transmembrane potential has also been reported to negatively affect FtsZ function, inhibiting cell division via dissociation of FtsA and consequent release of FtsZ from the membrane in Bacillus subtilis (Strahl and Hamoen, 2010). Recently, a link of cell division to central carbon metabolism has been established, including the discoveries that UDP-glucose-activated UgtP and OpgH enzymes inhibit FtsZ assembly until cells reach an appropriate mass (Hill et al., 2013), and that pyruvate may promote Z-ring assembly via PDH E1α (Monahan et al., 2014). On the other hand, the developmental regulator MciZ (mother cell inhibitor of Z), a 40-amino acid peptide produced during B. subtilis sporulation under the control of the transcription factor σE, halts cytokinesis by inhibiting FtsZ (Handler et al., 2008). Finally, several phage-encoded polypeptides interact with FtsZ and delay the host cell division (Ballesteros-Plaza et al., 2013; Kiro et al., 2013; Haeusser et al., 2014).
New antibiotics are urgently needed to fight the widespread emergence of pathogens resistant to current therapeutic options, aggravated by the diminished antibiotic discovery pipeline (Payne, 2008; Boucher et al., 2009; Lewis, 2012; Lin et al., 2015). Inhibition of cell division in B. subtilis does not initially inhibit growth, but after several mass doubling periods it leads to a block in DNA replication followed by a complete cell growth arrest; the quiescent cells enter in a terminal cell-cycle state from which they cannot recover when shifted to permissive conditions (Arjes et al., 2014). These findings strongly support targeting the bacterial cell division machinery for the discovery of new antibacterial agents. Chemical inhibition of FtsZ by small molecules can in fact impair cell division and eventually cause bacterial death, an antibacterial mechanism of action to be clinically explored. The substituted difluorobenzamide PC190723 (Haydon et al., 2008; Czaplewski et al., 2009; Tan et al., 2012) and a few analogs (Stokes et al., 2013, 2014, Kaul et al., 2015, 2016; Lepak et al., 2015) have shown potent activity in animal models of infection, which validated FtsZ as a target for new antibacterials. A relatively large number of compounds have been reported to inhibit the function of FtsZ in bacterial cell division, to perturb purified FtsZ polymerization or its GTPase activity (Anderson et al., 2012; Schaffner-Barbero et al., 2012; den Blaauwen et al., 2014). Some among these inhibitors have demonstrated antibacterial activity, although in many other cases the specificity, FtsZ binding sites and bacterial phenotypic effects have not been clarified. FtsZ GTPase and polymerization screens have also given some conflicting results.
Specific cell-based screens other than simple filament formation are required to seek FtsZ-targeting inhibitors, but they are scarce (Stokes et al., 2005). Bacterial cytological profiling is a rapid and powerful approach for identifying the cellular mechanism of action of antibacterial molecules. It allows distinguishing antibiotics affecting different cellular pathways as well as different targets within the same pathway, using quantitative fluorescence microscopy, without the need for slow and labor-intensive analysis (Lamsa et al., 2012; Nonejuie et al., 2013). Cytological profiling has also been used for rapidly determining antibiotic susceptibility of clinical isolates of Staphylococcus aureus (Quach et al., 2016). In this work, we have characterized the effects on B. subtilis cells of a set of known FtsZ inhibitors and have defined their specific cytological profile; this should allow identifying new molecules targeting FtsZ in primary screening. Using this approach we have discovered that exogenously added synthetic peptide MciZ is an effective inhibitor of FtsZ localization and cell division in B. subtilis.
Materials and Methods
Strains and Fluorescence Microscopy
Bacillus subtilis 168 cells were grown in cation adjusted Mueller-Hinton broth (CAMHB; Becton, Dickinson and Company) at 37°C to an absorbance 0.1–0.2 at 600 nm and then the culture was divided into new flasks containing the compound at the desired concentration. After 3 h of incubation cells were directly observed or first stained with 4,6-diamino-2-phenylindole (DAPI, 0.25 μg/mL; Sigma) and FM4-64 (1 μg/mL; Sigma). For Z-ring analysis B. subtilis strain SU570 (Strauss et al., 2012), kindly donated by Dr. Elisabeth J. Harry (the ithree institute, University of Technology, Sydney, Australia), was grown in Antibiotic Medium 3 at 30°C, incubated with the compounds (1.5 h) and visualized after staining with DAPI and FM4-64.
Escherichia coli experiments were performed with the strain envA1 (Young and Silver, 1991), provided by Merck Sharp & Dohme Corp. (Rahway, NJ, USA). For Z-ring visualization the arabinose inducible plasmid pFtsZ-YFP20 (chloramphenicol resistance) (Keffer et al., 2013), kindly donated by Dr. Carole A. Bewley (NIDDK, NIH, Bethesda, MD, USA), was transformed into strain envA1 via electroporation, and colonies (termed envA1/pFtsZ-YFP) were selected after plating onto LB agar containing 20 μg/mL chloramphenicol. Replicate plates were made, and clones that expressed yellow fluorescence at mid-cell after 15 min induction with 0.4% L-arabinose in LB containing 20 μg/mL chloramphenicol were harvested and stored frozen as glycerol stocks at -80°C. FtsZ-YFP expression was induced as previously described (Keffer et al., 2013) and bacteria were incubated with the compounds (1.5 hour) at desired concentrations.
Aliquot of cells (5 μL) were harvested at appropriate time intervals and visualized with phase contrast or transferred to 1% (w/v) agarose pads, covered, and imaged with fluorescence, using a Zeiss Axioplan microscope equipped with 40x and 100× objectives and a Hamamatsu 4742-95 CCD camera. The fluorescent images in Figures 4, 6, 7A and 9 are contrast inverted for presentation purposes.
FtsZ Inhibitors and Antibiotics
Small molecule FtsZ inhibitors (Supplementary Table S1) were synthesized by the Medicinal Chemistry Laboratory (Dr. María L. López-Rodríguez, Universidad Complutense de Madrid, UCM, Spain) as previously described (Andreu et al., 2010; Ruiz-Avila et al., 2013; Artola et al., 2015), except hemi-chrysophaentin (Keffer et al., 2013) that was kindly provided by Dr. C. Bewley (NIDDK-NIH, Bethesda, MD, USA) and zantrin Z3 that was acquired from the Mcule online drug discovery platform. These compounds were dissolved in dimethyl sulfoxide (DMSO) at appropriate stock concentrations. Residual DMSO in treated cultures and controls was less than 1% in all cases. Peptides MciZ and CRAMP, with the sequences MK VHRMPKGVVLVGKAWEIRAKLKEYGRTFQYVKDWISKP and ISRLAGLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE, respectively, were synthesized in a Liberty Blue instrument (CEM Corp., Matthews, NC) using optimized, microwave-assisted solid-phase protocols and purified by HPLC to > 97% homogeneity. An independently synthesized MciZ batch from commercial sources (Peptide Specialty Laboratories GmbH, Heidelberg, Germany) was also used, of comparable purity and giving identical results in filamentation and Z-ring tests. For assays, peptides were dissolved in distilled water before use. MciZ concentration was measured spectrophotometrically employing an extinction coefficient 13980 M-1cm-1 at 280 nm, calculated from the amino acid sequence. Solutions of antibiotics were prepared in water or DMSO as recommended by the manufacturers. Nisin, vancomycin, carbonyl cyanide m-chlorophenyl hydrazone (CCCP), kanamycin, cerulenin, mitomycin C, cefotaxime and piperacillin (Sigma) were added to the growing bacterial cultures. In the case of daptomycin (provided by Novartis Pharma AG, Switzerland), extra calcium up to 50 μg/ml was employed for optimal activity.
FtsZ inhibitors were employed (unless otherwise indicated) at the minimal concentration that effectively induced filamentation while permitting initial B. subtilis growth (Artola et al., 2015): UCM62 5 μM, UCM78 4 μM, UCM79 4 μM, UCM81 3.5 μM, UCM82 25 μM, UCM93 7.5 μM, UCM95 12.5 μM. PC170942 was employed at 20 μM (Ruiz-Avila et al., 2013); hemi-chrysophaentin (Keffer et al., 2013) at 18 μM, PC190723 at 5.6 μM (Haydon et al., 2008) and MciZ at 1 μM (tested from 0.5 to 40 μM in this work). B. subtilis mass doubling period values were determined from least squares fits of Log (Absorbance 600 nm) versus time in the initial linear region. The fragments of PC190723 (CTPM and DFMBA Andreu et al., 2010), were employed at 1mM concentration. Concentrations of other compounds were: CRAMP 5 μM, zantrin Z3 3.5 μM, totarol 10 μM. Concentrations of antibiotics nisin (10 mg/L), CCCP (100 μM), vancomycin (250 μg/L), and daptomycin (1 mg/L) were those previously used in B. subtilis cytological studies (Lamsa et al., 2012; Pogliano et al., 2012). Concentrations of kanamycin (10 mg/L), cerulenin (15 mg/L), cefotaxime (0.75 mg/L), piperacillin (2 mg/L), and mitomycin C (0.1 mg/L) were adapted from those used in E. coli cytological profiling (Nonejuie et al., 2013). After 3 hours of incubation with antibiotics increased optical density of the cultures was observed, except in the treatments with CCCP, kanamycin and daptomycin, for which cell lengths were measured in the remaining not lysed cells.
Membrane Integrity of B. subtilis Cells
The effect of FtsZ inhibitors on membrane integrity was monitored using the Live/Dead BacLight bacterial viability kit (Molecular Probes). B. subtilis 168 cells were grown at 37°C until absorbance values of 0.2-0.3 and then grown in the absence and presence of FtsZ inhibitors for an additional 30 min. Then, cells were pelleted down, washed with 0.85% NaCl solution and incubated with 18 μM propidium iodide for 30 min at 25°C in 0.85 % NaCl solution. After an additional wash cell suspensions were excited at 470 nm and fluorescence spectra were recorded in the range of 500-700 nm.
Membrane Potential of B. subtilis Cells
Bacillus subtilis 168 cells were grown in Mueller-Hinton supplemented with 0.2% glucose to absorbance 0.1, incubated in the absence or presence of FtsZ inhibitors for 15 minutes and then with 30 μM of 3,3′-diethyloxa-carbocyanine iodide (DiOC2, BacLight Bacterial Membrane Potential Kit from Molecular Probes) for 30 min at 25°C. After two washes with phosphate buffered saline pH 7.4 supplemented with 0.1% glucose, fluorescence emission was measured using 488 nm as the excitation wavelength. The ratio of red (575 nm) to green (530 nm) fluorescence intensity was used as an indicator of membrane potential.
Cytological Profiling
Cell parameters were measured using the analysis tools of Wasabi software (Hamamatsu). Line profiles were drawn on cell stained with FM4-64 to measure cell length distinguishing from potential cell chaining. DNA staining with DAPI was employed to measure nucleoid length. For Z-rings cytological analysis, we operatively defined a Z-ring as a continuous band of FtsZ-GFP across the width of the cell; the distance between Z-rings was measured using the line profile analysis tool. We defined FtsZ foci as any (punctate or large) accumulation of FtsZ-GFP that does not fulfill the criteria for a Z-ring.
Cell parameters for each treatment were obtained from three or more independent experiments. Before statistical Student’s t-test, outliers were removed (Lower limit = Q1-1.5(IQR); Upper limit = Q3 + 1.5(IQR). The deviation represented in graphics corresponds to the standard error. Principal component analysis (PCA) and hierarchical cluster analysis were performed using the XLSTAT (version 2015.1.02) program on Microsoft Excel for Windows.
Biochemical Methods
Bacillus subtilis FtsZ and E. coli FtsZ proteins were purified, and their polymerization characterized by sedimentation, light scattering and GTPase activity assays in 50 mM Hepes/KOH, 50 mM KCl, 1 mM EDTA, 10 mM MgCl2, 1 mM GTP, pH 6.8 at 25 °C as previously described (Ruiz-Avila et al., 2013).
Results and Discussion
To define the cytological profile of chemical FtsZ inhibitors we selected molecules that bind to different sites in FtsZ (Figure 1): (i) GTP-replacing FtsZ inhibitors from our in-house synthetic library (UCM62, UCM78, UCM79, UCM81, UCM82, UCM93, UCM95) (Artola et al., 2015); (ii) a GTP-replacing fragment of the natural FtsZ inhibitor crysophaentin (Hemi-chrys; Keffer et al., 2013); (iii) the well-known inhibitor PC190723 that binds in the cleft between FtsZ’s nucleotide binding and C-terminal domains (Haydon et al., 2008; Andreu et al., 2010; Adams et al., 2011; Elsen et al., 2012), and (iv) the effective inhibitor PC170942 (Stokes et al., 2005) binding to an undetermined site on FtsZ (Ruiz-Avila et al., 2013). Each of the small molecules in classes (i) to (iv) has been documented to possess antibacterial activity on B. subtilis and methycilin resistant S. aureus (MRSA) (Supplementary Table S1).
FIGURE 1
Defining a Relevant Filamentous Phenotype for FtsZ Inhibitors in B. subtilis
One hallmark of bacterial cell division inhibition is the induction of an enlarged phenotype, caused by the initially continuing growth without division. In order to quantitatively characterize this effect we measured the length of wild type B. subtilis 168 cells incubated with our FtsZ inhibitor panel, as well as with several known antibiotics of different mechanisms of action. The treatment with each of the above FtsZ inhibitors produced a statistically significant increase of the average cell length with respect to the untreated control (Figure 2, black bars), at effective concentrations not markedly affecting initial growth (except UCM95 and PC170942; Supplementary Table S1). However, several of the antibiotics that do not act on cell division but target cell wall (vancomycin, cefotaxime, and piperacillin), cell membrane (cerulenin and daptomycin) or protein synthesis (kanamycin) also produced significantly elongated cells (Figure 2, gray bars). For that, a more stringent criterion to identify relevant FtsZ inhibitors is an increase of the cell length significantly larger than the non specific increase produced by antibiotics. This is shown by the dash line in Figure 2, which corresponds approximately to three times the length of the not treated B. subtilis cells. On the other hand, DNA cross-linker antibiotics such as mitomycin C, indirectly inhibit cell division leading to a marked increase in cell length (Figure 2, white bar). However, criteria such as nucleoid length or Z-ring morphology, allow distinguishing them from FtsZ inhibitors as will be shown later. Notice that other growth conditions or bacterial strains may give different results, but we found always advisable the comparison with control antibiotics not acting on cell division. In our case, the small molecule inhibitors that fulfill the set requirement with probability p < 0.05 are: UCM81, UCM93, UCM95, hemi-chrysophaentin, PC170942, DFMBA, and PC190723.
FIGURE 2
We also tested other FtsZ inhibitors from the literature, such as zantrin Z3 (Margalit et al., 2004; Anderson et al., 2012) but a lack of effect on B. subtilis cell length was observed. During these experiments, we unexpectedly found that the addition of synthetic peptide MciZ (1-5 μM) to the growing medium induces a marked filamentation of B. subtilis. Previous studies had shown that intracellular MciZ expression leads to the formation of filaments that are deficient in Z-rings (Handler et al., 2008; Bisson-Filho et al., 2015), but the effects of exogenous MciZ had not been observed. We also analyzed the effect of the antimicrobial peptide CRAMP, which shares part of the MciZ sequence, but found an insignificant increase in average cell length (9.4 ± 0.8 μm) with respect to the control (7.3 ± 1.1 μm; p > 0.5), quite below the threshold (17.9 ± 2.1 μm) of relevant filamentation of B. subtilis cells (Figure 2), in agreement with previous results (Handler et al., 2008). For convenience, the cytological effects of MciZ are shown below with those of the small molecule inhibitors, but they will be separately analyzed and discussed later.
The Biochemical Profiles of PC190723 Fragments Explain Their Cellular Activities
The PC190723 fragment DFMBA (2,6-difluoro-3-hydroxybenzamide) was included in the group of active compounds inducing B. subtilis cell filamentation. DFMBA appears responsible for the activity of PC190723, as the other moiety CTPM ((6-chloro [1,3]tiazol[5,4-b]pyridin-2-yl) methanol), did not fulfill the p < 0.05 criterion for relevant cell elongation (Figure 2). In order to explain these cellular results and to improve biochemical profiling methods for FtsZ inhibitors, we have analyzed in detail the effects of PC190723 and its fragments on the polymerization and GTPase activity of FtsZ from B. subtilis. GTPase activity is a consequence of FtsZ assembly, because the active site is completed between consecutive monomers in FtsZ filaments. We have thus observed a direct correlation between the bulk GTPase rate and BsFtsZ polymer concentration in the solution (Figure 3A). Both appear above a critical BsFtsZ concentration (Cr, the minimal concentration of protein monomers needed for cooperative polymerization) and then grow linearly with the total protein concentration. This parallelism is abrogated by PC190723, due to an inhibition of the GTPase activity of BsFtsZ polymers and the decrease in Cr by polymer stabilization (Figure 3B; Supplementary Table S2). The PC190723 fragment DFMBA reduced Cr with respect to control and inhibited the GTPase activity (Figure 3C; Supplementary Table S2), similarly to PC190723. However, the fragment CTPM only weakly modified GTPase activity and Cr (Figure 3D; Supplementary Table S2). These results indicate that DFMBA is the active moiety of PC190723, whereas the CTPM part enhances binding (Andreu et al., 2010) by means of hydrophobic interactions (Tan et al., 2012), providing an explanation for the cell filamentation results.
FIGURE 3
Notice that conflicting results were reported (Anderson et al., 2012) when attempting to reproduce previously observed FtsZ GTPase activity changes induced by PC190723 (Haydon et al., 2008; Andreu et al., 2010). This may be explained by the results in Figure 3 that show how apparent GTPase activation, inhibition or weak effects relative to controls can be measured if single FtsZ concentrations are employed. Simplified biochemical tests with FtsZ assembly modulators may give complicated results, lead to unproductive screens or to conflicting interpretations, particularly for individual GTPase activity assays in the absence of other information. When a suitable binding assay is available (Ruiz-Avila et al., 2013), we prefer determination of specific binding affinity to FtsZ, which in fact predicted antibacterial activity in the UCM inhibitor series (Artola et al., 2015).
FtsZ-Targeting Cell Division Inhibitors Induce Aberrantly Positioned Z-Rings
The effects of the selected inhibitors in FtsZ subcellular localization was analyzed in B. subtilis SU570, a strain that has FtsZ fused to green fluorescent protein (FtsZ-GFP) as the only FtsZ protein (Strauss et al., 2012). The GTP-replacing inhibitors, as well as PC170942, produced alterations in the regular midcell distribution of Z-rings and the appearance of punctate FtsZ foci (Figure 4; see Materials and Methods). PC190723 produced a large number of foci throughout the cells lacking Z-rings, in agreement with the known effects of benzamide inhibitors (Haydon et al., 2008; Adams et al., 2011). However, hemi-chrysophaentin and PC170942 increased the number of Z-rings, and MciZ decreased it, whereas no significant difference was found with the other inhibitors (Supplementary Table S3). Cells exposed to zantrin Z3 showed similar Z-rings to control cells. With the aim to verify if the observed phenotypes were specific for FtsZ inhibitors, B. subtilis SU570 cells were exposed to different antibiotics. CCCP, kanamycin and vancomycin altered the distribution of the Z-rings; nisin, daptomycin, cefotaxime, and mitomycin C did not, and cerulenin caused a marked appearance of FtsZ foci. Quantification of the number of foci (Figure 4) showed that, except in the case of inhibitors PC190723 and PC170942, the number of FtsZ foci was significantly greater than in the control but no larger than observed with cerulenin. Therefore, FtsZ foci should not be considered as a single adequate criterion to differentiate specific FtsZ inhibitors.
FIGURE 4
We found that analyzing the distribution of rings throughout the cell allowed to clearly differentiate cells treated with FtsZ inhibitors from untreated controls and from cells treated with other antibiotics (Figure 5). Control cells had regularly distributed Z-rings and most of the rings (97%) were normally spaced at distances comprised between 2.5 and 5 μm. Treatment with FtsZ inhibitors induced wider, aberrant Z-ring distributions, reducing the proportion of normally spaced rings and increasing the percentage of closer or more distant rings, particularly in cells treated with UCM81 (Figure 5A) or with MciZ (Figure 5D). The other inhibitors were classified as producing intermediate effects (Figures 5B,C). Finally, in cells treated with control antibiotics (nisin, cerulenin, daptomycin, cefotaxime and mitomycin C) more than 60% of the rings were separated a distance of 2.5-5 μm similarly to the untreated control (Figure 5E). Therefore, we conclude that specific FtsZ inhibitors are characterized by either suppressing ring formation or causing an aberrant distribution of rings along the cell, consisting of an increase of closer rings or more distant rings at the expense of the correctly positioned mid-cell rings.
FIGURE 5
Specific FtsZ Inhibitors Induce Membrane Spots Without Affecting Membrane Potential and Permeability
Next steps on the cytological characterization of FtsZ inhibitors were to determine their possible effect on membrane morphology and membrane permeability. To visualize membranes we used the vital stain FM4-64. As can be observed in Figure 6, inhibitors UCM81, hemi-chrysophaentin and PC190723 caused a significant increase of membrane stained spots randomly distributed through the cell. By contrast, the membrane morphology observed in cells treated with inhibitors UCM93, UCM95, and PC170942 was more similar to control cells. MciZ frequently increased membrane staining around division septa rather than inducing disperse membrane spots. Following the trend of our study we also analyzed the effect of different known antibiotics on membrane morphology. Vancomycin, CCCP, kanamycin, and daptomycin induced abundant membrane spots compatible with previously observed morphologies (Lamsa et al., 2012; Pogliano et al., 2012; Nonejuie et al., 2013). Thus, membrane spots by themselves do not allow discerning specific FtsZ inhibitors from the non-specific effects of other antibiotics.
FIGURE 6
To test whether FtsZ inhibitors increased the permeability of B. subtilis membranes we used propidium iodide (PI) (Supplementary Figure S1A). The cellular uptake of PI increases with increasing membrane permeability and then this dye emits red fluorescence (γemission = 620 nm) upon binding to DNA. When B. subtilis cells were grown with FtsZ inhibitors and stained with PI the red fluorescence was similar to control cells. When cells were treated with nisin (10 mg/L) the red fluorescence detected was significantly higher than in the control. Protonophores such as CCCP alter membrane potential, but do not allow passage of other solutes. Thus, PI fluorescence did not increase in cells treated with CCCP (Supplementary Figure S1A). This response is similar to antibiotics such as daptomycin, which increases the flux of K+ ions across the membrane, but has not effect on PI uptake (Silverman et al., 2003). Alkyl gallate FtsZ inhibitors affect membrane integrity (Krol et al., 2015), however, our effective FtsZ inhibitors do not perturb membrane integrity of B. subtilis cells.
It has been noted that disruption of membrane potential inhibits cell division by detachment of the divisomal machinery from the membrane (Strahl and Hamoen, 2010) and several FtsZ inhibitors have been reported to alter membrane potential and permeability (Foss et al., 2013). To determine if our selected FtsZ inhibitors altered the membrane potential, cells of B. subtilis 168 were incubated with the compounds and stained with 3,3′-diethyloxa-carbocyanine iodide (DiOC2), a fluorophore that emits green fluorescence in solution and shifts toward the red when concentrated at the cell membrane. Values of red to green fluorescence emission ratio are indicative of the membrane potential. The fluorescence ratio I575/I530 in cells treated with FtsZ inhibitors was similar to control cells, except for decreases observed with PC170942 and with totarol, a compound that alters membrane potential and permeability and thus affects FtsZ localization (Foss et al., 2013). CCCP (10 μM), a known membrane potential inhibitor, decreased I575/I530 significantly (p < 0.01) compared to the control (Supplementary Figure S1B).
FtsZ Inhibitors Modify Nucleoid Morphology
To analyze nucleoid morphology, B. subtilis 168 cells treated with the selected inhibitors were stained with DAPI and visualized under the microscope. Two different effects of the FtsZ inhibitors were observed (Figure 7A): UCM81, UCM93, hemi-chrysophaentin, and PC170942 lead to fragmented short nucleoids compared to control cells; by contrast, the treatments with PC190723 or MciZ provoked the appearance of longer nucleoids than in control cells. Quantitative analysis of these observations, determining nucleoid length, supported the existence of these two distinct groups of inhibitors (Figure 7A, graphic). The more marked nucleoid fragmentation was caused by UCM81, which in turn was the inhibitor for which a larger number of closer rings were detected (Figure 5A). In this case, abnormally close FtsZ-GFP rings match nucleoid constriction zones; and nucleoid constrictions where rings are not observed may correspond to aborted rings, or to previous rings that have already disappeared (Figure 7B). On the other hand, longer nucleoids correlated with more spaced rings with MciZ, or with absence of rings with PC190723. The enlarged nucleoids with PC190723 extend among non-constricting FtsZ-GFP foci (Figure 7B). Thus, each class of abnormal nucleoid morphology might reflect a different impairment of the cell division ring: constricted nucleoids may be caused by abnormally close Z-rings whereas the elongated nucleoids might be suggested to fill the regions without Z-rings. Alternatively, the effects on the Z-ring could be attributed to off-target changes in nucleoid shape (via nucleoid occlusion activity); however, this appears quite unlikely for the best characterized FtsZ inhibitor PC190723, the regulator MciZ and the chemically different UCM81 and PC170942 inhibitors all together. In practice, using nucleoid fragmentation alone we could not distinguish FtsZ inhibition from similar effects caused by three control antibiotics (CCCP, cerulenin, vancomycin; Figure 7A), however, the latter could be distinguished by the lack of significant filamentation (Figure 2). On the other hand, the very long nucleoids observed with mitomycin C distinguish this DNA targeting antibiotic from FtsZ inhibitors (Figure 7A), although both induced comparable filamentous phenotypes (Figure 2).
FIGURE 7
A Lack of Effective Inhibitors of E. coli Cell Division Targeting FtsZ
The cytological effects of FtsZ inhibitors were also characterized in the Gram-negative bacterium E. coli. To overcome the physical barrier imposed by the outer membrane we used the envA1 E. coli strain that is permeable to antibiotics and dyes (Young and Silver, 1991). Only with compounds UCM81 (5 μM), PC190723 (10 μM), CRAMP (10 μM), and hemi-chrysophaentin (340 μM) we found some undivided longer cells (Supplementary Figure S2), representing only 3-5% of the total cell population. These minority long cells showed extensively fragmented nucleoids, altered Z-ring distributions and some FtsZ foci (Supplementary Figure S2). The Z-ring impairment observed with hemi-chrysophaentin was similar to the previously reported morphology (Keffer et al., 2013). These effects appeared specific of FtsZ inhibitors because treatment with control antibiotics did not affect Z-rings (Supplementary Figure S3). We report these effects on a minority of cells solely as examples of practically negative results that could be confused with a relevant FtsZ inhibition if the whole cell population was not analyzed.
It has been reported that TXY436, a prodrug of PC190723, induces changes in the morphology of E. coli and Klebsiella pneumoniae consistent with inhibition of cell division when the RND-type efflux pump activity is genetically or chemically inhibited (Kaul et al., 2014). Consequently, we evaluated the possible effect of our selected FtsZ inhibitors in the E. coli MG1622 wild type strain cultured in the presence of the efflux pump inhibitor PAβN (Pages et al., 2005). However, the results obtained were similar to those with the envA1 strain, in which no significant effects of the FtsZ inhibitor on average cell length were observed.
We further investigated the causes for the lack of susceptibility of E. coli to PC190723, analyzing its effects on GTPase activity and polymerization of FtsZ from E. coli (EcFtsZ) (Figure 3E). In this case, PC190723 did not disable the correlation between GTPase activity and polymerization as for BsFtsZ (compare Figure 3F with Figure 3B), because it insignificantly modified Cr and only weakly increased the GTPase activity of EcFtsZ polymers (Supplementary Table S2). The small GTPase increase has been attributed to non-specific or ineffective binding of PC190723 to EcFtsZ (Andreu et al., 2010). The biochemical profiles of PC190723 on BsFtsZ and EcFtsZ thus explain the irrelevant effect that we have found on the envA1 E. coli permeable cells. They support the susceptibility of certain Gram-positive bacteria compared to the resistance of Gram-negative bacteria to PC190723, which tracks to having Val307 at the ligand binding site rather than Arg or His residues (Haydon et al., 2008).
In conclusion, although we could document cytological alterations induced by selected FtsZ inhibitors on E. coli cells, the affected cells are only a small fraction not representative of the population, rendering the compounds essentially ineffective in this Gram-negative bacterium. Our cytological and biochemical results with selected inhibitors underscore a current scarcity of effective FtsZ-targeting inhibitors for Gram-negative bacteria, although we cannot exclude that other compounds from the literature may work.
Categorizing FtsZ Inhibitors and Synthetic Peptide MciZ in B. subtilis
To quantitatively analyze the set of results obtained with B. subtilis cells we performed principal component analysis (PCA) based on our cytological parameters: cell length, number of Z-rings/μm, number of FtsZ foci/μm, number of membrane spots/μm, nucleoid length and Z-rings distance distribution in four intervals (Supplementary Table S4). The results obtained from this analysis allowed us to classify cells with similar morphologies and establish which variables are necessary and sufficient to differentiate specific FtsZ inhibitors from non-specific antibiotic effects, as well as FtsZ inhibitors among them. As was observed previously in the individual analysis of the number of membrane spots or FtsZ foci, including these variables in the PCA did not make possible to differentiate FtsZ inhibitors from other antibiotics. Then, removing variables in successive PCA tests lead to determine a minimal set of variables that are enough to categorize FtsZ inhibitors (Figure 8). PCA based on variables “cell length” and “nucleoid length” allows to distinguish FtsZ inhibitors from other antibiotics, with the exception of hemi-chrysophaentin (the less effective FtsZ inhibitor included). Using the variable “Z-ring distribution” in the PCA lead to a complete separation of FtsZ inhibitors form other antibiotics, although this has the disadvantage that it is not applicable to those inhibitors that cause the complete absence of Z-rings such as PC190723, and it requires using a modified strain expressing FtsZ-FP or to carry out immunofluorescence assays.
FIGURE 8
The set of results obtained analyzing the cytological profile of FtsZ inhibitors compared with the phenotypic effects induced by other antibiotics allow to establish guidelines for identifying FtsZ inhibitors. There are two morphological parameters that should be analyzed for screening potential FtsZ inhibitors: the cell length and the nucleoid length. For further studies and categorizing FtsZ inhibitors identified in the screening we suggest analyzing the distribution of Z-rings.
Using our cytological profile approach for FtsZ inhibitors we have identified exogenous MciZ as an effective inhibitor of B. subtilis cell division. The crystal structure of the FtsZ-MciZ complex has shown that MciZ blocks the C-terminal association interface of FtsZ, and a minus-end FtsZ filament capping mechanism has been proposed for this developmental regulator, which substoichiometrically inhibits FtsZ assembly when expressed in B. subtilis cells (Bisson-Filho et al., 2015). We have now observed that, similarly to the effects of several small molecule FtsZ inhibitors, MciZ addition to the culture medium leads to the formation of long undivided cells (Figure 2), but these have quite sparsely distributed Z-rings along them (Figures 4 and 5D). MciZ did not induce membrane spots (Figure 6) and did not impair membrane potential (Supplementary Figure S1B). MciZ increased the nucleoid length (Figure 7), reflecting a longer distance between Z-rings than in the case of small molecule inhibitors, which categorized peptide MciZ as a separate class among FtsZ inhibitors (Figure 8). This new finding validates our cytological profiling approach for FtsZ inhibitors. The remarkable filamentation effect of exogenous MciZ on B. subtilis (Figure 9), resembling the endogenous MciZ effects (Handler et al., 2008; Bisson-Filho et al., 2015), raises the question of how MciZ penetrates the cells and suggests new possibilities for designing synthetic peptide inhibitors of bacterial cell division.
FIGURE 9
Conclusion
We have determined the cytological effects caused by selected cell division inhibitors targeting different binding sites of B. subtilis FtsZ. The analysis of cell length, Z-rings, nucleoid morphology, membrane morphology, and permeability allowed us to establish the cytological profile of chemical FtsZ inhibitors, as well as the criteria that distinguish them from antibiotics with other mechanisms of action. Quantifying cell length and nucleoid length should be sufficient to screen potential FtsZ inhibitors. The distribution of Z-rings may be employed for detailed studies and categorizing FtsZ inhibitors. In addition, biochemical profiling with FtsZ polymerization and GTPase assays may be used, as exemplified for PC190723 action on B. subtilis FtsZ and its lack of effect on the Gram-negative E. coli FtsZ; when possible, specific binding assays to determine the affinity of inhibitor binding to FtsZ are preferable. We have applied cytological profiling to the mother cell inhibitor MciZ, normally an endogenous regulator for sporulation, with the finding that exogenously added synthetic MciZ peptide is able to effectively inhibit cell division in B. subtilis cells by targeting FtsZ.
Statements
Author contributions
LA-B, DA, JA designed the work; LA-B, LR-A, SH performed experiments; LA-B, DA, SH, JA analyzed results; LA-B, JA wrote the paper with input from all authors, who revised and approved the final paper.
Funding
This work was supported by grants BFU2014-51823-R and CM 2010/BMD-2353 to JA.
Acknowledgments
We especially thank Prof. M. L. López-Rodríguez’s laboratory, Universidad Complutense de Madrid, for the synthesis of the UCM inhibitors, PC190723 and PC170942, and for critical reading of the manuscript; Drs. P. Castellen and A. W. Bisson-Filho, University of Sao Paulo, Brasil, for a first sample of synthetic MciZ and helpful feedback. We thank Dr. E. J. Harry for the B. subtilis SU570 strain, Dr. C. A. Bewley for hemi-chrysophaentin and plasmid pFtsZ-YFP20, Merck Sharp & Dohme Corp. for the E. coli envA1 strain and Novartis Pharma AG for daptomycin. We thank David Juan for FtsZ purification.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: http://journal.frontiersin.org/article/10.3389/fmicb.2016.01558
References
1
AdamsD. W.ErringtonJ. (2009). Bacterial cell division: assembly, maintenance and disassembly of the Z ring.Nat. Rev. Microbiol.7642–653. 10.1038/nrmicro2198
2
AdamsD. W.WuL. J.CzaplewskiL. G.ErringtonJ. (2011). Multiple effects of benzamide antibiotics on FtsZ function.Mol. Microbiol.8068–84. 10.1111/j.1365-2958.2011.07559.x
3
AdamsD. W.WuL. J.ErringtonJ. (2015). Nucleoid occlusion protein Noc recruits DNA to the bacterial cell membrane.EMBO J.34491–501. 10.15252/embj.201490177
4
AndersonD. E.KimM. B.MooreJ. T.O’BrienT. E.SortoN. A.GroveC. I.et al (2012). Comparison of small molecule inhibitors of the bacterial cell division protein FtsZ and identification of a reliable cross-species inhibitor.ACS Chem. Biol.71918–1928. 10.1021/cb300340j
5
AndreuJ. M.Schaffner-BarberoC.HuecasS.AlonsoD.Lopez-RodriguezM. L.Ruiz-AvilaL. B.et al (2010). The antibacterial cell division inhibitor PC190723 is an FtsZ polymer-stabilizing agent that induces filament assembly and condensation.J. Biol. Chem.28514239–14246. 10.1074/jbc.M109.094722
6
ArjesH. A.KrielA.SortoN. A.ShawJ. T.WangJ. D.LevinP. A. (2014). Failsafe mechanisms couple division and DNA replication in bacteria.Curr. Biol.242149–2155. 10.1016/j.cub.2014.07.055
7
ArtolaM.Ruiz-AvilaL. B.VergonosA.HuecasS.Araujo-BazanL.Martin-FontechaM.et al (2015). Effective GTP-replacing FtsZ inhibitors and antibacterial mechanism of action.ACS Chem. Biol.10834–843. 10.1021/cb500974d
8
Ballesteros-PlazaD.HolgueraI.ScheffersD. J.SalasM.Munoz-EspinD. (2013). Phage 29 phi protein p1 promotes replication by associating with the FtsZ ring of the divisome in Bacillus subtilis.Proc. Natl. Acad. Sci. U.S.A.11012313–12318. 10.1073/pnas.1311524110
9
BernhardtT. G.de BoerP. A. (2005). SlmA, a nucleoid-associated, FtsZ binding protein required for blocking septal ring assembly over chromosomes in E. coli.Mol. Cell18555–564. 10.1016/j.molcel.2005.04.012
10
BiE.LutkenhausJ. (1993). Cell division inhibitors SulA and MinCD prevent formation of the FtsZ ring.J. Bacteriol.1751118–1125.
11
BiE. F.LutkenhausJ. (1991). FtsZ ring structure associated with division in Escherichia coli.Nature354161–164. 10.1038/354161a0
12
Bisson-FilhoA. W.DiscolaK. F.CastellenP.BlasiosV.MartinsA.SforcaM. L.et al (2015). FtsZ filament capping by MciZ, a developmental regulator of bacterial division.Proc. Natl. Acad. Sci. U.S.A.112E2130–E2138. 10.1073/pnas.1414242112
13
BiteenJ. S.GoleyE. D.ShapiroL.MoernerW. E. (2012). Three-dimensional super-resolution imaging of the midplane protein FtsZ in live Caulobacter crescentus cells using astigmatism.Chemphyschem131007–1012. 10.1002/cphc.201100686
14
BoucherH. W.TalbotG. H.BradleyJ. S.EdwardsJ. E.GilbertD.RiceL. B.et al (2009). Bad bugs, no drugs: no ESKAPE! An update from the Infectious Diseases Society of America.Clin. Infect. Dis.481–12. 10.1086/595011
15
BuskeP. J.LevinP. A. (2012). Extreme C terminus of bacterial cytoskeletal protein FtsZ plays fundamental role in assembly independent of modulatory proteins.J. Biol. Chem.28710945–10957. 10.1074/jbc.M111.330324
16
BuskeP. J.MittalA.PappuR. V.LevinP. A. (2015). An intrinsically disordered linker plays a critical role in bacterial cell division.Semin. Cell Dev. Biol.373–10. 10.1016/j.semcdb.2014.09.017
17
BussJ.ColtharpC.ShtengelG.YangX.HessH.XiaoJ. (2015). A multi-layered protein network stabilizes the Escherichia coli FtsZ-ring and modulates constriction dynamics.PLoS Genet.11:e1005128. 10.1371/journal.pgen.1005128
18
ColtharpC.BussJ.PlumerT. M.XiaoJ. (2016). Defining the rate-limiting processes of bacterial cytokinesis.Proc. Natl. Acad. Sci. U.S.A.113E1044–E1053. 10.1073/pnas.1514296113
19
CordellS. C.RobinsonE. J.LoweJ. (2003). Crystal structure of the SOS cell division inhibitor SulA and in complex with FtsZ.Proc. Natl. Acad. Sci. U.S.A.1007889–7894. 10.1073/pnas.1330742100
20
CzaplewskiL. G.CollinsI.BoydE. A.BrownD.EastS. P.GardinerM.et al (2009). Antibacterial alkoxybenzamide inhibitors of the essential bacterial cell division protein FtsZ.Bioorg. Med. Chem. Lett.19524–527. 10.1016/j.bmcl.2008.11.021
21
den BlaauwenT.AndreuJ. M.MonasterioO. (2014). Bacterial cell division proteins as antibiotic targets.Bioorg. Chem.5527–38. 10.1016/j.bioorg.2014.03.007
22
EganA. J.VollmerW. (2013). The physiology of bacterial cell division.Ann. N. Y. Acad. Sci.12778–28. 10.1111/j.1749-6632.2012.06818.x
23
ElsenN. L.LuJ.ParthasarathyG.ReidJ. C.SharmaS.SoissonS. M.et al (2012). Mechanism of action of the cell-division inhibitor PC190723: modulation of FtsZ assembly cooperativity.J. Am. Chem. Soc.13412342–12345. 10.1021/ja303564a
24
EricksonH. P.AndersonD. E.OsawaM. (2010). FtsZ in bacterial cytokinesis: cytoskeleton and force generator all in one.Microbiol. Mol. Biol. Rev.74504–528. 10.1128/MMBR.00021-10
25
FeuchtA.ErringtonJ. (2005). ftsZ mutations affecting cell division frequency, placement and morphology in Bacillus subtilis.Microbiology1512053–2064. 10.1099/mic.0.27899-0
26
FossM. H.EunY. J.GroveC. I.PauwD. A.SortoN. A.RensvoldJ. W.et al (2013). Inhibitors of bacterial tubulin target bacterial membranes.Medchemcomm4112–119. 10.1039/C2MD20127E
27
FuG.HuangT.BussJ.ColtharpC.HenselZ.XiaoJ. (2010). In vivo structure of the E. coli FtsZ-ring revealed by photoactivated localization microscopy (PALM).PLoS ONE5:e12682. 10.1371/journal.pone.0012680
28
HaeusserD. P.HoashiM.WeaverA.BrownN.PanJ.SawitzkeJ. A.et al (2014). The Kil peptide of bacteriophage lambda blocks Escherichia coli cytokinesis via ZipA-dependent inhibition of FtsZ assembly.PLoS Genet.10:e1004217. 10.1371/journal.pgen.1004217
29
HaeusserD. P.MargolinW. (2016). Splitsville: structural and functional insights into the dynamic bacterial Z ring.Nat. Rev. Microbiol.14305–319. 10.1038/nrmicro.2016.26
30
HandlerA. A.LimJ. E.LosickR. (2008). Peptide inhibitor of cytokinesis during sporulation in Bacillus subtilis.Mol. Microbiol.68588–599. 10.1111/j.1365-2958.2008.06173.x
31
HaydonD. J.StokesN. R.UreR.GalbraithG.BennettJ. M.BrownD. R.et al (2008). An inhibitor of FtsZ with potent and selective anti-staphylococcal activity.Science3211673–1675. 10.1126/science.1159961
32
HillN. S.BuskeP. J.ShiY.LevinP. A. (2013). A moonlighting enzyme links Escherichia coli cell size with central metabolism.PLoS Genet.9:e1003663. 10.1371/journal.pgen.1003663
33
HoldenS. J.PengoT.MeibomK. L.Fernandez FernandezC.CollierJ.ManleyS. (2014). High throughput 3D super-resolution microscopy reveals Caulobacter crescentus in vivo Z-ring organization.Proc. Natl. Acad. Sci. U.S.A.1114566–4571. 10.1073/pnas.1313368111
34
KaulM.MarkL.ParhiA. K.LaVoieE. J.PilchD. S. (2016). Combining the FtsZ-Targeting Prodrug TXA709 and the cephalosporin cefdinir confers synergy and reduces the frequency of resistance in methicillin-resistant Staphylococcus aureus.Antimicrob. Agents Chemother.604290–4296. 10.1128/AAC.00613-16
35
KaulM.MarkL.ZhangY.ParhiA. K.LyuY. L.PawlakJ.et al (2015). TXA709, an FtsZ-targeting benzamide prodrug with improved pharmacokinetics and enhanced in vivo efficacy against methicillin-resistant Staphylococcus aureus.Antimicrob. Agents Chemother.594845–4855. 10.1128/AAC.00708-15
36
KaulM.ZhangY.ParhiA. K.LavoieE. J.PilchD. S. (2014). Inhibition of RND-type efflux pumps confers the FtsZ-directed prodrug TXY436 with activity against Gram-negative bacteria.Biochem. Pharmacol.89321–328. 10.1016/j.bcp.2014.03.002
37
KefferJ. L.HuecasS.HammillJ. T.WipfP.AndreuJ. M.BewleyC. A. (2013). Chrysophaentins are competitive inhibitors of FtsZ and inhibit Z-ring formation in live bacteria.Bioorg. Med. Chem.215673–5678. 10.1016/j.bmc.2013.07.033
38
KiroR.Molshanski-MorS.YosefI.MilamS. L.EricksonH. P.QimronU. (2013). Gene product 0.4 increases bacteriophage T7 competitiveness by inhibiting host cell division.Proc. Natl. Acad. Sci. U.S.A.11019549–19554. 10.1073/pnas.1314096110
39
KrolE.de Sousa BorgesA.da SilvaI.PolaquiniC. R.RegasiniL. O.FerreiraH.et al (2015). Antibacterial activity of alkyl gallates is a combination of direct targeting of FtsZ and permeabilization of bacterial membranes.Front. Microbiol.6:390. 10.3389/fmicb.2015.00390
40
LamsaA.LiuW. T.DorresteinP. C.PoglianoK. (2012). The Bacillus subtilis cannibalism toxin SDP collapses the proton motive force and induces autolysis.Mol. Microbiol.84486–500. 10.1111/j.1365-2958.2012.08038.x
41
LepakA. J.MarchilloK.CraigW. A.AndesD. R. (2015). In vivo pharmacokinetics and pharmacodynamics of the lantibiotic NAI-107 in a neutropenic murine thigh infection model.Antimicrob. Agents Chemother.591258–1264. 10.1128/AAC.04444-14
42
LewisK. (2012). Antibiotics: recover the lost art of drug discovery.Nature485439–440. 10.1038/485439a
43
LinJ.NishinoK.RobertsM. C.TolmaskyM.AminovR. I.ZhangL. (2015). Mechanisms of antibiotic resistance.Front. Microbiol.6:34. 10.3389/fmicb.2015.00034
44
LutkenhausJ.PichoffS.DuS. (2012). Bacterial cytokinesis: from Z ring to divisome.Cytoskeleton (Hoboken)69778–790. 10.1002/cm.21054
45
MargalitD. N.RombergL.MetsR. B.HebertA. M.MitchisonT. J.KirschnerM. W.et al (2004). Targeting cell division: small-molecule inhibitors of FtsZ GTPase perturb cytokinetic ring assembly and induce bacterial lethality.Proc. Natl. Acad. Sci. U.S.A.10111821–11826. 10.1073/pnas.0404439101
46
MargolinW. (2005). FtsZ and the division of prokaryotic cells and organelles.Nat. Rev. Mol. Cell Biol.6862–871. 10.1038/nrm1745
47
MatsuiT.YamaneJ.MogiN.YamaguchiH.TakemotoH.YaoM.et al (2012). Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus.Acta Crystallogr. D. Biol. Crystallogr.681175–1188. 10.1107/S0907444912022640
48
MeierE. L.GoleyE. D. (2014). Form and function of the bacterial cytokinetic ring.Curr. Opin. Cell Biol.2619–27. 10.1016/j.ceb.2013.08.006
49
MonahanL. G.HajdukI. V.BlaberS. P.CharlesI. G.HarryE. J. (2014). Coordinating bacterial cell division with nutrient availability: a role for glycolysis.MBio5e00935-14. 10.1128/mBio.00935-14
50
NonejuieP.BurkartM.PoglianoK.PoglianoJ. (2013). Bacterial cytological profiling rapidly identifies the cellular pathways targeted by antibacterial molecules.Proc. Natl. Acad. Sci. U.S.A.11016169–16174. 10.1073/pnas.1311066110
51
OlivaM. A.CordellS. C.LoweJ. (2004). Structural insights into FtsZ protofilament formation.Nat. Struct. Mol. Biol.111243–1250. 10.1038/nsmb855
52
PagesJ. M.MasiM.BarbeJ. (2005). Inhibitors of efflux pumps in Gram-negative bacteria.Trends Mol. Med.11382–389. 10.1016/j.molmed.2005.06.006
53
PayneD. J. (2008). Microbiology. Desperately seeking new antibiotics.Science3211644–1645. 10.1126/science.1164586
54
PoglianoJ.PoglianoN.SilvermanJ. A. (2012). Daptomycin-mediated reorganization of membrane architecture causes mislocalization of essential cell division proteins.J. Bacteriol.1944494–4504. 10.1128/JB.00011-12
55
QuachD. T.SakoulasG.NizetV.PoglianoJ.PoglianoK. (2016). Bacterial Cytological Profiling (BCP) as a rapid and accurate antimicrobial susceptibility testing method for Staphylococcus aureus.EBioMedicine495–103. 10.1016/j.ebiom.2016.01.020
56
RedickS. D.StrickerJ.BriscoeG.EricksonH. P. (2005). Mutants of FtsZ targeting the protofilament interface: effects on cell division and GTPase activity.J. Bacteriol.1872727–2736. 10.1128/JB.187.8.2727-2736.2005
57
RowlettV. W.MargolinW. (2014). 3D-SIM super-resolution of FtsZ and its membrane tethers in Escherichia coli cells.Biophys. J.107L17–L20. 10.1016/j.bpj.2014.08.024
58
Ruiz-AvilaL. B.HuecasS.ArtolaM.VergonosA.Ramirez-AportelaE.CercenadoE.et al (2013). Synthetic inhibitors of bacterial cell division targeting the GTP-binding site of FtsZ.ACS Chem. Biol.82072–2083. 10.1021/cb400208z
59
Schaffner-BarberoC.Martin-FontechaM.ChaconP.AndreuJ. M. (2012). Targeting the assembly of bacterial cell division protein FtsZ with small molecules.ACS Chem. Biol.7269–277. 10.1021/cb2003626
60
SiF.BusiekK.MargolinW.SunS. X. (2013). Organization of FtsZ filaments in the bacterial division ring measured from polarized fluorescence microscopy.Biophys. J.1051976–1986. 10.1016/j.bpj.2013.09.030
61
SilvermanJ. A.PerlmutterN. G.ShapiroH. M. (2003). Correlation of daptomycin bactericidal activity and membrane depolarization in Staphylococcus aureus.Antimicrob. Agents Chemother.472538–2544. 10.1128/AAC.47.8.2538-2544.2003
62
StokesN. R.BakerN.BennettJ. M.BerryJ.CollinsI.CzaplewskiL. G.et al (2013). An improved small-molecule inhibitor of FtsZ with superior in vitro potency, drug-like properties, and in vivo efficacy.Antimicrob. Agents Chemother.57317–325. 10.1128/AAC.01580-12
63
StokesN. R.BakerN.BennettJ. M.ChauhanP. K.CollinsI.DaviesD. T.et al (2014). Design, synthesis and structure-activity relationships of substituted oxazole-benzamide antibacterial inhibitors of FtsZ.Bioorg. Med. Chem. Lett.24353–359. 10.1016/j.bmcl.2013.11.002
64
StokesN. R.SieversJ.BarkerS.BennettJ. M.BrownD. R.CollinsI.et al (2005). Novel inhibitors of bacterial cytokinesis identified by a cell-based antibiotic screening assay.J. Biol. Chem.28039709–39715. 10.1074/jbc.M506741200
65
StrahlH.HamoenL. W. (2010). Membrane potential is important for bacterial cell division.Proc. Natl. Acad. Sci. U.S.A.10712281–12286. 10.1073/pnas.1005485107
66
StraussM. P.LiewA. T.TurnbullL.WhitchurchC. B.MonahanL. G.HarryE. J. (2012). 3D-SIM super resolution microscopy reveals a bead-like arrangement for FtsZ and the division machinery: implications for triggering cytokinesis.PLoS Biol.10:e1001389. 10.1371/journal.pbio.1001389
67
StrickerJ.EricksonH. P. (2003). In vivo characterization of Escherichia coli ftsZ mutants: effects on Z-ring structure and function.J. Bacteriol.1854796–4805. 10.1128/JB.185.16.4796-4805.2003
68
SzwedziakP.WangQ.BharatT. A.TsimM.LoweJ. (2014). Architecture of the ring formed by the tubulin homologue FtsZ in bacterial cell division.Elife3:e04601. 10.7554/eLife.04601
69
TanC. M.TherienA. G.LuJ.LeeS. H.CaronA.GillC. J.et al (2012). Restoring methicillin-resistant Staphylococcus aureus susceptibility to beta-lactam antibiotics.Sci. Transl. Med.4:126ra35. 10.1126/scitranslmed.3003592
70
WuL. J.IshikawaS.KawaiY.OshimaT.OgasawaraN.ErringtonJ. (2009). Noc protein binds to specific DNA sequences to coordinate cell division with chromosome segregation.EMBO J.281940–1952. 10.1038/emboj.2009.144
71
YoungK.SilverL. L. (1991). Leakage of periplasmic enzymes from envA1 strains of Escherichia coli.J. Bacteriol.1733609–3614.
Summary
Keywords
bacterial cell division, FtsZ ring, small molecule inhibitors, MciZ, cytological profiling
Citation
Araújo-Bazán L, Ruiz-Avila LB, Andreu D, Huecas S and Andreu JM (2016) Cytological Profile of Antibacterial FtsZ Inhibitors and Synthetic Peptide MciZ. Front. Microbiol. 7:1558. doi: 10.3389/fmicb.2016.01558
Received
30 May 2016
Accepted
16 September 2016
Published
03 October 2016
Volume
7 - 2016
Edited by
Axel Cloeckaert, French National Institute for Agricultural Research (INRA), France
Reviewed by
Iain G. Duggin, University of Technology Sydney, Australia; Henrik Strahl, Newcastle University, UK; Kunihiko Nishino, Osaka University, Japan
Updates
Copyright
© 2016 Araújo-Bazán, Ruiz-Avila, Andreu, Huecas and Andreu.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Lidia Araújo-Bazán, laraujo@cib.csic.es José M. Andreu, j.m.andreu@cib.csic.es
†Present address: Laura B. Ruiz-Avila, Max Planck Institute of Biochemistry, Martinsried, Germany
This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.