ORIGINAL RESEARCH article

Front. Microbiol., 20 December 2016

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 7 - 2016 | https://doi.org/10.3389/fmicb.2016.02006

A New Synthetic Peptide Having Two Target of Antibacterial Action in E. coli ML35

  • 1. Receptor-Ligand Department, Fundación Instituto de Inmunología de Colombia Bogotá, Colombia

  • 2. Faculty of Sciences and Education, Universidad Distrital Francisco José de Caldas Bogotá, Colombia

  • 3. School of Medicine and Health sciences, Universidad del Rosario Bogotá, Colombia

  • 4. Escuela Colombiana de Carreras Industriales Bogotá, Colombia

  • 5. Faculty of Medicine, Universidad Nacional de Colombia Bogotá, Colombia

Abstract

The increased resistance of microorganisms to the different antimicrobials available to today has highlighted the need to find new therapeutic agents, including natural and/or synthetic antimicrobial peptides (AMPs). This study has evaluated the antimicrobial activity of synthetic peptide 35409 (RYRRKKKMKKALQYIKLLKE) against Staphylococcus aureus ATCC 29213, Pseudomonas aeruginosa ATCC 15442 and Escherichia coli ML 35 (ATCC 43827). The results have shown that peptide 35409 inhibited the growth of these three bacterial strains, having 16-fold greater activity against E. coli and P. aeruginosa, but requiring less concentration regarding E. coli (22 μM). When analyzing this activity against E. coli compared to time taken, it was found that this peptide inhibited bacterial growth during the first 60 min and reduced CFU/mL 1 log after 120 min had elapsed. This AMP permeabilized the E. coli membrane by interaction with membrane phospholipids, mainly phosphatidylethanolamine, inhibited cell division and induced filamentation, suggesting two different targets of action within a bacterial cell. Cytotoxicity studies revealed that peptide 35409 had low hemolytic activity and was not cytotoxic for two human cell lines. We would thus propose, in the light of these findings, that the peptide 35409 sequence should provide a promising template for designing broad-spectrum AMPs.

Introduction

Antibiotics are molecules combating part of the infections produced by bacteria. However, the appearance of resistant strains, such as vancomycin-resistant Staphylococcus aureus, methicillin-resistant Staphylococcus epidermidis, ampicillin-resistant and carbapenemase-resistant Escherichia coli, has become a global public health problem and driven the search for new therapeutic compounds having antimicrobial activity which can counteract this phenomenon (Rodriguez-Noriega et al., 2010; Elhani et al., 2012; Kaase et al., 2016). This has led to discovering and isolating natural antimicrobial peptides (AMPs) and developing synthetic peptides having antimicrobial activity and improved selectivity (Broekaert et al., 1995; Frecer et al., 2004; Chen et al., 2005; Jenssen et al., 2006; Bea Rde et al., 2015).

Antimicrobial peptides have a broad spectrum of activity against fungi, parasites, viruses, and bacteria (Gram-positive and Gram-negative) (Koczulla and Bals, 2003; Bulet et al., 2004; Reddy et al., 2004). Most of them share common characteristics, such as length (12-100 residues), positive net charge and amphipathic structures; however; they have little sequence homology and a broad range of secondary structures (Lewies et al., 2015). AMPs’ most important mechanism of action lies in altering membrane organization and depolarization through electrostatic and hydrophobic interactions with negatively charged lipids on cell membrane (Yeaman and Yount, 2003; Reddy et al., 2004; Teixeira et al., 2012). It has been described that AMPs can exercise their activity through peptide-membrane interactions, cell entry and binding to intracellular molecules, and inhibiting the synthesis of enzymes from cell wall, DNA, RNA, or proteins (Peters et al., 2010; Lewies et al., 2015). Additionally, AMP activity and mechanism of action have been related to their amino acid sequence, concentration, net charge, secondary structure, hydrophobicity, as well as the bacterial membrane composition (Dathe et al., 1997; Epand et al., 2005; Spindler et al., 2011).

Antimicrobial peptides have been classified into four main groups based on their structure and composition: alpha-helix peptides such as cecropin-A (Jenssen et al., 2006), beta-sheet peptides (i.e., human β-defensin-1) (Broekaert et al., 1995), mixed structure (i.e., plectasin) (Frecer et al., 2004) and specific amino acid-rich peptides, such as indolicidin having a large amount of tryptophan (Falla and Hancock, 1997). Regarding such classification, it has been reported that alpha-helix amphipathic peptides are usually more active than those having less-defined secondary structures (Brogden, 2005).

Several studies have focused on natural AMPs isolated from different animal species, for example cecropins isolated from insects mainly having activity against Gram-negative bacteria (Steiner et al., 1981), magainin isolated from frog skin (Xenopus laevis) having activity against Gram-positive and Gram-negative bacteria (Zasloff, 1987) and dermaseptin isolated from tree frog skin having action on a wide spectrum of microorganisms, such as protozoa, bacteria, yeast, and filamentous fungi (Mor et al., 1994; Ghosh et al., 1997). Unfortunately, some of the greatest problems involved in using native AMPs as therapeutic components is their high toxicity and their ability to lyse eukaryotic cells (Koczulla and Bals, 2003). Nevertheless, some studies have revealed that selective modification in such peptide sequences (e.g., reducing length, modifying structure, replacing amino acids, and fusion with other sequences) has led to notably reducing toxic activity against eukaryotic cells whilst maintaining or increasing their antimicrobial activity (Sitaram et al., 1992; Navon-Venezia et al., 2002; Zelezetsky and Tossi, 2006; Almaaytah et al., 2012). Designing synthetic AMPs (imitating/mimicking physical–chemical properties from native AMPs) (Joshi et al., 2010) or native AMPs analogous peptides has opened up a research field into new synthetic molecules only having activity against prokaryotic cells (Falla and Hancock, 1997; Fox et al., 2012).

Peptide 35409 (RYRRKKKMKKALQYIKLLKE) is a new peptide analog from peptide 20628 (321RYRRKKKMKKKLQYIKLLKE340), in turn, derived from the Plasmodium falciparum PfRif protein (Weber, 1988). PfRif forms part of the family of proteins called Rifins which are characterized by their low molecular weight (30-45 KD) and expression during different parasite stages (sporozoite, merozoites, and gametes) (Florens et al., 2002). Rifins are clonally variant antigens expressed on infected red blood cells (iRBCs), associated with the pathogenesis of malaria by cytoadhesion (rosetting) and evasion of the immune response (Kyes et al., 1999; Petter et al., 2007; Wang and Hviid, 2015).

In the search for high activity binding peptides as anti-malarial vaccine candidates (Patarroyo and Patarroyo, 2008; Rodriguez et al., 2008) it was found that peptide 20628 caused the lysis of human RBC (10.4% at 200 μM) (unpublished data). Peptide 20628 did not inhibit Gram-negative (E. coli ATCC 25922) or Gram-positive (S. aureus ATCC 29213) bacterial growth whilst its analog 35409 (K331A) had reduced hemolytic activity and inhibited E. coli and S. aureus bacterial growth (Maya, 2009).

Comparing peptide 35409 sequence to AMP database sequences (collecting, predicting, and classifying AMPs) (Lata et al., 2010) showed that peptide 35409 could have had antibacterial activity, this being similar to previously described AMPs (e.g., 39.28% similarity with natural latarcin 1 AMP isolated from the poisonous spider Lachesana tarabaevi) (Kozlov et al., 2006; Rothan et al., 2014). Furthermore, peptide 35409 had arginine in position 1, and this has been reported as being one of the preferential residues towards the amino-terminal region of some AMPs (Lata et al., 2007).

The present work aimed at characterizing peptide 35409 antimicrobial activity concerning different types of bacteria and their mechanism of action against E. coli ML35. The results showed that peptide 35409 had antibacterial activity against Escherichia coli ML35 and Pseudomonas aeruginosa ATCC 15442 at low concentrations and that this peptide did not affect eukaryotic cell viability and maintained low hemolysis percentages. Our results suggested that peptide 35409 permeabilized E. coli ML35 membrane through its interaction with phosphatidylethanolamine (PE) (a phospholipid component present in high concentrations on bacterial membrane), thereby enabling peptide molecule entry to a cell where it interacts with the DNA, inhibiting its synthesis and consequently bacterial cell division.

Materials and Methods

Peptide Synthesis and Purification

Pf-Rif 20628 (321RYRRKKKMKKKLQYIKLLKE340): 35409 (RYRRKKKMKKALQYIKLLKE) (K331A), and 35415 (RYRRKKKMKKKLQYIKALKE) (K337A) peptide analogs were synthesized using the solid phase t-Boc strategy on MBHA resin (0.5 meq/g) (Merrifield, 1969). Lyophilized peptides were analyzed by reverse-phase high-performance liquid chromatography (RP-HPLC) on a Merck-Hitachi chromatograph on a C-18 column in a 0-70% acetonitrile linear gradient for 45 min at 250 μL/min flow-rate, greater than 90% purity being determined. Synthesized peptides’ molecular mass was determined by MALDI-TOF mass spectrometry on Microflex equipment (Bruker) using α-Cyano-4-hydroxycinnamic acid (Sigma) as matrix. The same methodology was used for synthesizing cecropin (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL) (Steiner et al., 1981) and scrambled (same amino acid composition but different sequence) peptide 38659 (YKLQLKRKREKKIYMRKKLA) designed with Shuffle Protein software from peptide 35409 sequence. Cecropin and peptide 38659 were used as positive and negative controls, respectively.

Circular Dichroism (CD)

The peptides’ secondary structure was examined by CD. The peptides (5 μM) were analyzed using a 1-cm light pass length quartz cell thermostated at 20°C using 30% (v/v) 2,2,2- trifluoroethanol (TFE) as co-solvent as it has been shown to stabilize secondary structures (Buck, 1998; Povey et al., 2007). Spectra were obtained on a nitrogen-flushed Jasco J-810 spectrometer at room temperature by averaging three sweeps taken from 260 to 190 nm at a 20 nm/min scan rate and 1 nm bandwidth. Data was collected using Spectra Manager Software and analyzed using SELCON3, CONTINLL, and CDSSTR software, as reported previously (Sreerama et al., 1999).

Measuring Antibacterial Activity

Minimal inhibitory concentration (MIC) was determined using standard micro-titer dilution, standard techniques for determining peptide, and antibiotic antimicrobial activity approved by the Clinical and Laboratory Standards Institute (CLSI) (Wiegand et al., 2008). Briefly, cells were grown overnight in Luria-Bertani (LB) agar at 37°C. Morphologically similar colonies (3-4) were used for inoculating 5 mL LB liquid medium. Following 4-5 h growth (∼1 × 108 colony-forming unit CFU), the bacteria were harvested by spinning at 685 × g for 20 min, washed twice with PBS, pH 7.2 at 4°C and diluted in fresh PBS until an initial 5 × 106 CFU/mL working inoculum was obtained (Wiegand et al., 2008). Optical density (OD) was read at 620 nm and precise amounts of bacteria were measured as OD620 = 0.2 = 5 × 107 CFU/mL (Hiemstra et al., 1993).

Serial peptide dilutions, bacterial inoculum (15 μL) and media were added to the micro-titer plates (150 μL final volume) and incubated for 18 h at 37°C. MIC was determined as being the lowest peptide concentration that inhibited growth by measuring OD620. Cecropin-treated cells and cells without peptides were used as positive and negative controls, respectively. Sterile LB medium was used as sterility control. Assays were carried out in duplicate. S. aureus ATCC 29213, P. aeruginosa ATCC 15442, and E. coli ML 35 (ATCC 43827) were the bacterial strains used.

Bactericidal Kinetics

Peptide 35409 bactericidal kinetics was evaluated by incubating peptide (MIC concentration) with E. coli (5 × 105 CFU/mL). Peptide/bacteria mixtures (100 μL) were taken at 0, 30, 60, 90, and 120 min and serially diluted. These dilutions were plated on LB agar and incubated for 18 h to determine cell viability and the number of CFU/mL. Data was obtained from three independent experiments performed in duplicate. Bacteria in the absence of peptide were taken as control (Lehrer et al., 1983).

Peptide 35409 Action on E. coli ML35 Membrane

Peptide 35409 activity on E. coli ML35 bacterial membrane was studied by three different techniques. Scanning electron microscopy was used for describing morphological changes regarding E. coli or E coli-derived spheroplasts after incubation with peptide 35409. Flow cytometry was used for evaluating peptide permeabilization capability related to cytoplasmatic membrane whilst ortho-nitrophenyl-β-galactoside (ONPG) hydrolysis assay was used for studying permeabilization concerning time taken.

Scanning Electron Microscopy (SEM)

Escherichia coli ML35 strain spheroplasts were obtained by 1% lysozyme treatment, following previously described methodology (Zerrouk et al., 2008). SEM involved taking spheroplasts or 5 × 105 UFC/mL E. coli ML35 grown as mentioned in Section “Measuring Antibacterial Activity” and incubated with peptide 35409 for 1 h at 37°C in LB liquid medium (22 μM final concentration). They were then washed with 1X PBS and bacteria or spheroplasts were fixed with 2.5% glutaraldehyde. The samples were dehydrated using ethanol at a range of concentrations from 70 to 100% and critical points were dried in EK3150 drier. The samples were then gold coated, using the Quorum Q150R ES coating system, and analyzed by Phenom scanning electron microscope, 100× at 10 KV. Bacteria or spheroplasts without peptide were used as negative control [protocol adapted from (Hartmann et al., 2010)].

Flow Cytometry

Escherichia coli bacteria (5 × 105 CFU/mL) were incubated with 88 μM (4 × MIC) peptide 35409 (500 μL final volume) for 3 h at 37°C. The peptide–bacteria mixture was then incubated with 3 μL 25% propidium iodide (PI) for 15 min in the dark (Chau et al., 2011). Fluorescence was read by FACSCanto II (Beckton Dickinson) flow cytometer (4-2-2 configuration) using an FL2-H filter and FACSDiva software (Beckton Dickinson) was used for analyzing the data. Bacteria treated with cecropin (12 μM) were used as membrane permeabilization control. Dead bacteria obtained by heat treatment (5 min at 100°C and 3 h at 70°C) and bacteria without any treatment were used for establishing cut-off points between bacteria having permeabilized membranes and living ones.

ONPG Hydrolysis

Inner membrane permeabilization was investigated by ONPG hydrolysis assay. E. coli ML-35 strain cells were grown to mid-log in LB liquid medium, washed twice with an equal volume of PBS and diluted in PBS to 5 × 107 CFU/mL. Then, 15 μL of this solution (5 × 105 CFU) was diluted with PBS (135 μL) supplemented with 1.5 mM ONPG and peptides 35409 (0, 11, 22, and 44 μM) or 35415 (22 μM). Maximum permeability was determined by evaluating cells pre-treated with cecropin (3 μM). Permeability rate was evaluated by ONPG hydrolysis, measuring absorbance at 405 nm in 30 min intervals for up to 3 h (Arcidiacono et al., 2009).

Liposome Preparation

Large unilamellar vesicles (LUVs) were obtained for determining whether the membrane’s lipid composition affected peptide activity, according to a previously described methodology (Haginoya et al., 2005; Cheng et al., 2009). Briefly, L-α- PE (Sigma P7943) and L-α-phosphatidyl-DL-glycerol (PG) (Sigma P5531) lipids, singly or in mixture (8:2 PE: PG) (Epand et al., 2007), were dissolved in 5 mL dichloromethane. The solvent was evaporated in a Rotavapor at 450 mBar pressure at 60 rpm at 25°C until the appearance of a lipid film on the wall of the flask (left for 20–30 min more to ensure dryness).

The lipid film was dissolved with 1.5 mL buffer (150 mM NaCl, 0.1 g/L EDTA, 1 mM NaN3, 10 mM Tris-base) containing 10 mg/mL calcein and 0.25 M NaOH with strong shaking for 15 min. It was then left for 30 min at room temperature. The solution was passed 10 times through a 0.2 μm Nylon filter and left for 30 min for homogenization of vesicles and LUV formation. The liposomes were purified by size exclusion chromatography on a Sephacryl S300 HR column (0.5 cm × 20 cm). LUV size distribution was ascertained by SEM.

Calcein Leakage Assay

Liposomes mimicking E. coli phospholipid composition (8:2 PE: PG) (Hancock and Lehrer, 1998; Epand et al., 2007), consisting solely of PE or PG, were used for the calcein release assay (Cheng et al., 2009; Fillion et al., 2015). The fluorescence of just liposomes or those incubated with peptide 35409 (22 μM) was monitored at different times over a 4 h period. Fluorescence was read on a Thermo-scientific Fluoroskan Ascent with 485 nm excitation and 538 nm emission filters. Liposomes were treated with 1 μL 20% Triton X-100 for determining maximum fluorescence intensity (taken as 100% calcein release) and percentage calcein release was calculated according to the following equation:

where F: sample fluorescence, F0: untreated liposome fluorescence, FT: the fluorescence of triton-treated liposomes.

Peptide 35409 In vitro DNA-Binding Ability

Plasmid DNA (100 ng) alone or with peptide 35409 (0, 11, 22, 44, and 88 μM) was incubated at room temperature for 1 h (10 μL final volume). The sample was then resolved by electrophoresis on 0.5% agarose gel and stained with SYBR Green (Hsu et al., 2005; Alfred et al., 2013).

Inhibiting DNA Synthesis In vivo in E. coli by Peptide 35409

Bacteria (15 μL, 5 × 106 UFC/mL) were incubated with peptide 35409 (1× MIC and 2× MIC) at 37°C for 3 h. Then 50 μL of each sample was fixed on a slide and stained with violet crystal (1 min) and washed with water. The samples were observed by light microscopy at 100× magnification (Alfred et al., 2013). Bacteria alone or treated with ciprofloxacin [which inhibits E. coli DNA synthesis (Gottfredsson et al., 1995)] were used as negative and positive control of filamentation, respectively.

Resazurine-Based Cytotoxicity Assay and Hemolytic Activity

The resazurine fluorometric test (O’Brien et al., 2000) was used for determining peptide toxicity on HeLa ATCC CCL-2 (human epidermis-derived cells) and HepG2 ATCC HB-8065 (human hepatocyte-derived cells) cell-lines. Cells (2 × 104 per well) were transferred to 96-well plates and cultured in RPMI medium for 24 h until a monolayer was obtained. The cells were incubated with peptide 35409 (1x MIC and 2x MIC), for 72 h at 37°C. The supernatant was then skimmed off, resazurine (44 μM) added and the mixture incubated for 4 h at 37°C. Using resazurine enables cellular metabolic function to be measured, based on their oxidation state. Oxidized state is blue (cells lacking metabolic activity) and fluorescent pink in reduced state (action of oxydoreductase mainly located in viable cell mitochondria) (Perrot et al., 2003; Rolon et al., 2006).

Fluorescence was measured at 530 nm on a TECAN GENios fluorometer. RPMI medium and heat-killed bacteria (70°C) were used as negative control and untreated bacteria as positive control. IBM SPSS Statistics v20 software was used with a Tukey test for evaluating differences between treatments (p < 0.05 being considered statistically significant).

Hemolytic activity was determined using human RBCs. Cells were centrifuged for 15 min to remove the buffy coat and washed with PBS. Six microliter human RBC (3%) were plated into sterilized 96-well plates containing incubated peptide 35409 (serial dilutions) and PBS (200 μL final volume). After 1 h at 37°C, plates were spun at 1,000 g for 5 min and hemoglobin release was monitored using an ELISA plate reader (Molecular Devices), measuring absorbance at 540 nm (Almaaytah et al., 2012).

Percentage hemolysis was calculated from:

where A: sample absorbance at 540 nm, A0: untreated RBCs absorbance, AT: triton-treated RBCs absorbance.

Results

Helical Peptide 35409 Inhibited E. coli and P. aeruginosa Growth

Peptide 35409 primary sequence contains six hydrophobic residues (bold) and 10 positively charged ones (underlined) (RYRRKKKMKKALQYIKLLKE), meaning that is a cationic peptide (Wang and Wang, 2004). CD analysis showed that this peptide had a 190 nm maximum and two minimums at 209 and 220 nm (Figure 1). This data coincided with deconvolution analysis, revealing ∼90% α-helical features. Peptide 35415 was also α-helical, but scrambled peptide 38659 only had a minimum at 197 nm, suggesting the presence of random elements (Figure 1).

FIGURE 1

The broth dilution method revealed that peptide 35409 had antimicrobial activity against Gram-negative bacteria (MIC 22 μM against E. coli and MIC 44 μM against P. aeruginosa) and activity against Gram-positive bacteria (S. aureus) at greater concentration (350 μM), whilst peptides 38659 (scrambled sequence) and 35415 had no effect on bacterial growth at any concentration assayed here (Table 1).

Table 1

MIC (μM)

Bacteria3540938659C (-)
Gram-negativeEscherichia coli ML 35 (43827)22 ± 1GG
Pseudomonas aeruginosa 1544244 ± 1GG
Gram-positiveStaphylococcus aureus 29213350 ± 1GG

Peptide 35409 antibacterial activity against Gram-negative and Gram-positive bacteria.

Mean ± SD of three experiments

G: growth

Peptide 35409 Kinetic Activity

Peptide 35409 inhibitory activity against E. coli ML35 cells was evaluated as regards time taken. The results showed that the peptide maintained its inhibitory activity during the time being evaluated (3 h) and reduced UFC/mL. Figure 2 shows that the amount of UFC/mL was constant in the presence of peptide 35409 and during the first 60 min; after this, a progressive reduction in bacterial population was observed. Reading at 120 min showed that the bacterial population became reduced by 1 log compared to the initial population.

FIGURE 2

Permeabilization of E. coli ML 35 Membrane

The effect of peptide 35409 on E. coli cell envelop was evaluated by SEM. Morphological changes were observed on the surface of bacteria treated with peptide 35409, thereby indicating the deterioration of cell membrane (Figures 3A,B). Peptide 35409 also caused lysis in spheroplasts which are bacteria lacking external membrane and bacterial wall (Figures 3C,D). Interestingly, it was found that peptide 35409 caused a morphological change consisting of the lengthening of bacterial bodies (Figure 3E).

FIGURE 3

Membrane permeability determination involved cells treated with peptide 35409 being stained with PI, which only enters cells having damaged cytoplasmic membranes or dead bacteria (Chau et al., 2011). PI incorporation by E. coli ML35 cells treated with peptide 35409 was evaluated by flow cytometry. Figure 4 shows that dead bacteria and those treated with peptide (4x MIC) incorporated PI (63.5%), whilst bacteria without treatment did not incorporate PI. The AMP cecropin, which has been reported to induce inner membrane perturbation (Chen et al., 2003; Arcidiacono et al., 2009), induced high PI incorporation (83.75%) (Figure 4).

FIGURE 4

In another assay, ONPG hydrolysis by E. coli ML-35 strain cells, having no lactose permease but constitutively forming β-galactosidase (a cytoplasmic enzyme), was used for evaluating membrane permeability regarding time taken. When β-galactosidase is released it causes ONPG hydrolysis, producing yellow o-nitrophenol (ONP). Figure 5A shows that peptide 35409 (11-44 μM) caused ONP formation after 30 min (maximum at 120 min), while cecropin (3 μM) allowed more rapid ONP formation (maximum at 30 min).

FIGURE 5

Calcein Leakage in LUVs Having Different Lipid Composition

Antimicrobial peptides activity is due mainly to membrane-permeabilization and is related to membrane lipid composition (Yeaman and Yount, 2003; Dennison et al., 2008; Teixeira et al., 2012). ONPG hydrolysis and PI incorporation assays showed that peptide 35409 permeabilized the membrane of E. coli ML-35 cells. To know whether peptide 35049 activity is dependent on membrane lipid composition, LUVs consisting of PE, PG, or a mixture of both PE/PG (8:2) containing calcein were prepared and treated with peptides 35409 and 35415. Figure 5B shows that peptide 35409 induced calcein release in liposomes having different lipid composition. Greater release (21%) was seen in liposomes consisting just of PE and lower release (8%) in liposomes just consisting of PG, whilst liposomes consisting of PE and PG (8:2) had 17 % calcein release. On the other hand, peptide 35415 (lacking inhibitory activity) had ≤2% release for all types of liposomes (Figure 5B).

Peptide 35409 Binding to Bacterial DNA and Inhibiting Cell Division

The gel retardation assay assesses peptide-DNA binding by retarding the migration of DNA bands across agarose gels (Alfred et al., 2013). It was observed that plasmid DNA was still able to migrate into the gel at peptide concentrations lower than MIC, the same as control (untreated DNA), whereas almost all the DNA remained at the origin at ≥MIC concentrations (Figure 6A).

FIGURE 6

It has been reported that some AMPs inhibit DNA synthesis and bacteria then grow without causing cell lysis (Falla et al., 1996). As peptide 35409 had in vitro DNA-binding ability then a filamentation assay was used for evaluating whether peptide 35409 could inhibit DNA synthesis in vivo. Figure 6D shows a lengthening of bacterial bodies caused by peptide 35409 treatment at MIC.

Peptide 35409 Was Not Cytotoxic on Eukaryotic Cells

A fluorometric assay using resazurine as viability indicator evaluated the toxic effect of peptide 35409 on HeLa and HepG2 cell-lines (Figure 7). The results revealed no statistically significant difference when treating HeLa and/or HepG2 cells with peptide 35409 (22 and 44 μM) and cells without any type of treatment. Evaluating the effect of peptide 35409 (increasing concentrations) on human RBCs revealed that the peptide lysed around 14% of the cells at the highest concentration assayed (350 μM) (data not shown).

FIGURE 7

Discussion

The search for new agents to combat bacterial infections represents a significant focus for current research given the increased appearance of strains which are resistant to available antimicrobial drugs. AMPs have emerged as a useful alternative for combating the problem and studying this type of molecules is increasing.

Peptide 35409 sequence (RYRRKKKMKKALQYIKLLKE) has characteristics typical of some AMPs: being cationic, having α-helix structure elements (Figure 1) and having arginine in the sequence’s first position (Lata et al., 2010). This sequence has not been reported as being an AMP; however, it has ∼40% similarity with AMP latarcin-1 sequence. Peptide 35409 antimicrobial activity against Gram-positive and Gram-negative bacteria was analyzed here to address its possible use as target in developing a new AMP.

Peptide 35409 acted on Gram-positive and Gram-negative bacteria, inhibiting Gram-negative growth 16-fold regarding Gram-positive growth (Table 1). Interestingly, even though peptide 35409 and cecropin P1 isolated from pig intestine have different sequences and little similarity, the same activity pattern having preference concerning Gram-negative bacteria has been observed for both (Arcidiacono et al., 2009). It has been suggested that such pattern could have been due to differences in bacterial membranes; the peptidoglycan layer in S. aureus cell wall could confer greater resistance against peptide activity, as has been reported for these bacteria concerning antibiotic activity (Lemmen et al., 2004). Peptide 35409’s high α-helix structure content and peptide 38659’s random structure (Figure 1) (having no effect on bacterial growth) suggested that secondary structure could also be involved in or even determinant in 35409 peptide activity, as has been shown for some AMPs (Hwang and Vogel, 1998).

Peptide 35409 had a 22 μM MIC for the E. coli ML 35 strain according to broth dilution results. Such value fell within the range of MICs reported for the different AMPs being studied. For example, AamAP1 and synthetic CP-1 AMPs had activity against Gram-positive and Gram-negative bacteria with MIC 22-150 and 3-77 μM, respectively (Zhang et al., 2009; Almaaytah et al., 2012).

Peptide kinetic activity against E. coli ML 35 was constant regarding CFU/mL during the first 60 min and then became reduced, reaching 1 log at 120 min (Figure 2). This suggested slow kinetic action compared to that observed for other AMPs (Arcidiacono et al., 2009; Joshi et al., 2010). Even though bacterial death was observed, the results were not conclusive enough for determining whether the action was bactericidal or bacteriostatic.

The peptide’s effect on bacterial surface was evaluated by SEM to address such issue. The micrographies revealed deterioration on bacterial surface caused by this peptide (Figures 3A,B). The peptide also provoked lysis in bacteria devoid of external membrane and cell wall (spheroplasts); suggesting a direct effect on internal membrane. In fact, when PI incorporation and ONPG hydrolysis kinetics concerning E. coli ML35 cells was evaluated, it was found that the peptide slowly permeabilized inner membrane (compared to cecropin) (Figures 4 and 5A). There could thus be a relationship between ONPG hydrolysis kinetics and peptide 35409 kinetic activity (Figures 2 and 5A) since the reduction of UFC/mL occurred after 90 to 120 min had elapsed, coinciding with membrane permeabilization.

It has been described that factors such as hydrophobicity, charge, hydrophobic moment, and polar angle are related to antimicrobial and hemolytic activity, but this is not always a linear or direct association (Teixeira et al., 2012). Peptide 35409 has a +9 charge and -1.54 hydrophobicity and, in spite of being cationic, has had greater interaction with liposomes consisting of zwitterion phospholipid at physiological pH (PE) but not with liposomes consisting of negatively charged phospholipid (PG) (Figure 5B). This would coincide with a direct correlation between PE content on inner lipid membrane and antimicrobial activity which has been reported for some α/β helical peptides, also indicating that peptide 35409-membrane interaction did not depend on charge or electrostatic interactions (contrary to that reported for most AMPs) (Chen et al., 2003; Teixeira et al., 2012) but was rather associated with hydrophobicity and amphipathicity (Epand et al., 2005, 2007). While this experiment confirmed interaction with the most abundant phospholipid on bacterial membrane, the slow release of calcein on LUVs endorsed a transitory interaction (Figure 5B), thereby suggesting two possible mechanisms of action for peptide 35409. The first concerns the formation of small, short-lived pores allowing peptide translocation, and release of calcein, as described for some AMPs having similar characteristics to those of peptide 35409: short, cationic, α helical, and amphipathic (Giangaspero et al., 2001; Yan et al., 2013). The second is the translocation of the peptide favored by the abundance of PE on the inner membrane of E. coli (Epand et al., 2006), causing low and slow calcein release (Figure 5B).

Based on the forgoing and the morphological change observed by SEM (Figure 3E) it might be suggested that cell division became inhibited; this led to evaluating whether DNA is a target for peptide 35409 action. Figure 6A shows that the peptide retarded plasmid DNA electrophoretic run, suggesting an interaction between the peptide and the DNA chain. The DNA-peptide complex not only had greater weight but also lost affinity for the positive pole (anode) due to the positive charges provided by the cationic peptide. Peptide 35409 interaction with DNA could be attributed to electrostatic attraction between the peptide and the phosphate groups of DNA molecules, where the peptide’s α-helix conformation (revealed by CD for peptide 35409) plays an important role at spatial level for insertion into the DNA chain (Rivas-Santiago et al., 2006).

On the other hand, when a bacteria’s DNA synthesis is inhibited, this changes its morphology, it becomes longer without achieving cell division (morphological change called filamentation) (Subbalakshmi and Sitaram, 1998; Rosenberger et al., 2004). Peptide 35409 treated bacteria underwent such morphological change in an assay in vivo as observed by SEM (Figure 3E) and light microscopy (Figures 6B–D). The above, together with the results of calcein release, indicated that the peptide interacted transitorily with the bacterial membrane, affected cell entry and bound to DNA, inhibiting its synthesis and impeding cell division.

As main problem with AMPs lies in their high toxicity concerning eukaryotic cells; evaluating peptide cytotoxicity regarding eukaryote membranes is an important step in using them as bacterial agents (Koczulla and Bals, 2003; Chen et al., 2005). It was found that peptide 35409 caused hRBC lysis at MIC and that such lytic activity was concentration-dependent. However, lysis percentages were very low, thereby agreeing with that reported for various AMPs; SA-2-SA-5 has 10% maximum hemolysis at 500 μg/mL and magainin 1 has maximum 3% hemolysis at 50 μM. Other natural AMPs, such as melittin, have 100% hemolytic activity at 12 μg/mL (Maher and McClean, 2006; Joshi et al., 2010; Lewies et al., 2015). Such low hemolytic capability could be associated with a lower percentage of PE in RBC external monolayer (Daleke, 2008) since it was observed that peptide 35409 preferentially interacted with this phospholipid (Figure 5B).

It was also found that this peptide did not affect eukaryote cell viability (Figures 7A,B), thereby making it a target for further studies when looking for new therapeutic agents against infectious diseases.

The present study has thus reported a new sequence (peptide 35409) having usual AMP characteristics and double-action mechanism on E. coli. Its target of action is not only the bacterial membrane but also cytoplasmatic DNA. Our results suggested that helical conformation, hydrophobicity, and amphipathicity play an important role in its mechanism of action. Even though this peptide had hemolytic activity, it was low and had no toxicity regarding other eukaryotic cells which is why we consider that it is a good candidate when designing and developing new AMPs having selectivity for bacterial membranes.

Statements

Author contributions

HC, GA-P, DS, and AB-S conceived and designed the experiments; AB-S, DS, CH, GA-P performed the experiments and analyzed the data; WP, MP contributed reagents/materials/analysis tools; AB-S, GA-P, HC wrote the paper.

Acknowledgments

We would like to thank Jason Garry for translating this manuscript and Diana Granados for providing flow cytometry service at the Universidad Nacional de Colombia.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Supplementary material

The Supplementary Material for this article can be found online at: http://journal.frontiersin.org/article/10.3389/fmicb.2016.02006/full#supplementary-material

References

  • 1

    AlfredR. L.PalomboE. A.PanozzoJ. F.BhaveM. (2013). The antimicrobial domains of wheat puroindolines are cell-penetrating peptides with possible intracellular mechanisms of action.PLoS One8:e75488. 10.1371/journal.pone.0075488

  • 2

    AlmaaytahA.ZhouM.WangL.ChenT.WalkerB.ShawC. (2012). Antimicrobial/cytolytic peptides from the venom of the North African scorpion, Androctonus amoreuxi: biochemical and functional characterization of natural peptides and a single site-substituted analog.Peptides35291299. 10.1016/j.peptides.2012.03.016

  • 3

    ArcidiaconoS.SoaresJ. W.MeehanA. M.MarekP.KirbyR. (2009). Membrane permeability and antimicrobial kinetics of cecropin P1 against Escherichia coli.J. Pept. Sci.15398403. 10.1002/psc.1125

  • 4

    Bea RdeL.PetragliaA. F.JohnsonL. E. (2015). Synthesis, antimicrobial activity and toxicity of analogs of the scorpion venom BmKn peptides.Toxicon1017984. 10.1016/j.toxicon.2015.05.006

  • 5

    BroekaertW. F.TerrasF. R.CammueB. P.OsbornR. W. (1995). Plant defensins: novel antimicrobial peptides as components of the host defense system.Plant Physiol.10813531358. 10.1104/pp.108.4.1353

  • 6

    BrogdenK. A. (2005). Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria?Nat. Rev. Microbiol.3238250. 10.1038/nrmicro1098

  • 7

    BuckM. (1998). Trifluoroethanol and colleagues: cosolvents come of age. Recent studies with peptides and proteins.Q. Rev. Biophys.31297355.

  • 8

    BuletP.StocklinR.MeninL. (2004). Anti-microbial peptides: from invertebrates to vertebrates.Immunol. Rev.198169184. 10.1111/j.0105-2896.2004.0124.x

  • 9

    ChauF.LefortA.BenaddaS.DubeeV.FantinB. (2011). Flow cytometry as a tool to determine the effects of cell wall-active antibiotics on vancomycin-susceptible and -resistant Enterococcus faecalis strains.Antimicrob. Agents Chemother.55395398. 10.1128/AAC.00970-10

  • 10

    ChenH. M.ChanS. C.LeeJ. C.ChangC. C.MuruganM.JackR. W. (2003). Transmission electron microscopic observations of membrane effects of antibiotic cecropin B on Escherichia coli.Microsc. Res. Tech.62423430. 10.1002/jemt.10406

  • 11

    ChenY.MantC. T.FarmerS. W.HancockR. E.VasilM. L.HodgesR. S. (2005). Rational design of alpha-helical antimicrobial peptides with enhanced activities and specificity/therapeutic index.J. Biol. Chem.2801231612329. 10.1074/jbc.M413406200

  • 12

    ChengJ. T.HaleJ. D.ElliotM.HancockR. E.StrausS. K. (2009). Effect of membrane composition on antimicrobial peptides aurein 2.2 and 2.3 from Australian southern bell frogs.Biophys. J.96552565. 10.1016/j.bpj.2008.10.012

  • 13

    DalekeD. L. (2008). Regulation of phospholipid asymmetry in the erythrocyte membrane.Curr. Opin. Hematol.15191195. 10.1097/MOH.0b013e3282f97af7

  • 14

    DatheM.WieprechtT.NikolenkoH.HandelL.MaloyW. L.MacDonaldD. L.et al (1997). Hydrophobicity, hydrophobic moment and angle subtended by charged residues modulate antibacterial and haemolytic activity of amphipathic helical peptides.FEBS Lett.403208212. 10.1016/S0014-5793(97)00055-0

  • 15

    DennisonS. R.MortonL. H.HarrisF.PhoenixD. A. (2008). The impact of membrane lipid composition on antimicrobial function of an alpha-helical peptide.Chem. Phys. Lipids15192102. 10.1016/j.chemphyslip.2007.10.007

  • 16

    ElhaniD.ElhaniI.AouniM. (2012). [Resistance in Gram negative bacteria: what is the current situation?].Tunis. Med.90680685.

  • 17

    EpandR. F.SavageP. B.EpandR. M. (2007). Bacterial lipid composition and the antimicrobial efficacy of cationic steroid compounds (Ceragenins).Biochim. Biophys. Acta176825002509. 10.1016/j.bbamem.2007.05.023

  • 18

    EpandR. F.SchmittM. A.GellmanS. H.EpandR. M. (2006). Role of membrane lipids in the mechanism of bacterial species selective toxicity by two alpha/beta-antimicrobial peptides.Biochim. Biophys. Acta175813431350. 10.1016/j.bbamem.2006.01.018

  • 19

    EpandR. F.SchmittM. A.GellmanS. H.SenA.AugerM.HughesD. W.et al (2005). Bacterial species selective toxicity of two isomeric alpha/beta-peptides: role of membrane lipids.Mol. Membr. Biol.22457469. 10.1080/09687860500370562

  • 20

    FallaT. J.HancockR. E. (1997). Improved activity of a synthetic indolicidin analog.Antimicrob. Agents Chemother.41771775.

  • 21

    FallaT. J.KarunaratneD. N.HancockR. E. (1996). Mode of action of the antimicrobial peptide indolicidin.J. Biol. Chem.2711929819303. 10.1074/jbc.271.32.19298

  • 22

    FillionM.Valois-PaillardG.LorinA.NoelM.VoyerN.AugerM.et al (2015). Membrane interactions of synthetic peptides with antimicrobial potential: effect of electrostatic interactions and amphiphilicity.Probiotics Antimicrob. Proteins76674. 10.1007/s12602-014-9177-z

  • 23

    FlorensL.WashburnM. P.RaineJ. D.AnthonyR. M.GraingerM.HaynesJ. D.et al (2002). A proteomic view of the Plasmodium falciparum life cycle.Nature419520526. 10.1038/nature01107

  • 24

    FoxM. A.ThwaiteJ. E.UlaetoD. O.AtkinsT. P.AtkinsH. S. (2012). Design and characterization of novel hybrid antimicrobial peptides based on cecropin A, LL-37 and magainin II.Peptides33197205. 10.1016/j.peptides.2012.01.013

  • 25

    FrecerV.HoB.DingJ. L. (2004). De novo design of potent antimicrobial peptides.Antimicrob. Agents Chemother.4833493357. 10.1128/AAC.48.9.3349-3357.2004

  • 26

    GhoshJ. K.ShaoolD.GuillaudP.CiceronL.MazierD.KustanovichI.et al (1997). Selective cytotoxicity of dermaseptin S3 toward intraerythrocytic Plasmodium falciparum and the underlying molecular basis.J. Biol. Chem.2723160931616. 10.1074/jbc.272.50.31609

  • 27

    GiangasperoA.SandriL.TossiA. (2001). Amphipathic alpha helical antimicrobial peptides.Eur. J. Biochem.26855895600. 10.1046/j.1432-1033.2001.02494.x

  • 28

    GottfredssonM.ErlendsdottirH.GudmundssonA.GudmundssonS. (1995). Different patterns of bacterial DNA synthesis during postantibiotic effect.Antimicrob. Agents Chemother.3913141319. 10.1128/AAC.39.6.1314

  • 29

    HaginoyaK.KatoT.HiguchiM.ShitomiY.AsakuraT.HayakawaT.et al (2005). Preparation of Stable Liposomes Using Sucrose Density Gradient Centrifugation and Their Interaction with Insecticidal Cry1A Toxins of Bacillus thuringiensis. Available at: http://dspace.lib.niigata-u.ac.jp/dspace/?lang = ja

  • 30

    HancockR. E.LehrerR. (1998). Cationic peptides: a new source of antibiotics.Trends Biotechnol.168288. 10.1016/S0167-7799(97)01156-6

  • 31

    HartmannM.BerditschM.HaweckerJ.ArdakaniM. F.GerthsenD.UlrichA. S. (2010). Damage of the bacterial cell envelope by antimicrobial peptides gramicidin S and PGLa as revealed by transmission and scanning electron microscopy.Antimicrob. Agents Chemother.5431323142. 10.1128/AAC.00124-10

  • 32

    HiemstraP. S.EisenhauerP. B.HarwigS. S.van den BarselaarM. T.van FurthR.LehrerR. I. (1993). Antimicrobial proteins of murine macrophages.Infect. Immun.6130383046.

  • 33

    HsuC. H.ChenC.JouM. L.LeeA. Y.LinY. C.YuY. P.et al (2005). Structural and DNA-binding studies on the bovine antimicrobial peptide, indolicidin: evidence for multiple conformations involved in binding to membranes and DNA.Nucleic Acids Res.3340534064. 10.1093/nar/gki725

  • 34

    HwangP. M.VogelH. J. (1998). Structure-function relationships of antimicrobial peptides.Biochem. Cell Biol.76235246. 10.1139/o98-026

  • 35

    JenssenH.HamillP.HancockR. E. (2006). Peptide antimicrobial agents.Clin. Microbiol. Rev.19491511. 10.1128/CMR.00056-05

  • 36

    JoshiS.BishtG. S.RawatD. S.KumarA.KumarR.MaitiS.et al (2010). Interaction studies of novel cell selective antimicrobial peptides with model membranes and E. coli ATCC 11775.Biochim. Biophys. Acta179818641875. 10.1016/j.bbamem.2010.06.016

  • 37

    KaaseM.SchimanskiS.SchillerR.BeyreissB.ThurmerA.SteinmannJ.et al (2016). Multicentre investigation of carbapenemase-producing Escherichia coli and Klebsiella pneumoniae in German hospitals.Int. J. Med. Microbiol.306415420. 10.1016/j.ijmm.2016.05.009

  • 38

    KoczullaA. R.BalsR. (2003). Antimicrobial peptides: current status and therapeutic potential.Drugs63389406. 10.2165/00003495-200363040-00005

  • 39

    KozlovS. A.VassilevskiA. A.FeofanovA. V.SurovoyA. Y.KarpuninD. V.GrishinE. V. (2006). Latarcins, antimicrobial and cytolytic peptides from the venom of the spider Lachesana tarabaevi (Zodariidae) that exemplify biomolecular diversity.J. Biol. Chem.2812098320992. 10.1074/jbc.M602168200

  • 40

    KyesS. A.RoweJ. A.KriekN.NewboldC. I. (1999). Rifins: a second family of clonally variant proteins expressed on the surface of red cells infected with Plasmodium falciparum.Proc. Natl. Acad. Sci. U.S.A.9693339338. 10.1073/pnas.96.16.9333

  • 41

    LataS.MishraN. K.RaghavaG. P. (2010). AntiBP2: improved version of antibacterial peptide prediction.BMC Bioinformatics11(Suppl. 1):S19. 10.1186/1471-2105-11-S1-S19

  • 42

    LataS.SharmaB. K.RaghavaG. P. (2007). Analysis and prediction of antibacterial peptides.BMC Bioinformatics8:263. 10.1186/1471-2105-8-263

  • 43

    LehrerR. I.SelstedM. E.SzklarekD.FleischmannJ. (1983). Antibacterial activity of microbicidal cationic proteins 1 and 2, natural peptide antibiotics of rabbit lung macrophages.Infect. Immun.421014.

  • 44

    LemmenS. W.HafnerH.ZolldannD.StanzelS.LuttickenR. (2004). Distribution of multi-resistant gram-negative versus gram-positive bacteria in the hospital inanimate environment.J. Hosp. Infect.56191197. 10.1016/j.jhin.2003.12.004

  • 45

    LewiesA.WentzelJ. F.JacobsG.Du PlessisL. H. (2015). The potential use of natural and structural analogues of antimicrobial peptides in the fight against neglected tropical diseases.Molecules201539215433. 10.3390/molecules200815392

  • 46

    MaherS.McCleanS. (2006). Investigation of the cytotoxicity of eukaryotic and prokaryotic antimicrobial peptides in intestinal epithelial cells in vitro.Biochem. Pharmacol.7112891298. 10.1016/j.bcp.2006.01.012

  • 47

    MayaC. A. (2009). Determining the Structure-Activity Relationship of Peptide 20628 Derived From the Plasmodium Falciparum Rif-1 Protein.Degree thesis, Universidad Distrital Francisco José de Caldas, Bogotá.

  • 48

    MerrifieldR. B. (1969). Solid-phase peptide synthesis.Adv. Enzymol. Relat. Areas Mol. Biol.32221296.

  • 49

    MorA.HaniK.NicolasP. (1994). The vertebrate peptide antibiotics dermaseptins have overlapping structural features but target specific microorganisms.J. Biol. Chem.2693163531641.

  • 50

    Navon-VeneziaS.FederR.GaidukovL.CarmeliY.MorA. (2002). Antibacterial properties of dermaseptin S4 derivatives with in vivo activity.Antimicrob. Agents Chemother.46689694. 10.1128/AAC.46.3.689-694.2002

  • 51

    O’BrienJ.WilsonI.OrtonT.PognanF. (2000). Investigation of the alamar blue (resazurin) fluorescent dye for the assessment of mammalian cell cytotoxicity.Eur. J. Biochem.26754215426. 10.1046/j.1432-1327.2000.01606.x

  • 52

    PatarroyoM. E.PatarroyoM. A. (2008). Emerging rules for subunit-based, multiantigenic, multistage chemically synthesized vaccines.Acc. Chem. Res.41377386. 10.1021/ar700120t

  • 53

    PerrotS.Dutertre-CatellaH.MartinC.RatP.WarnetJ. M. (2003). Resazurin metabolism assay is a new sensitive alternative test in isolated pig cornea.Toxicol. Sci.72122129. 10.1093/toxsci/kfg014

  • 54

    PetersB. M.ShirtliffM. E.Jabra-RizkM. A. (2010). Antimicrobial peptides: primeval molecules or future drugs?PLoS Pathog6:e1001067. 10.1371/journal.ppat.1001067

  • 55

    PetterM.HaeggstromM.KhattabA.FernandezV.KlinkertM. Q.WahlgrenM. (2007). Variant proteins of the Plasmodium falciparum RIFIN family show distinct subcellular localization and developmental expression patterns.Mol. Biochem. Parasitol.1565161. 10.1016/j.molbiopara.2007.07.011

  • 56

    PoveyJ. F.SmalesC. M.HassardS. J.HowardM. J. (2007). Comparison of the effects of 2,2,2-trifluoroethanol on peptide and protein structure and function.J. Struct. Biol.157329338. 10.1016/j.jsb.2006.07.008

  • 57

    ReddyK. V.YederyR. D.AranhaC. (2004). Antimicrobial peptides: premises and promises.Int. J. Antimicrob. Agents24536547. 10.1016/j.ijantimicag.2004.09.005

  • 58

    Rivas-SantiagoB.SadaE.Hernández-PandoR.TsutsumiV. (2006). Péptidos antimicrobianos en la inmunidad innata de enfermedades infecciosas.Salud Pública Méx.486271.

  • 59

    RodriguezL. E.CurtidorH.UrquizaM.CifuentesG.ReyesC.PatarroyoM. E. (2008). Intimate molecular interactions of P.falciparum merozoite proteins involved in invasion of red blood cells and their implications for vaccine design.Chem Rev10836563705. 10.1021/cr068407v

  • 60

    Rodriguez-NoriegaE.SeasC.Guzman-BlancoM.MejiaC.AlvarezC.BavestrelloL.et al (2010). Evolution of methicillin-resistant Staphylococcus aureus clones in Latin America.Int. J. Infect. Dis.14e560e566. 10.1016/j.ijid.2009.08.018

  • 61

    RolonM.VegaC.EscarioJ. A.Gomez-BarrioA. (2006). Development of resazurin microtiter assay for drug sensibility testing of Trypanosoma cruzi epimastigotes.Parasitol. Res.99103107. 10.1007/s00436-006-0126-y

  • 62

    RosenbergerC. M.GalloR. L.FinlayB. B. (2004). Interplay between antibacterial effectors: a macrophage antimicrobial peptide impairs intracellular Salmonella replication.Proc. Natl. Acad. Sci. U.S.A.10124222427. 10.1073/pnas.0304455101

  • 63

    RothanH. A.BahraniH.RahmanN. A.YusofR. (2014). Identification of natural antimicrobial agents to treat dengue infection: In vitro analysis of latarcin peptide activity against dengue virus.BMC Microbiol.14:140. 10.1186/1471-2180-14-140

  • 64

    SitaramN.ChandyM.PillaiV. N.NagarajR. (1992). Change of glutamic acid to lysine in a 13-residue antibacterial and hemolytic peptide results in enhanced antibacterial activity without increase in hemolytic activity.Antimicrob. Agents Chemother.3624682472. 10.1128/AAC.36.11.2468

  • 65

    SpindlerE. C.HaleJ. D.GiddingsT. H.Jr.HancockR. E.GillR. T. (2011). Deciphering the mode of action of the synthetic antimicrobial peptide Bac8c.Antimicrob. Agents Chemother.5517061716. 10.1128/AAC.01053-10

  • 66

    SreeramaN.VenyaminovS. Y.WoodyR. W. (1999). Estimation of the number of alpha-helical and beta-strand segments in proteins using circular dichroism spectroscopy.Protein Sci.8370380. 10.1110/ps.8.2.370

  • 67

    SteinerH.HultmarkD.EngstromA.BennichH.BomanH. G. (1981). Sequence and specificity of two antibacterial proteins involved in insect immunity.Nature292246248. 10.1038/292246a0

  • 68

    SubbalakshmiC.SitaramN. (1998). Mechanism of antimicrobial action of indolicidin.FEMS Microbiol. Lett.1609196. 10.1111/j.1574-6968.1998.tb12896.x

  • 69

    TeixeiraV.FeioM. J.BastosM. (2012). Role of lipids in the interaction of antimicrobial peptides with membranes.Prog. Lipid Res.51149177. 10.1016/j.plipres.2011.12.005

  • 70

    WangC. W.HviidL. (2015). Rifins, rosetting, and red blood cells.Trends Parasitol.31285286. 10.1016/j.pt.2015.04.009

  • 71

    WangZ.WangG. (2004). APD: the Antimicrobial Peptide Database.Nucleic Acids Res.32D590D592. 10.1093/nar/gkh025

  • 72

    WeberJ. L. (1988). Interspersed repetitive DNA from Plasmodium falciparum.Mol. Biochem. Parasitol.29117124. 10.1016/0166-6851(88)90066-7

  • 73

    WiegandI.HilpertK.HancockR. E. (2008). Agar and broth dilution methods to determine the minimal inhibitory concentration (MIC) of antimicrobial substances.Nat. Protoc.3163175. 10.1038/nprot.2007.521

  • 74

    YanJ.WangK.DangW.ChenR.XieJ.ZhangB.et al (2013). Two hits are better than one: membrane-active and DNA binding-related double-action mechanism of NK-18, a novel antimicrobial peptide derived from mammalian NK-lysin.Antimicrob. Agents Chemother.57220228. 10.1128/AAC.01619-12

  • 75

    YeamanM. R.YountN. Y. (2003). Mechanisms of antimicrobial peptide action and resistance.Pharmacol. Rev.552755. 10.1124/pr.55.1.2

  • 76

    ZasloffM. (1987). Magainins, a class of antimicrobial peptides from Xenopus skin: isolation, characterization of two active forms, and partial cDNA sequence of a precursor.Proc. Natl. Acad. Sci. U.S.A.8454495453. 10.1073/pnas.84.15.5449

  • 77

    ZelezetskyI.TossiA. (2006). Alpha-helical antimicrobial peptides–using a sequence template to guide structure-activity relationship studies.Biochim. Biophys. Acta175814361449. 10.1016/j.bbamem.2006.03.021

  • 78

    ZerroukZ.AlexandreS.LafontaineC.NorrisV.ValletonJ. M. (2008). Inner membrane lipids of Escherichia coli form domains.Colloids Surf B Biointerfaces63306310. 10.1016/j.colsurfb.2007.12.016

  • 79

    ZhangG.LinX.LongY.WangY.ZhangY.MiH.et al (2009). A peptide fragment derived from the T-cell antigen receptor protein alpha-chain adopts beta-sheet structure and shows potent antimicrobial activity.Peptides30647653. 10.1016/j.peptides.2008.12.002

Summary

Keywords

antimicrobial peptide (AMP), synthetic peptide, minimum inhibitory concentration (MIC), liposome, membrane phospholipid, membrane permeabilization

Citation

Barreto-Santamaría A, Curtidor H, Arévalo-Pinzón G, Herrera C, Suárez D, Pérez WH and Patarroyo ME (2016) A New Synthetic Peptide Having Two Target of Antibacterial Action in E. coli ML35. Front. Microbiol. 7:2006. doi: 10.3389/fmicb.2016.02006

Received

19 September 2016

Accepted

30 November 2016

Published

20 December 2016

Volume

7 - 2016

Edited by

Octavio Luiz Franco, Universidade Católica de Brasília, Brazil

Reviewed by

Nuno C. Santos, University of Lisbon, Portugal; Sónia Gonçalves, Universidade de Lisboa, Portugal

Updates

Copyright

*Correspondence: Hernando Curtidor, ;

This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics