Abstract
Synthetically derived peptide-based biomaterials are in many instances capable of mimicking the structure and function of their full-length endogenous counterparts. Combine this with the fact that short mimetic peptides are easier to produce when compared to full length proteins, show enhanced processability and ease of modification, and have the ability to be prepared under well-defined and controlled conditions; it becomes obvious why there has been a recent push to develop regenerative biomaterials from these molecules. There is increasing evidence that the incorporation of peptides within regenerative scaffolds can result in the generation of structural recognition motifs that can enhance cell attachment or induce cell signaling pathways, improving cell infiltration or promote a variety of other modulatory biochemical responses. By highlighting the current approaches in the design and application of short mimetic peptides, we hope to demonstrate their potential in soft-tissue healing while at the same time drawing attention to the advances made to date and the problems which need to be overcome to advance these materials to the clinic for applications in heart, skin, and cornea repair.
Introduction
Bioinspired materials for tissue repair have been amongst the most exhaustively explored fields in biomaterials research, yet mimicry of native extra cellular matrix (ECM), remains one of the most challenging tasks in tissue engineering. Further, while remarkable progress in recombinant protein expression has been made, there remains a gap as these processes are still relatively expensive particularly for heteromeric proteins; thus limiting scientists to the use animal origin (e.g., extracted from tissues) proteins including collagen and elastin for engineering translatable biomaterials. This limitation has severely halted clinical translation of functional biomaterials to the clinic. It is well-known that proteins take on an important role in almost all biological processes. While they have well-defined roles in the structural integrity of cells, organs, and tissues; their roles in other processes such as cell motility, signal transduction, immunological response, and enzymatic reactions are much more dynamic (Ouzounis et al., ). As such, many of the important findings regarding wound healing and tissue repair have come through the study of protein-protein and protein-ligand interactions. One such finding is that molecules which present binding sites for proteins, typically associated with either disease or wound healing, are excellent targets for the development of therapeutic solutions (Webber et al., ). Given recent advancements in both chemical peptide synthesis and the recombinant production of full length proteins and peptides, generating and studying the interactions of mimetic molecules has been greatly simplified. Whether it is the production of exact copies of full-length or fragments of proteins, the incorporation of non-coded amino acids, or modification of the peptide backbone to enhance its proteolytic stability or the inclusion of tethers for further functionalization; one can generally find a suitable method to produce the desired molecule. For these reasons peptides, which are the small building blocks of proteins, have rapidly emerged as a cost-effective alternative for developing functional materials for tissue repair.
While the design options are almost limitless, these mimics usually interact with their target through the presentation of a specific amino acid sequence, a functional structure, or a combination of both. In this review, we will focus on peptides structures prepared using solid-phase peptide synthesis (SPPS), which for most systems nowadays takes place in cyclically automated synthetic equipment where each amino acid of the peptide structure is sequentially incorporated. Readers interested in learning more on peptide synthesis using transgenic organisms are encouraged to seek out reviews on this specific topic (Structural Genomics et al., ).
SPPS was conceptualized in 1959 and first reported on in the early 1960's by the Nobel awardee Robert Bruce Merrifield, its popularity and mainstream adoption grew in the 1970's and 1980's as technological advances in peptide chemistry made the process more robust (Merrifield, ). The concept of extending a peptide chain through the α-Nitrogen of an amino acid (a.a.) by coupling it with the carboxyl terminal of the next sequential a.a. whose other functional groups are protected, truly revolutionized the way peptides chains were produced. These protecting groups serve to prevent both oxidations and unspecific reactions of the a.a. side chains (Isidro-Llobet et al., ). Decades of intense synthetic research have yielded a number of versatile protecting groups such as the archetypical Fluorenylmethyloxycarbonyl (Fmoc) group. Single a.a.'s bearing Fmoc group are readily available on the market (Sigma-Aldrich, ). Technological improvement in SPPS, such as the use of microwave reactors and advanced temperature control systems, has allowed for the synthesis of peptides containing hundreds of a.a.'s in improved yield and reaction time in comparison to room temperature and convectional heating methods (Bacsa et al., ; Loffredo et al., ; Pedersen et al., ; Thapa et al., ). These technological advances have also contributed to the expedited synthesis of so-called difficult peptide sequences. Difficult peptide sequences refer to peptide sequences that agglomerate forming insoluble products during synthesis or after removal of the protective groups, a process that results in reduced yields or deactivation of the peptide preventing further modifications (Tickler and Wade, ). In most instance these problems arise due to introduction of functionalities capable a participating in non-covalent interactions, such as hydrogen bonds and dipole-dipole interactions (Paradis-Bas et al., ). Thus, when designing peptides for SPPS, both the individual a.a. and the resulting coupling products (on the resin) should be screened for the potential formation of self-assembled structures, side reactions, and tendency to fold onto the resin. The following parameters have been demonstrated to aid in the synthesis of difficult peptide sequences: (i) high temperatures (e.g., 95°C for microwave-assisted synthesis), (ii) presence of salt or detergents for improving solubility, (iii) protecting groups at the amide group to avoid potential hydrogen-bond interactions, (iv) incorporation of amino acids with unreactive side chains to prevent undesired interactions, and (v) glycosylation or pegylation to improve peptide solubility.
Bioactive Peptide Sequence Mimics
Structural mimics developed using peptide sequences are in fact epitopes of bioactive sites, where in many instances the recognition site of the mimic is defined by both the amino acid sequence and three-dimensional conformation. In the following sections, we will discuss a number of bioactive short peptide sequences that have been identified, synthesized, and/or incorporated into structures to impart some type of biological response which could be exploited in tissue engineering or the development of regenerative biomaterials. The peptide sequences which will be discussed correspond to a representative set of examples, which we believe fall into one of the following three categories which we deemed most important in the development of functional biomaterials for the regeneration of heart, skin, and corneal tissue, namely, (i) pro-angiogenic sequences, (ii) anti-inflammatory, and (iii) pro-adherence sequences. Table 1 contains some representative peptide sequences that have been identified and used in the fabrication of functional materials. Scheme 1 depicts a representative summary for the concepts revised in this review. While we have limited this review to our expertise in soft tissue targets such as the heart, skin, and cornea, it is important to mention that peptide based materials have also found applications in the regeneration of hard-tissues such as bone and teeth, and that further information regarding these applications and recent advancements can be found in more specialized reviews (Pountos et al., ; Wang et al., ).
Table 1
| Peptide Sequence | Reference(s) | Main findings | Limitations | Portion of protein extracted | Receptors involved | |
|---|---|---|---|---|---|---|
| ECM PROTEINS | ||||||
| Collagen | GFOGER | Knight et al., ; Wojtowicz et al., | Authors demonstrate the utility of coating grafts and improvement in bone growth with the peptide | Used an original sequence that included a GGYGG sequence that does not demonstrate utility in the self-assemble process and was added originally for radiolabeling (Reyes and Garcia, ) | Residues 502–507 of the αl(I)-CB3 fragment of type I collagen | α2β1 integrin receptor |
| DGEA | Mehta et al., | DGEA induced osteogenesis only when encapsulated with cells in a 3D network. The peptide does not provide any advantages when used in 2D cell culture | The authors do not provide details regarding the nature of peptide attachment to the polymer or whether it formed dimers through the carboxylic acids of the peptides | Residues 435–438 of the αl(I)-CB3 fragment of type I collagen | α2β1 integrin receptor | |
| FPGERGVEGPGP | Gelain et al., ; Bradshaw et al., | Authors demonstrated the ability of the peptide to induce migration of fibroblast in hydrogels | The peptide itself does not induce cell proliferation | – | – | |
| Laminin | IKVAV | Tashiro et al., ; Yamada et al., | Authors demonstrate that the peptide promotes cell attachment | The peptide sequence does not produce the same response as laminin | From the α-helix A chain segment of fragment E8 starts at amino acid position 1886 | – |
| YIGSR | Graf et al., ; Yoshida et al., ; Boateng et al., | They demonstrated the ability of the peptide to attach cardiomyocytes onto a silica treated surface | The peptide sequence does not produce the same response as laminin | β1 chain amino acid residues 929–933 on the of Laminin-1 | – | |
| PDGSR | Kleinman et al., ; Huettner et al., | They demonstrated an improvement in the adhesion of tumoral cells in the presence of the peptide | They compared the peptide with a cyclic YIGSR peptide, but did not provide information if the cyclic PDGSR could be improved too | β1 chain amino acid residues 902–906 on the of Laminin-1 | – | |
| LRE | Hunter et al., | They assessed the active protein recognition of the peptide for neurite outgrowth and its correlation with salts in the solution | No direct assessment of antibody interaction to identify the specific receptor involved in the interaction | The A-subunit of laminin and synaptic basal lamina | – | |
| IKLLI | Tashiro et al., | They demonstrated attachment of cells is similar to that seen with IKVAV peptide. Also demonstrate that conformation of the peptide in a secondary structure affects adhesion | They did not use other highly charged positive peptides to compare the affinity of the heparin | α1 chain of laminin, between amino acids residues 2080–2095 | Integrin receptor α3β1 and a cell surface heparan sulfate proteoglycan | |
| Fibronectin | RGDS | (Ruoslahti, ; D'souza et al., ; Leahy et al., ) | One of the most used sequences for cell attachment | It is not the only site involved in cell attachment and recognition, other molecules could be also key, as an example proteoglycans. | Domain 10, from amino acid sequence 1493 to 1496 | More than 10 RGD dependent receptors, as an example: α3β1, α5β1, αvβ1, etc… |
| KQAGDV | Hautanen et al., ; Calvete et al., | They provide well-documented information of attachment sectors of the peptide to the receptor | The authors did not show inhibition studies with the peptides under study | γ chain in the fibronectin protein | αIIbβ3, αVβ3 | |
| REDV | Hubbell et al., ; Massia and Hubbell, | Demonstrate similarities between this peptide and RGD peptide, also selectivity for vessel forming endothelial cells | – | Within the spliced type III connecting segment (III CS) domain of human plasma fibronectin | α4β1 | |
| PHSRN | Feng and Mrksich, | Demonstrate that this fragment is also recognized by integrin receptor, competitive with RGD, but with less strength than RGD | – | Within the 9th type III domain | α5β1 | |
| REMODELING ENZYMES | ||||||
| Collagenase | GPQGIWGQ GPQGYIAGQ GPQGYILGQ | Nagase and Fields, ; Lutolf et al., ; Patterson and Hubbell, | Substrates containing the sequence are cleaved under the conditions tested and can induce release of specific molecules after proteolytic effects | The sequence is not specific for one type of enzyme | Sequence presented in position 775 of αI fibril of the collagen | GPQG↓ (↓ = Enzyme proteolytic effect) |
| Matrix metalloproteinases (MMPs) | CPENYFFWGGGG | Salinas and Anseth, | Demonstrate that biomaterials performance depends on the presence and dynamic concentration of the receptor in the hydrogel | In hydrogels, the enzyme degradation rate is fast for surface and slow for deeper cues | Cleaved by MMP-13 | CPEN↓ |
| APGL | West and Hubbell, | The sequence is selective for collagenase, but not for plasmin. | The authors do not provide proof the sequence could be cleaved through cell culture | Cleaved by collagenase | APG↓ | |
| LGPA | Patel et al., | The sequence is attached to a photo responsive material, that can control hydrogel formation with light and degradation by the peptide sequence. | The sequence by itself does not induce cell attachment and survival in the long term | Collagenase-sensitive degradable sequence | – | |
| GTAGLIGQ | Jun et al., ; Kim et al., | The sequence is used to release other drugs, in this case cis-platin | The sequence is attached with an RGD sequence. This could affect enzymatic degradation rates (not evaluated without the RGD sequence) | MMP-2 specific cleavage | GTAG↓ | |
| Plasmin | YKNRD | Pratt et al., ; Raeber et al., | The sequence induces bone regeneration and cell attachment. Selective to plasmin | – | Plasmin sensitive sequence that is enhanced at the carboxylic side of the lysine amino acid | YK↓ |
| ELAPLRAP FPLRMRDW EGTKKGHK KKGHKLHL HPVGLLAR | Patterson and Hubbell, ; Singh et al., | Depending on the sequence selected, the hydrogel degradation rate can be tuned with respect to its sensibility toward plasmin | Sequences have shared activity with other MMPs | – | ELAP↓ FPLR↓ EGTKKGHK↓ KKGHK↓ HPVG↓ | |
| TARGET PROTEIN/RECEPTOR | ||||||
| Vascular endothelial growth factor | KLTWQELYQLKYKGI | Diana et al., ; Liu et al., | Demonstrated ability to promote angiogenesis | VEGF mimetic peptide agonist from amino acid sequence 87 to 100 | VEGF receptor 1-D2 | |
| LRK2LGKA | Webber et al., | Cationic amino acids are used to bind heparin binding factors to a self-assembling sequence | The attachment of the heparin binding is ionic and is not compared with covalent bonding, which could increase long term release of the factors | – | – | |
| Glycosaminoglycans | PNDRRR | Gilmore et al., | Heparin binding through the sequence RRR (or KKK) is used for increasing angiogenic properties | The attachment of heparin is ionic, thus reducing the long-term stability of the aminoglycan | – | – |
| SUPRAMOLECULAR STRUCTURE | ||||||
| Vesicle/Micelle | G4D2 G6D2 G8D2 G10D2 | Santoso et al., | Length of the peptide glycine chain, dictated the formation of nanovesicles or nanotubes | Lack of homogeneous structures | – | – |
| V6K2 L6K2 A6K V6H V6K H2V6 KV6 | Von Maltzahn et al., | The peptides have the ability to self-assemble in different macro-structures. One of the main advantages, is that they dissemble above their pI | Lack of homogeneous structures | – | – | |
| Fiber | (PKG)4(POG)4(DOG)4 | O'leary et al., | Stable formation of a hydrogel that has similar characteristics to collagen | Lack of D periodicity | – | – |
| PRG)4(POG)4(EOG)4 | Rele et al., | Stable formation of a hydrogel that has similar characteristics to collagen | Lack of strength when compared to collagen bundles | – | – | |
| (RADA)4 (RARADADA)2 (FKFE)2 (KLDL)3 | Sieminski et al., | Fibers are formed by β-sheet interactions. RADA incorporation leads to better attachment of cells | Ability to control fiber dimensions could improve comparison of the system | – | – | |
| MULTI-DOMAIN PEPTIDES | ||||||
| Double function peptide | E2(SL)6E2-G-RGDS | Bakota et al., | Left sequence used for self-assembly as a β-sheet [E2(SL)6E2]. Right sequence to be sensed as fibronectin receptor [RGDS] | – | – | – |
| C12H25O-YGAAKKAAKAAKKAAKAA | Chu-Kung et al., | Left sequence: lipid portion to interact with lipidic membranes [C12H25O]. Right sequence: cationic sequence to facilitate interaction with bacteria wall as an anti-microbial peptide [YGAAKKAAKAAKKAAKAA] | Lipid attachment could result in toxicity toward eukaryotic cells | – | – | |
| Quadruple function peptide | KS(LS)2-LRG-(SL)3KG- KLTWQELYQLKYKGI | Kumar et al., | Left sequence [KS(LS)2] used for self-assembly as a β-sheet Center left sequence (LRG) MMP-2 substrate. Center Right sequence [(SL)3KG]: used for self-assembly as a β-sheet Right sequence [KLTWQELYQLKYKGI] is a vascular endothelial growth factor | – | – | – |
Representative peptide sequences of potential interest in the development of functional biomaterials for tissue engineering.
Scheme 1
Pro-Angiogenic Sequences
Angiogenesis is a process which involves the proliferation and migration of endothelial cells as well as the concurrent remodeling of the extracellular matrix, which drives the development of new blood vessels from exiting vasculature (Potente et al., ). The principal regulator of angiogenesis in both physiological and diseased state is vascular endothelial growth factor (VEGF). VEGF and its many isoforms induce physiological responses through interaction with three well-described tyrosine kinase receptors (Simons et al., ). To date the most promising pro-angiogenic peptides are VEGF mimics. Of the available VEGF-mimics the most well-characterized is peptide QK, which was designed to imitate the binding of VEGF to its receptor through a N-terminal α-helix mimic comprised of the amino acid sequence, KLTWQELYQLKYKGI (Andrea et al., ). The angiogenic properties of peptide QK have been demonstrated both in vitro and in vivo, with evident endothelial cell activation and increases in VEGF related cellular functions such as chemotaxis, invasion, sprouting of new capillaries, and enhanced organization (Andrea et al., ; Finetti et al., ). A self-assembling β-sheet peptide hydrogel encompassing the QK sequence has also shown to promote cell infiltration and vascularization when injected subcutaneously in a rat model as shown in Figure 1 (Kumar et al., ).
Figure 1
It may also be interesting to explore the ability of these VEGF mimics to bind heparin as there is much literature regarding the propensity of different isoforms of VEGF to bind heparin and the necessity of this binding to promote endothelial cell growth and proliferation (Ferrara et al.,
Other peptides which have shown promise in regulating angiogenesis are targets of growth factor receptors which typically work in conjunction with VEGF. For example, fibroblast growth factor as well as neural cell adhesion molecules (NCAMs), which have been shown to bind to fibroblast growth factor receptors can also promote angiogenesis (Elfenbein et al.,
Anti-inflammatory Sequences
In the design of scaffolds and biomaterials for tissue engineering and regeneration, the host immune system is one of the largest barriers to overcome. However, this does not mean that immune response is to be completely avoided; in fact in order to maximize the therapeutic efficacy of implants it is necessary for them to modulate the resulting immune response. Furthermore, inflammation promotes angiogenesis and the formation of new blood vessels can lead to further inflammation. For this reason it is important to understand that inflammation is a complex process which eventually brings homeostasis to the effected tissue through the promotion of cell infiltration, proliferation, and subsequent polarization. While there are many players involved in immune response, macrophages are considered amongst the most important and as such the current section will focus on the ways peptide mimetics can or could be used in their regulation. Macrophages are dynamic cells whose phenotype is subject to polarization from the extracellular environment as well as active signaling molecules (Taraballi et al.,
One of the ways in which macrophage activation controls the immune response is through the expression/production of matrix metalloproteinases (MMPs). MMPs are a family of proteolytic enzymes which themselves are capable of modulating immune responses through the regulation of cytokines and chemokines. There are a handful of different types of MMPs all of which are capable of degrading extracellular matrix proteins and activating bioactive molecules via proteolytic cleavage or other modifications. Through the inclusion of MMP binding and cleavage sequences within the peptides that comprise a material it is possible to increase its local concentration while enhancing the proteolytic degradation of the material which can allow for its replacement with endogenous matrix and the release of small peptide fragments which can in turn modulate other cellular responses. An example, of an MMP epitope found in Type I collagen is the amino acid sequence GPQGIAG (Turk et al.,
Pro-Adherence Sequences
One of the key requirements of regenerative biomaterials is that they support the in-growth, attachment, and proliferation of endogenous cells. One way to ensure that cells attach to a material is to modify the material in such a way to incorporate a peptide that displays a specific binding sequence. One of the most ubiquitous and simple binding sequences are the RGD and RGDS motifs, which are prominent in adhesion proteins like fibronectin and fibrinogen but also structural proteins such as collagen and laminin (Yamada,
Also important to mention is that some peptide sequences can self-assemble due to intra or inter molecular interactions to form supramolecular structures driven by Van-Der-Waals, electrostatic, hydrogen bonding, hydrophobic, and π-π stacking (see Table 1). Different kinds of self-assembly structures can be generated from the peptides depending on their structure at the nanometer scale. Peptides can assemble as (i) α-coil, (ii) β-sheet, (iii) β-hairpins, and (iv) poly-proline helix. Depending on the supramolecular structure of the peptide assembly a variety of configurations can be achieved, which include vesicles, rods, or fibers. In addition, advancements in peptide synthesis have allowed for the fabrication of peptides bearing more than one property in their sequences. Thus, for example, in Table 2, some peptide sequences contain a self-assembly portion and a second portion which acts as a bio-recognition sequences for receptors, or a lipid-like portion for vesicle formation (see Table 1).
Table 2
| Peptide sequence | Tissue/Organ | Functional effect | Specific cell receptor | Delivery System | In vitro or In vivo test | Main findings | References |
|---|---|---|---|---|---|---|---|
| CG(PKG)4(POG)4(DOG)4, with O being hydroxyproline | Cornea | Corneal implant promoting cell and nerve regeneration | – | Self-assembly | Collagenase Cell proliferation In vivo biocompatibility by subcutaneous implantation Corneal implantation (pigs) In vitro toxicology, biocompatibility, metabolic activity, live/dead, DSC | Corneal implant was compatible for transplantation showing cell and nerve regeneration | Islam et al., |
| YIGSR | Promotes epithelial cell growth and neurite extension | Epithelial cells | Hydrogel | In vitro characterization (cell layers and thickness, nerve density, IR spectroscopy), immunohistochemistry, regeneration, corneal touch sensitivity | Overall corneal regeneration including nerve regeneration | Li et al., | |
| Q11 (Ac- QQKFQFQFEQQ-Am) | Skin | Wound healing in strong immune response | dermal | Wound closure, type of cell recruitment in mice with strong immune response | Immunogenic peptides do not delay healing, even in mice with heightened immune response | Vigneswaran et al., | |
| KGF–ELP | Chronic wound healing | KGF receptor | Fibrin hydrogel vehicle | Characterization (DLS, TEM), cell proliferation, full thickness wound healing | Enhanced granulation and reepithelialization | Koria et al., | |
| Pexiganan Acetate GIGKFLKKAKKFGKAFVKILKK | Antibacterial properties | Disturbs membrane permeability | Topical | MIC against gram-negative and positive bacteria, anaerobes, in vivo antibacterial activity, short term tolerability tests | Indication: infected diabetic foot ulcers, similar efficacy to ofloxacin | Lamb and Wiseman, | |
| HBPA (palmitoyl–AAAAGGGLRKKLGKA) | Increased angiogenesis | VEGF and FGF-2 | Gel administered subcutaneously | Subcutaneous implantation, histological and morphological analysis of wound site, skinfold chamber model, in vivo microscopy, microcirculatory analysis | Increased angiogenesis, including de novo angiogenesis | Ghanaati et al., | |
| RADA16-I, [COCH3]-RADARADARADARADA-[CONH2] with EGF | Improved would healing | Keratinocytes and fibroblasts | Topical | In vitro human skin equivalent wound healing model, proliferation assay, apoptosis assay, Histological analysis | Epithelialization and wound healing are accelerated with EGF and RADA-16, as opposed to RADA-16 alone | Schneider et al., | |
| RADA16-GG-RGDS and RADA16-GG-FPGERGVEGPGP | Improved cell migration | Keratinocytes and fibroblasts | Hydrogel | In vivo analysis, including SEM of cells with SAP, cell proliferation, cell migration | Improved cellular migration | Bradshaw et al., | |
| (RADA)4 | Heart | Self-assembling | Nanofiber | Rat MI model | Improved Angiogenesis | Dubois et al., | |
| (RADA)4-LRKKLGKA | Self-assembling heparin-binding sequence | Nanofiber with VEGF | Rat MI model | Improved Angiogenesis Improved Left ventricle contraction Decrease Fibrosis and Left ventricle remodeling | Guo et al., | ||
| (RARADADA)2 | Self-assembling | IFG-1 bound nanofiber with CMs | Rat MI model | Improved Cell survival Improved Left ventricle contraction Decrease cardiac remodeling | Davis et al., | ||
| Self-assembling | Dissolved in solution with MNCs | Porcine MI model | Improved Angiogenesis, Cell survival, and Left ventricle contraction. Reduced ventricular remodeling | Lin et al., | |||
| Self-assembling | Nanofiber with VEGF | Rat MI model Porcine MI model | Improved Angiogenesis Left ventricle contraction. Reduced ventricular remodeling | Lin et al., | |||
| Self-assembling | PDGF bound nanofiber | Rat MI model | Improved Angiogenesis, Cell survival and Left ventricle contraction. Reduced ventricular remodeling | Hsieh et al., | |||
| Self-assembling | Dissolved in solution with ADSCs | Rat MI model | Improved Angiogenesis, Cell survival and Left ventricle contraction. Reduced ventricular remodeling | Kim et al., | |||
| Self-assembling | SDF-1 bound nanofiber | Rat MI model | Increases EPC recruitment, Angiogenesis and Left ventricle contraction | Segers et al., | |||
| Self-assembling heparin-binding sequence | Nanofiber with MSCs | Rat MI model | Increases cell survival, Angiogenesis and Left ventricle contraction | Cui et al., | |||
| (RARADADA)2-CDDYYYGFGCNKFCRPR(Notch ligand Jagged-1) | Self-assembling Cell adhesion sequence | Hydrogel with CACs | Rat MI model | Increases cell survival and Left ventricle contraction. Decreases ventricular remodeling | Boopathy et al., | ||
| AAAAGGGEIKVAV(peptide amphiphile)-YIGSR AAAAGGGEIKVAV(peptide amphiphile)-KKKKK | Self-assembling EC adhesive ligand NO producing donor | Nanofiber | N/A | Increases EPC viability and differentiation | Andukuri et al., | ||
| Heparin-AAAAGGGEIKVAV(peptide amphiphile) | Self-assembling | VEGF/bFGF bound nanofiber | Mouse MI model | Increases Angiogenesis and Left ventricle contraction | Webber et al., | ||
| VVAGEGDKS | Glycosaminoglycan mimetic | Nanofiber | Rat MI model | Increases Angiogenesis and Left ventricle contraction | Rufaihah et al., | ||
| AcSDKP(Thymosinβ4) | Angiogenic | Collagen-chitosan hydrogel | Rat MI model | Increases Angiogenesis and cell survival. Reduces ventricular remodeling | Chiu et al., | ||
| KAFDITYVRLKF-AcSDKP(Thymosinβ4) | Proangiogenic Anti-inflammatory | Collagen hydrogel | Mouse subcutaneous implant | Increases Angiogenesis. Reduces Inflammation | Zachman et al., | ||
| RGD | Cell adhesion sequence | Alginate microsphere with MSCs | Rat MI model | Improved Angiogenesis, Cell survival, and Left ventricle contraction. Reduced ventricular remodeling | Yu et al., | ||
| RGD | Cell adhesion sequence | Alginate scaffold | Rat MI model | Improved Angiogenesis and Left ventricle function | Yu et al., | ||
| RGDfK | Cell adhesion sequence | Alginate scaffold with MSCs | Rat MI model | Improved Angiogenesis and Left ventricle contraction | Sondermeijer et al., | ||
| RGDS-AAAAGGGEIKVAV(peptide amphiphile) | Cell adhesion sequence Self-assembling | Subcutaneous injection with MNCs | Mouse | Improved Cell survival | Webber et al., | ||
| RGDSP-(RADA)4 | Cell adhesion sequence Self-assembling | Dissolved in solution with MCSCs | Rat MI model | Improved Cell survival and Left ventricle contraction. Reduced fibrosis | Guo et al., | ||
| GGGGRGDY | Cell adhesion sequence | Alginate scaffold | N/A | Improved NRVM contractility and viability | Shachar et al., | ||
| GRGDS | Cell adhesion sequence | Collagen hydrogel | N/A | Improved NRVM contractility and viability | Schussler et al., | ||
| QHREDGS | Cell adhesion sequence | Collagen-chitosan scaffold | N/A | Improved EC survival and tube formation | Miklas et al., | ||
| Cell adhesion sequence | Collagen-chitosan scaffold | N/A | Improved NRVM survival | Reis et al., | |||
| Cell adhesion sequence | Azidobenzoic acid-chitosan scaffold | N/A | Improved NRVM survival | Rask et al., | |||
| Cell adhesion sequence | Collagen-chitosan hydrogel | Rat MI model | Improved Cell survival and Left ventricle contraction. Reduced ventricular remodeling | Reis et al., | |||
| WKYMVm | Formyl peptide receptor 2 agonist | Dissolved in solution | Mouse MI model | Improved Angiogenesis and Left ventricle contraction. Reduced fibrosis | Heo et al., | ||
| KPVSLSYRCPCRFFESHPPLKWIQEYLEKALN | SDF-1a analog | Dissolved in solution | Mouse MI model | Improved Angiogenesis and Left ventricle contraction | Hiesinger et al., | ||
| YPHIDSLGHWRR | 78kDa Glucose-regulated protein receptor's ligand | Chitosan hydrogel | Rat MI model | Improved, Cell survival, Angiogenesis and Left ventricle contraction. Reduced ventricular remodeling | Shu et al., | ||
| MHSPGAD | Stem cell recruitment | Collagen hydrogel | Mouse MI model | Improved Angiogenesis and Left ventricle contraction. Reduced fibrosis and ventricular remodeling | Zhang et al., |
Peptide-containing biomaterials as therapeutic agents for tissue and organ repair of cornea, skin, and heart tissues.
Applications of Peptides in Tissue Engineering and Biomaterials
The modification of materials through bioengineering techniques has given rise to a promising route for the generation of synthetic and hybrid materials which not only display biological function and compatibility, but are also capable of controlling cellular microenvironment. The field of tissue engineering is continuously evolving and improving, changing the way scientists and engineers treat damaged tissues (Chen and Liu,
Peptides Sequences in Cornea and Skin Therapeutics
Collagen- and elastin-like peptides are commonly used peptides in skin and cornea tissue repair (Chattopadhyay and Raines,
The laminin adhesion pentapeptide motif, YIGSR, has also been grafted onto biosynthetic corneas comprised of hydrated collagen and N-isopropylacrylamide copolymers, and tested in Yucatan micropigs (Li et al.,
Peptides have also been functionalized in ways which allow them to be tethered to nanoparticles to generate biomimetic platforms, alter physical properties and cellular interactions, or allow for their incorporation into fibrils or hydrogels for various application (Chattopadhyay and Raines,
Elastin-like peptides (ELPs) have shown to be extremely useful in tissue engineering, due to their elastic properties, which help them mimic the physical properties of a number of different tissues and organs (Rodríguez-Cabello et al.,
Peptides such as Q11 and RADA-16, have also been incorporated into biomaterials and used in tissue engineering (Vigneswaran et al.,
Applications in the Heart
Myocardial infarction (MI) is a leading cause of death globally, and can ultimately lead to heart failure (World Health Organization,
Self-assembled peptide amphiphiles have emerged as versatile biomaterials (Beniash et al.,
Given the “hostile” environment within the infarcted heart, another approach has been to deliver soluble peptides within polymeric scaffolds to mimic extracellular matrix degradation products, which can act in a cytokine fashion (Zachman et al.,
Modification for Combination Therapies With Cells
Some large extracellular matrix (ECM) molecules, such as collagen and fibronectin, have multiple peptide sequences that are recognized by cells and induce multiple regenerative responses. To tackle the issue of poor retention and survival of reparative cellular components for MI, mimics of the nanotopographical cues of native ECM have been used to improve integration, proliferation and differentiation. The RGD sequence has been identified as the major cell-binding domain in fibronectin (Ruoslahti and Pierschbacher,
Other peptide ligands which are fundamental to specific cell types have also been investigated. For instance, due to the fact that Notch signaling has been shown to promote cardiac progenitor cell (CPC) mediated cardiac repair (Boni et al.,
Conclusions and Outlook
As the field looks to develop clinically translatable biomimetic materials for tissue regeneration, it is evident that peptide-based biomaterials have the ability to give rise to therapies which will not only provide improved quality of life, but also solve current problems associated with the xenogeneic nature of animal derived materials and the high cost of recombinantly prepared proteins. Due to recent advancements in SPPS and a better understanding of the structure-function relationship of peptides and proteins in complex biological settings, it is becoming more feasible to design targeted biomaterials capable of eliciting a desired response or enhanced biocompatibility. These short mimetic peptides are also typically more processable than their full length analogs and as such simpler to modify with a variety of different functionalities which could impart beneficial properties such as enhanced solubility, simple one step tethering to polymeric backbones, or stimuli responsiveness (pH, light, temperature, etc.). Given the complexity of the wound healing process, as we learn more about the factors determining tissue regeneration, it is likely that we will begin to see an increase in the development of combinatorial approaches and the design of materials consisting of numerous different structural and sequence based peptide mimics. While such complex materials are currently difficult to design, as predictive models improve and large bioactive peptide databases become available this task will be greatly simplified.
Statements
Author contributions
All authors listed have made a substantial, direct and intellectual contribution to the work, and approved it for publication.
Funding
This work was made possible by funding from the Natural Sciences and Engineering Research Council of Canada (NSERC) Discovery Grant No. RGPIN-2015-0632 to EA. EA would also like to thank the Canadian Institutes of Health Research (CIHR) for a Project Grant No. 375854. CM thanks the University of Ottawa Cardiac Endowment Fund at the Heart Institute for a postdoctoral fellowship. CL was thankful for the Queen Elizabeth II Graduate Scholarship in Science and Technology.
Acknowledgments
The authors would like to thank all the authors cited in this work.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
AndreaL. D.IaccarinoG.FattorussoR.SorrientoD.CarannanteC.CapassoD.et al. (2005). Targeting angiogenesis: structural characterization and biological properties of a de novo engineered VEGF mimicking peptide. PNAS102, 14215–14220. 10.1073/pnas.0505047102
2
AndukuriA.SohnY. D.AnakwenzeC. P.LimD. J.BrottB. C.YoonY. S.et al. (2013). Enhanced human endothelial progenitor cell adhesion and differentiation by a bioinspired multifunctional nanomatrix. Tissue Eng. Part C Met.19, 375–385. 10.1089/ten.tec.2012.0312
3
BacsaB.DesaiB.DiboG.KappeC. O. (2006). Rapid solid-phase peptide synthesis using thermal and controlled microwave irradiation. J. Pept. Sci.12, 633–638. 10.1002/psc.771
4
BakotaE. L.WangY.DaneshF. R.HartgerinkJ. D. (2011). Injectable multidomain peptide nanofiber hydrogel as a delivery agent for stem cell secretome. Biomacromolecules12, 1651–1657. 10.1021/bm200035r
5
BeniashE.HartgerinkJ. D.StorrieH.StendahlJ. C.StuppS. I. (2005). Self-assembling peptide amphiphile nanofiber matrices for cell entrapment. Acta Biomater.1, 387–397. 10.1016/j.actbio.2005.04.002
6
BoatengS. Y.LateefS. S.MosleyW.HartmanT. J.HanleyL.RussellB. (2005). RGD and YIGSR synthetic peptides facilitate cellular adhesion identical to that of laminin and fibronectin but alter the physiology of neonatal cardiac myocytes. Am. J. Physiol. Cell Physiol.288, C30–C38. 10.1152/ajpcell.00199.2004
7
BoersemaG. S. A.GrotenhuisN.BayonY.LangeJ. F.Bastiaansen-JenniskensY. M. (2016). The effect of biomaterials used for tissue regeneration purposes on polarization of macrophages. BioResearch5, 6–14. 10.1089/biores.2015.0041
8
BoniA.UrbanekK.NascimbeneA.HosodaT.ZhengH.DelucchiF.et al. (2008). Notch1 regulates the fate of cardiac progenitor cells. PNAS105, 15529–15534. 10.1073/pnas.0808357105
9
BoopathyA. V.CheP. L.SomasuntharamI.FioreV. F.CabigasE. B.BanK.et al. (2014). The modulation of cardiac progenitor cell function by hydrogel-dependent Notch1 activation. Biomaterials35, 8103–8112. 10.1016/j.biomaterials.2014.05.082
10
BradshawM.HoD.FearM. W.GelainF.WoodF. M.IyerK. S. (2014). Designer self-assembling hydrogel scaffolds can impact skin cell proliferation and migration. Sci. Rep.4:6903. 10.1038/srep06903
11
BrancaccioM.HirschE.NotteA.SelvetellaG.LemboG.TaroneG. (2006). Integrin signalling: the tug-of-war in heart hypertrophy. Cardiovasc. Res.70, 422–433. 10.1016/j.cardiores.2005.12.015
12
BrunettiJ.RosciaG.LamprontiI.GambariR.QuerciniL.FalcianiC.et al. (2016). Immunomodulatory and anti-inflammatory activity in vitro and in vivo of a novel antimicrobial candidate. J. Biol. Chem.291, 25742–25748. 10.1074/jbc.M116.750257
13
CalveteJ. J.SchaferW.MannK.HenschenA.Gonzalez-RodriguezJ. (1992). Localization of the cross-linking sites of RGD and KQAGDV peptides to the isolated fibrinogen receptor, the human platelet integrin glicoprotein IIb/IIIa. Influence of peptide length. Eur. J. Biochem.206, 759–765. 10.1111/j.1432-1033.1992.tb16982.x
14
ChattopadhyayS.RainesR. T. (2014). Review collagen-based biomaterials for wound healing. Biopolymers101, 821–833. 10.1002/bip.22486
15
ChenF.-M.LiuX. (2016). Advancing biomaterials of human origin for tissue engineering. Prog. Pol. Sci.53, 86–168. 10.1016/j.progpolymsci.2015.02.004
16
ChiuL. L.ReisL. A.MomenA.RadisicM. (2012). Controlled release of thymosin beta4 from injected collagen-chitosan hydrogels promotes angiogenesis and prevents tissue loss after myocardial infarction. Regen. Med.7, 523–533. 10.2217/rme.12.35
17
ChoC.-H.KammererR. A.LeeH. J.SteinmetzM. O.RyuY. S.LeeS. H.et al. (2004). COMP-Ang1: a designed angiopoietin-1 variant with nonleaky angiogenic activity. PNAS101, 5547–5552. 10.1073/pnas.0307574101
18
ChowL. W.BittonR.WebberM. J.CarvajalD.ShullK. R.SharmaA. K.et al. (2011). A bioactive self-assembled membrane to promote angiogenesis. Biomaterials32, 1574–1582. 10.1016/j.biomaterials.2010.10.048
19
Chu-KungA. F.BozzelliK. N.LockwoodN. A.HasemanJ. R.MayoK. H.TirrellM. V. (2004). Promotion of peptide antimicrobial activity by fatty acid conjugation. Bioconjug. Chem.15, 530–535. 10.1021/bc0341573
20
CuiX.-J.XieH.WangH.-J.GuoH.-D.ZhangJ.-K.WangC.et al. (2010). Transplantation of mesenchymal stem cells with self-assembling polypeptide scaffolds is conducive to treating myocardial infarction in rats. Tohoku J. Exp. Med.222, 281–289. 10.1620/tjem.222.281
21
DavisM. E.HsiehP. C.TakahashiT.SongQ.ZhangS.KammR. D.et al. (2006). Local myocardial insulin-like growth factor 1 (IGF-1) delivery with biotinylated peptide nanofibers improves cell therapy for myocardial infarction. PNAS103, 8155–8160. 10.1073/pnas.0602877103
22
DavisM. E.MotionJ. P.NarmonevaD. A.TakahashiT.HakunoD.KammR. D.et al. (2005). Injectable self-assembling peptide nanofibers create intramyocardial microenvironments for endothelial cells. Circulation111, 442–450. 10.1161/01.CIR.0000153847.47301.80
23
DianaD.BasileA.De RosaL.Di StasiR.AuriemmaS.ArraC.et al. (2011). beta-hairpin peptide that targets vascular endothelial growth factor (VEGF) receptors: design, NMR characterization, and biological activity. J. Biol. Chem.286, 41680–41691. 10.1074/jbc.M111.257402
24
D'souzaS. E.GinsbergM. H.PlowE. F. (1991). Arginyl-glycyl-aspartic acid (RGD): a cell adhesion motif. Trends Biochem. Sci.16, 246–250. 10.1016/0968-0004(91)90096-E
25
DuboisG.SegersV. F.BellamyV.SabbahL.PeyrardS.BrunevalP.et al. (2008). Self-assembling peptide nanofibers and skeletal myoblast transplantation in infarcted myocardium. J. Biomed. Mater. Res. B87, 222–228. 10.1002/jbm.b.31099
26
ElfenbeinA.SimonsM.MurakamiM. (2007). Non-canonical fibroblast growth factor signalling in angiogenesis. Cardiovasc. Res.78, 223–231. 10.1093/cvr/cvm086
27
FengY.MrksichM. (2004). The synergy peptide PHSRN and the adhesion peptide RGD mediate cell adhesion through a common mechanism. Biochemistry43, 15811–15821. 10.1021/bi049174
28
FerraraN.GerberH.-P.LecouterJ. (2003). The biology of VEGF and its receptors. Nat. Med.9, 669–676. 10.1038/nm0603-669
29
FerrariG.CookB. D.TerushkinV.PintucciG.MignattiP. (2009). Transforming growth factor-beta 1 (TGF-beta1) induces angiogenesis through vascular endothelial growth factor (VEGF)-mediated apoptosis. J. Cell. Physiol.219, 449–458. 10.1002/jcp.21706
30
FieldsG. B. (2010). Synthesis and biological applications of collagen-model triple-helical peptides. Org. Biomol. Chem.8, 1237–1258. 10.1039/b920670a
31
FinettiF.BasileA.CapassoD.Di GaetanoS.Di StasiR.PascaleM.et al. (2012). Functional and pharmacological characterization of a VEGF mimetic peptide on reparative angiogenesis. Biochem. Pharm.84, 303–311. 10.1016/j.bcp.2012.04.011
32
GavinsF. N. (2010). Are formyl peptide receptors novel targets for therapeutic intervention in ischaemia–reperfusion injury?Trends Pharm. Sci.31, 266–276. 10.1016/j.tips.2010.04.001
33
GelainF.BottaiD.VescoviA.ZhangS. (2006). Designer self-assembling peptide nanofiber scaffolds for adult mouse neural stem cell 3-dimensional cultures. PLoS ONE1:e119. 10.1371/journal.pone.0000119
34
GhanaatiS.WebberM. J.UngerR. E.OrthC.HulvatJ. F.KiehnaS. E.et al. (2009). Dynamic in vivo biocompatibility of angiogenic peptide amphiphile nanofibers. Biomaterials30, 6202–6212. 10.1016/j.biomaterials.2009.07.063
35
GilmoreL.RimmerS.McarthurS. L.MittarS.SunD.MacneilS. (2013). Arginine functionalization of hydrogels for heparin binding–a supramolecular approach to developing a pro-angiogenic biomaterial. Biotechnol. Bioeng.110, 296–317. 10.1002/bit.24598
36
GirottiA.RegueraJ.Rodríguez-CabelloJ. C.AriasF. J.AlonsoM.TesteraA. M. (2004). Design and bioproduction of a recombinant multi(bio)functional elastin-like protein polymer containing cell adhesion sequences for tissue engineering purposes. J. Mat. Sci.15, 479–484. 10.1023/B:JMSM.0000021124.58688.7a
37
GomesA.TeixeiraC.FerrazR.PrudêncioC.GomesP. (2017). Wound-healing peptides for treatment of chronic diabetic foot ulcers and other infected skin injuries. Molecules22:1743. 10.3390/molecules22101743
38
GrafJ.IwamotoY.SasakiM.MartinG. R.KleinmanH. K.RobeyF. A.et al. (1987a). Identification of an amino acid sequence in laminin mediating cell attachment, chemotaxis, and receptor binding. Cell48, 989–996. 10.1016/0092-8674(87)90707-0
39
GrafJ.OgleR. C.RobeyF. A.SasakiM.MartinG. R.YamadaY.et al. (1987b). A pentapeptide from the laminin B1 chain mediates cell adhesion and binds the 67,000 laminin receptor. Biochemistry26, 6896–6900. 10.1021/bi00396a004
40
GuoH. D.CuiG. H.WangH. J.TanY. Z. (2010). Transplantation of marrow-derived cardiac stem cells carried in designer self-assembling peptide nanofibers improves cardiac function after myocardial infarction. Biochem. Biophys. Res. Commun.399, 42–48. 10.1016/j.bbrc.2010.07.031
41
GuoH. D.CuiG. H.YangJ. J.WangC.ZhuJ.ZhangL. S.et al. (2012). Sustained delivery of VEGF from designer self-assembling peptides improves cardiac function after myocardial infarction. Biochem. Biophys. Res. Commun.424, 105–111. 10.1016/j.bbrc.2012.06.080
42
HautanenA.GailitJ.MannD. M.RuoslahtiE. (1989). Effects of modifications of the RGD sequence and its context on recognition by the fibronectin receptor. J. Biol. Chem.264, 1437–1442.
43
HeoS. C.KwonY. W.JangI. H.JeongG. O.LeeT. W.YoonJ. W.et al. (2017). Formyl peptide receptor 2 is involved in cardiac repair after myocardial infarction through mobilization of circulating angiogenic cells. Stem Cells35, 654–665. 10.1002/stem.2535
44
HiesingerW.Perez-AguilarJ. M.AtluriP.MarottaN. A.FrederickJ. R.FitzpatrickJ. R.III.MccormickR. C.et al. (2011). Computational protein design to reengineer stromal cell-derived factor-1alpha generates an effective and translatable angiogenic polypeptide analog. Circulation124, S18–S26. 10.1161/CIRCULATIONAHA.110.009431
45
HsiehP. C.DavisM. E.GannonJ.MacgillivrayC.LeeR. T. (2006a). Controlled delivery of PDGF-BB for myocardial protection using injectable self-assembling peptide nanofibers. J. Clin. Invest.116, 237–248. 10.1172/JCI25878
46
HsiehP. C.MacgillivrayC.GannonJ.CruzF. U.LeeR. T. (2006b). Local controlled intramyocardial delivery of platelet-derived growth factor improves postinfarction ventricular function without pulmonary toxicity. Circulation114, 637–644. 10.1161/CIRCULATIONAHA.106.639831
47
HuG. F.RiordanJ. F.ValleeB. L. (1997). A putative angiogenin receptor in angiogenin-responsive human endothelial cells. Proc. Natl. Acad. Sci. U.S.A.94, 2204–2209. 10.1073/pnas.94.6.2204
48
HubbellJ. A.MassiaS. P.DesaiN. P.DrumhellerP. D. (1991). Endothelial cell-selective materials for tissue engineering in the vascular graft via a new receptor. Nat. Biotechnol.9, 568–572. 10.1038/nbt0691-568
49
HuettnerN.DargavilleT. R.ForgetA. (2018). Discovering cell-adhesion peptides in tissue engineering: beyond RGD. Trends Biotechnol.36, 372–383. 10.1016/j.tibtech.2018.01.008
50
HunterD. D.CashmanN.Morris-ValeroR.BulockJ. W.AdamsS. P.SanesJ. R. (1991). An LRE (leucine-arginine-glutamate)-dependent mechanism for adhesion of neurons to S-laminin. J. Neurosci.11, 3960–3971. 10.1523/JNEUROSCI.11-12-03960.1991
51
Isidro-LlobetA.AlvarezM.AlbericioF. (2009). Amino acid-protecting groups. Chem. Rev.109, 2455–2504. 10.1021/cr800323s
52
IslamM. M.RavichandranR.OlsenD.LjunggrenM. K.FagerholmP.LeeC. J.et al. (2016). Self-assembled collagen-like-peptide implants as alternatives to human donor corneal transplantation. RSC Adv.6, 55745–55749. 10.1039/C6RA08895C
53
JangamreddyJ. R.HaagdorensM. K. C.Mirazul IslamM.LewisP.SamantaA.FagerholmP.et al. (2018). Short peptide analogs as alternatives to collagen in pro-regenerative corneal implants. Acta Biomater.69, 120–130. 10.1016/j.actbio.2018.01.011
54
JunH. W.YuwonoV.ParamonovS. E.HartgerinkJ. D. (2005). Enzyme-mediated degradation of peptide-amphiphile nanofiber networks. Adv. Mater.17, 2612–2617. 10.1002/adma.200500855
55
KahlenbergJ. M.KaplanM. J. (2013). Little peptide, big effects: the role of LL-37 in inflammation and autoimmune disease. J. Immunol.191, 4895–4901. 10.4049/jimmunol.1302005
56
KimJ. H.ParkY.JungY.KimS. H.KimS. H. (2017). Combinatorial therapy with three-dimensionally cultured adipose-derived stromal cells and self-assembling peptides to enhance angiogenesis and preserve cardiac function in infarcted hearts. J. Tissue Eng. Regen. Med.11, 2816–2827. 10.1002/term.2181
57
KimJ. K.AndersonJ.JunH. W.RepkaM. A.JoS. (2009). Self-assembling peptide amphiphile-based nanofiber gel for bioresponsive cisplatin delivery. Mol. Pharm.6, 978–985. 10.1021/mp900009n
58
KleinmanH. K.GrafJ.IwamotoY.SasakiM.SchasteenC. S.YamadaY.et al. (1989). Identification of a second active site in laminin for promotion of cell adhesion and migration and inhibition of in vivo melanoma lung colonization. Arch. Biochem. Biophys.272, 39–45. 10.1016/0003-9861(89)90192-6
59
KnightC. G.MortonL. F.PeacheyA. R.TuckwellD. S.FarndaleR. W.BarnesM. J. (2000). The collagen-binding A-domains of integrins alpha(1)beta(1) and alpha(2)beta(1) recognize the same specific amino acid sequence, GFOGER, in native (triple-helical) collagens. J. Biol. Chem.275, 35–40. 10.1074/jbc.275.1.35
60
KoideT. (2005). Triple helical collagen-like peptides: engineering and applications in matrix biology. Connect. Tissue Res.46, 131–141. 10.1080/03008200591008518
61
KoriaP.YagiH.KitagawaY.MegeedZ.NahmiasY.SheridanR.et al. (2011). Self-assembling elastin-like peptides growth factor chimeric nanoparticles for the treatment of chronic wounds. PNAS108, 1034–1039. 10.1073/pnas.1009881108
62
KraehenbuehlT. P.ZammarettiP.Van Der VliesA. J.SchoenmakersR. G.LutolfM. P.JaconiM. E.et al. (2008). Three-dimensional extracellular matrix-directed cardioprogenitor differentiation: systematic modulation of a synthetic cell-responsive PEG-hydrogel. Biomaterials29, 2757–2766. 10.1016/j.biomaterials.2008.03.016
63
KrockB. L.SkuliN.SimonM. C. (2011). Hypoxia-induced angiogenesis: good and evil. Genes Cancer2, 1117–1133. 10.1177/1947601911423654
64
KumarV. A.TaylorN. L.ShiS.WangB. K.JalanA. A.KangM. K.et al. (2015). Highly angiogenic peptide nanofibers. ACS Nano9, 860–868. 10.1021/nn506544b
65
LambH. M.WisemanL. R. (1998). Pexiganan acetate. Drugs56, 1047–1052. 10.2165/00003495-199856060-00011
66
LeahyD. J.AukhilI.EricksonH. P. (1996). 2.0 Å crystal structure of a four-domain segment of human fibronectin encompassing the RGD loop and synergy region. Cell84, 155–164. 10.1016/S0092-8674(00)81002-8
67
LiF.CarlssonD.LohmannC.SuuronenE.VascottoS.KobuchK.et al. (2003). Cellular and nerve regeneration within a biosynthetic extracellular matrix for corneal transplantation. PNAS100, 15346–15351. 10.1073/pnas.2536767100
68
LiM.ZhangY.FeurinoL. W.WangH.FisherW. E.BrunicardiF. C.et al. (2008). Interleukin-8 increases vascular endothelial growth factor and neuropilin expression and stimulates ERK activation in human pancreatic cancer. Cancer Sci.99, 733–737. 10.1111/j.1349-7006.2008.00740.x
69
LinY. D.ChangM. Y.ChengB.LiuY. W.LinL. C.ChenJ. H.et al. (2015). Injection of Peptide nanogels preserves postinfarct diastolic function and prolongs efficacy of cell therapy in pigs. Tissue Eng. Part A21, 1662–1671. 10.1089/ten.tea.2014.0581
70
LinY. D.LuoC. Y.HuY. N.YehM. L.HsuehY. C.ChangM. Y.et al. (2012). Instructive nanofiber scaffolds with VEGF create a microenvironment for arteriogenesis and cardiac repair. Sci. Transl. Med.4:146ra109. 10.1126/scitranslmed.3003841
71
LinY. D.YehM. L.YangY. J.TsaiD. C.ChuT. Y.ShihY. Y.et al. (2010). Intramyocardial peptide nanofiber injection improves postinfarction ventricular remodeling and efficacy of bone marrow cell therapy in pigs. Circulation122, S132–S141. 10.1161/CIRCULATIONAHA.110.939512
72
LiuX.WangX.HoriiA.WangX.QiaoL.ZhangS.et al. (2012). In vivo studies on angiogenic activity of two designer self-assembling peptide scaffold hydrogels in the chicken embryo chorioallantoic membrane. Nanoscale4, 2720–2727. 10.1039/c2nr00001f
73
LoffredoC.AssuncaoN. A.GerhardtJ.MirandaM. T. (2009). Microwave-assisted solid-phase peptide synthesis at 60 degrees C: alternative conditions with low enantiomerization. J. Pept. Sci.15, 808–817. 10.1002/psc.1178
74
LutolfM. P.WeberF. E.SchmoekelH. G.SchenseJ. C.KohlerT.MullerR.et al. (2003). Repair of bone defects using synthetic mimetics of collagenous extracellular matrices. Nat. Biotechnol.21, 513–518. 10.1038/nbt818
75
MangoniM. L.McdermottA. M.ZasloffM. (2016). Antimicrobial peptides and wound healing: biological and therapeutic considerations. Exp. Dermatol.25, 167–173. 10.1111/exd.12929
76
MardilovichA.CraigJ. A.MccammonM. Q.GargA.KokkoliE. (2006). Design of a novel fibronectin-mimetic peptide–amphiphile for functionalized biomaterials. Langmuir22, 3259–3264. 10.1021/la052756n
77
MartinezF. O.GordonS. (2014). The M1 and M2 paradigm of macrophage activation: time for reassessment. F1000Prime Rep.6, 13–13. 10.12703/P6-13
78
MassiaS. P.HubbellJ. A. (1992). Vascular endothelial cell adhesion and spreading promoted by the peptide REDV of the IIICS region of plasma fibronectin is mediated by integrin alpha 4 beta 1. 267, 14019–14026.
79
MehtaM.MadlC. M.LeeS.DudaG. N.MooneyD. J. (2015). The collagen I mimetic peptide DGEA enhances an osteogenic phenotype in mesenchymal stem cells when presented from cell-encapsulating hydrogels. J. Biomed. Mater. Res. A103, 3516–3525. 10.1002/jbm.a.35497
80
MerrifieldR. B. (1963). Solid phase peptide synthesis. I. The synthesis of a tetrapeptide. J. Am. Chem. Soc.85, 2149–2154. 10.1021/ja00897a025
81
MiklasJ. W.DallabridaS. M.ReisL. A.IsmailN.RupnickM.RadisicM. (2013). QHREDGS enhances tube formation, metabolism and survival of endothelial cells in collagen-chitosan hydrogels. PLoS ONE8:e72956. 10.1371/journal.pone.0072956
82
MiottoM.GouveiaR. M.ConnonC. J. (2015). Peptide amphiphiles in corneal tissue engineering. J. Funct. Biomater.6, 687–707. 10.3390/jfb6030687
83
MouldA. P.KomoriyaA.YamadaK. M.HumphriesM. J. (1991). The CS5 peptide is a second site in the IIICS region of fibronectin recognized by the integrin alpha 4 beta 1. Inhibition of alpha 4 beta 1 function by RGD peptide homologues. J. Biol. Chem.266, 3579–3585.
84
NagaseH.FieldsG. B. (1996). Human matrix metalloproteinase specificity studies using collagen sequence-based synthetic peptides. Biopolymers40, 399–416.
85
NiyonsabaF.MaderaL.AfacanN.OkumuraK.OgawaH.HancockR. E. (2013). The innate defense regulator peptides IDR-HH2, IDR-1002, and IDR-1018 modulate human neutrophil functions. J. Leukoc. Biol.94, 159–170. 10.1189/jlb.1012497
86
O'learyL. E.FallasJ. A.BakotaE. L.KangM. K.HartgerinkJ. D. (2011). Multi-hierarchical self-assembly of a collagen mimetic peptide from triple helix to nanofibre and hydrogel. Nat. Chem.3, 821–828. 10.1038/nchem.1123
87
OuzounisC. A.CoulsonR. M. R.EnrightA. J.KuninV.Pereira-LealJ. B. (2003). Classification schemes for protein structure and function. Nat. Rev. Gen.4:508. 10.1038/nrg1113
88
Paradis-BasM.Tulla-PucheJ.AlbericioF. (2016). The road to the synthesis of “difficult peptides”. Chem. Soc. Rev.45, 631–654. 10.1039/C5CS00680E
89
PatelP. N.GobinA. S.WestJ. L.PatrickC. W.Jr. (2005). Poly(ethylene glycol) hydrogel system supports preadipocyte viability, adhesion, and proliferation. Tissue Eng.11, 1498–1505. 10.1089/ten.2005.11.1498
90
PattersonJ.HubbellJ. A. (2010). Enhanced proteolytic degradation of molecularly engineered PEG hydrogels in response to MMP-1 and MMP-2. Biomaterials31, 7836–7845. 10.1016/j.biomaterials.2010.06.061
91
PattersonJ.HubbellJ. A. (2011). SPARC-derived protease substrates to enhance the plasmin sensitivity of molecularly engineered PEG hydrogels. Biomaterials32, 1301–1310. 10.1016/j.biomaterials.2010.10.016
92
PedersenS. L.ToftengA. P.MalikL.JensenK. J. (2012). Microwave heating in solid-phase peptide synthesis. Chem. Soc. Rev.41, 1826–1844. 10.1039/C1CS15214A
93
PenaO. M.AfacanN.PistolicJ.ChenC.MaderaL.FalsafiR.et al. (2013). Synthetic cationic peptide IDR-1018 modulates human macrophage differentiation. PLoS ONE8:e52449. 10.1371/journal.pone.0052449
94
PillarisettiK.GuptaS. K. (2001). Cloning and relative expression analysis of rat stromal cell derived factor-1 (SDF-1): SDF-1 α mRNA is selectively induced in rat model of myocardial infarction. Inflammation25, 293–300. 10.1023/A:1012808525370
95
PontenA.FolestadE. B.PietrasK.ErikssonU. (2005). Platelet-derived growth factor D induces cardiac fibrosis and proliferation of vascular smooth muscle cells in heart-specific transgenic mice. Circ. Res.97, 1036–1045. 10.1161/01.RES.0000190590.31545.d4
96
PotenteM.GerhardtH.CarmelietP. (2011). Basic and therapeutic aspects of angiogenesis. Cell146, 873–887. 10.1016/j.cell.2011.08.039
97
PountosI.PanteliM.LampropoulosA.JonesE.CaloriG. M.GiannoudisP. V. (2016). The role of peptides in bone healing and regeneration: a systematic review. BMC Med.14:103. 10.1186/s12916-016-0646-y
98
PrattA. B.WeberF. E.SchmoekelH. G.MullerR.HubbellJ. A. (2004). Synthetic extracellular matrices for in situ tissue engineering. Biotechnol. Bioeng.86, 27–36. 10.1002/bit.10897
99
RaeberG. P.LutolfM. P.HubbellJ. A. (2005). Molecularly engineered PEG hydrogels: a novel model system for proteolytically mediated cell migration. Biophys. J.89, 1374–1388. 10.1529/biophysj.104.050682
100
RajangamK.BehannaH. A.HuiM. J.HanX.HulvatJ. F.LomasneyJ. W.et al. (2006). Heparin binding nanostructures to promote growth of blood vessels. Nano Lett.6, 2086–2090. 10.1021/nl0613555
101
RaskF.DallabridaS. M.IsmailN. S.AmoozgarZ.YeoY.RupnickM. A.et al. (2010). Photocrosslinkable chitosan modified with angiopoietin-1 peptide, QHREDGS, promotes survival of neonatal rat heart cells. J. Biomed. Mater. Res. A95, 105–117. 10.1002/jbm.a.32808
102
ReisL. A.ChiuL. L.LiangY.HyunhK.MomenA.RadisicM. (2012). A peptide-modified chitosan-collagen hydrogel for cardiac cell culture and delivery. Acta Biomater.8, 1022–1036. 10.1016/j.actbio.2011.11.030
103
ReisL. A.ChiuL. L.WuJ.FericN.LaschingerC.MomenA.et al. (2015). Hydrogels with integrin-binding angiopoietin-1-derived peptide, QHREDGS, for treatment of acute myocardial infarction. Circ. Heart Fail.8, 333–341. 10.1161/CIRCHEARTFAILURE.114.001881
104
ReleS.SongY.ApkarianR. P.QuZ.ConticelloV. P.ChaikofE. L. (2007). D-periodic collagen-mimetic microfibers. J. Am. Chem. Soc.129, 14780–14787. 10.1021/ja0758990
105
ReyesC. D.GarciaA. J. (2003). Engineering integrin-specific surfaces with a triple-helical collagen-mimetic peptide. J. Biomed. Mater. Res. A65, 511–523. 10.1002/jbm.a.10550
106
Rodríguez-CabelloJ. C.González De TorreI.Ibañez-FonsecaA.AlonsoM. (2018). Bioactive scaffolds based on elastin-like materials for wound healing. Adv. Drug Deliv. Rev.129, 118–133. 10.1016/j.addr.2018.03.003
107
Ross RobertS.Borg ThomasK. (2001). Integrins and the Myocardium. Circul. Res.88, 1112–1119. 10.1161/hh1101.091862
108
RotemS.MorA. (2009). Antimicrobial peptide mimics for improved therapeutic properties. Biochim. Biophys. Acta1788, 1582–1592. 10.1016/j.bbamem.2008.10.020
109
Rubert PérezC. M.ÁlvarezZ.ChenF.AytunT.StuppS.I. (2017). Mimicking the bioactivity of fibroblast growth factor-2 using supramolecular nanoribbons. ACS Biomater. Sci. Eng.3, 2166–2175. 10.1021/acsbiomaterials.7b00347
110
RufaihahA. J.YasaI. C.RamanujamV. S.ArularasuS. C.KofidisT.GulerM. O.et al. (2017). Angiogenic peptide nanofibers repair cardiac tissue defect after myocardial infarction. Acta Biomater.58, 102–112. 10.1016/j.actbio.2017.06.009
111
RuoslahtiE. (1988). Fibronectin and its receptors. Annu. Rev. Biochem.57, 375–413. 10.1146/annurev.bi.57.070188.002111
112
RuoslahtiE.PierschbacherM. D. (1987). New perspectives in cell adhesion: RGD and integrins. Science238, 491–497. 10.1126/science.2821619
113
SainsonR. C.JohnstonD. A.ChuH. C.HolderfieldM. T.NakatsuM. N.CramptonS. P.et al. (2008). TNF primes endothelial cells for angiogenic sprouting by inducing a tip cell phenotype. Blood111, 4997–5007. 10.1182/blood-2007-08-108597
114
SalinasC. N.AnsethK. S. (2008). The enhancement of chondrogenic differentiation of human mesenchymal stem cells by enzymatically regulated RGD functionalities. Biomaterials29, 2370–2377. 10.1016/j.biomaterials.2008.01.035
115
SamanenJ.AliF.RomoffT.CalvoR.SorensonE.VaskoJ.et al. (1991). Development of a small RGD peptide fibrinogen receptor antagonist with potent antiaggregatory activity in vitro. J. Med. Chem.34, 3114–3125. 10.1021/jm00114a022
116
SanadaF.KimJ.CzarnaA.ChanN. Y.-K.SignoreS.OgórekB.et al. (2014). c-Kit–positive cardiac stem cells nested in hypoxic niches are activated by stem cell factor reversing the aging myopathy. Circul. Res.114, 41–55. 10.1161/CIRCRESAHA.114.302500
117
SantosoS.HwangW.HartmanH.ZhangS. (2002). Self-assembly of surfactant-like peptides with variable glycine tails to form nanotubes and nanovesicles. Nano Lett.2, 687–691. 10.1021/nl025563i
118
ScarboroughR. M.RoseJ. W.HsuM. A.PhillipsD. R.FriedV. A.CampbellA. M.et al. (1991). Barbourin. A GPIIb-IIIa-specific integrin antagonist from the venom of Sistrurus m. barbouri. J. Biol. Chem.266, 9359–9362.
119
SchneiderA.GarlickJ. A.EglesC. (2008). Self-assembling peptide nanofiber scaffolds accelerate wound healing. PLoS ONE3:e1410. 10.1371/journal.pone.0001410
120
SchusslerO.CoiraultC.Louis-TisserandM.Al-ChareW.OlivieroP.MenardC.et al. (2009). Use of arginine-glycine-aspartic acid adhesion peptides coupled with a new collagen scaffold to engineer a myocardium-like tissue graft. Nat. Clin. Pract. Cardiovasc. Med.6, 240–249. 10.1038/ncpcardio1451
121
SegersV. F.TokunouT.HigginsL. J.MacgillivrayC.GannonJ.LeeR. T. (2007). Local delivery of protease-resistant stromal cell derived factor-1 for stem cell recruitment after myocardial infarction. Circulation116, 1683–1692. 10.1161/CIRCULATIONAHA.107.718718
122
ShacharM.Tsur-GangO.DvirT.LeorJ.CohenS. (2011). The effect of immobilized RGD peptide in alginate scaffolds on cardiac tissue engineering. Acta Biomater.7, 152–162. 10.1016/j.actbio.2010.07.034
123
ShinH.JoS.MikosA. G. (2003). Biomimetic materials for tissue engineering. Biomaterials24, 4353–4364. 10.1016/S0142-9612(03)00339-9
124
ShuY.HaoT.YaoF.QianY.WangY.YangB.et al. (2015). RoY peptide-modified chitosan-based hydrogel to improve angiogenesis and cardiac repair under hypoxia. ACS Appl. Mater. Interfaces7, 6505–6517. 10.1021/acsami.5b01234
125
SieminskiA. L.SeminoC. E.GongH.KammR. D. (2008). Primary sequence of ionic self-assembling peptide gels affects endothelial cell adhesion and capillary morphogenesis. J. Biomed. Mater. Res. A87, 494–504. 10.1002/jbm.a.31785
126
SierraM. D. L. L.YangF.NarazakiM.SalvucciO.DavisD.YarchoanR.et al. (2004). Differential processing of stromal-derived factor-1α and stromal-derived factor-1β explains functional diversity. Blood103, 2452–2459. 10.1182/blood-2003-08-2857
127
Sigma-Aldrich (2019). Standard Fmoc Amino Acids. Available online at: https://www.sigmaaldrich.com/chemistry/chemistry-products.html?TablePage=111084330
128
SimonsM.GordonE.Claesson-WelshL. (2016). Mechanisms and regulation of endothelial VEGF receptor signalling. Nat. Rev. Mol. Cell Biol.17, 611–625. 10.1038/nrm.2016.87
129
SinghH. D.BushnakI.UnsworthL. D. (2012). Engineered peptides with enzymatically cleavable domains for controlling the release of model protein drug from “soft” nanoparticles. Acta Biomater.8, 636–645. 10.1016/j.actbio.2011.10.028
130
SondermeijerH.WitkowskiP.SekiT.Van Der LaarseA.ItescuS.HardyM. A. (2017). RGDfK-peptide modified alginate scaffold for cell transplantation and cardiac neovascularization. Tissue Eng. Part A24, 740–751. 10.1089/ten.tea.2017.0221
131
StaatzW. D.FokK. F.ZutterM. M.AdamsS. P.RodriguezB. A.SantoroS. A. (1991). Identification of a tetrapeptide recognition sequence for the alpha 2 beta 1 integrin in collagen. J. Biol. Chem.266, 7363–7367.
132
Structural GenomicsC.China Structural GenomicsC.Northeast Structural GenomicsC.GraslundS.NordlundP.WeigeltJ.et al. (2008). Protein production and purification. Nat. Methods5, 135–146. 10.1038/nmeth.f.202
133
TanrikuluI. C.ForticauxA.JinS.RainesR. T. (2016). Peptide tessellation yields micrometre-scale collagen triple helices. Nat. Chem.8:1008. 10.1038/nchem.2556
134
TaraballiF.SushnithaM.TsaoC.BauzaG.LiveraniC.ShiA.et al. (2018). Biomimetic tissue engineering: tuning the immune and inflammatory response to implantable biomaterials. Adv. Healthcare Mater.7:1800490. 10.1002/adhm.201800490
135
TashiroK.SephelG. C.WeeksB.SasakiM.MartinG. R.KleinmanH. K.et al. (1989). A synthetic peptide containing the IKVAV sequence from the A chain of laminin mediates cell attachment, migration, and neurite outgrowth. J. Biol. Chem.264, 16174–16182.
136
TashiroK.-I.MonjiA.YoshidaI.HayashiY.MatsudaK.TashiroN.et al. (1999). An IKLLI-containing peptide derived from the laminin α1 chain mediating heparin-binding, cell adhesion, neurite outgrowth and proliferation, represents a binding site for integrin α3β1 and heparan sulphate proteoglycan. Biochem. J.340, 119–126. 10.1042/bj3400119
137
ThapaP.ZhangR. Y.MenonV.BinghamJ. P. (2014). Native chemical ligation: a boon to peptide chemistry. Molecules19, 14461–14483. 10.3390/molecules190914461
138
TicklerA. K.WadeJ. D. (2007). Overview of solid phase synthesis of “difficult peptide” sequences. Curr. Protoc. Protein Sci.50, 18.8.1–18.8.6. 10.1002/0471140864.ps1808s50
139
TurkB. E.HuangL. L.PiroE. T.CantleyL. C. (2001). Determination of protease cleavage site motifs using mixture-based oriented peptide libraries. Nat. Biotechnol.19, 661–667. 10.1038/90273
140
UrryD. W. (1988). Entropic elastic processes in protein mechanisms. I. Elastic structure due to an inverse temperature transition and elasticity due to internal chain dynamics. J. Protein Chem.7, 1–34. 10.1007/BF01025411
141
UrryD. W.HarrisR. D.LongM. M. (1981). Compounding of elastin polypentapeptide to collagen analogue: a potential elastomeric prosthetic material. Biomater. Med. Dev. Art Organs9, 181–194. 10.3109/10731198109118999
142
VigneswaranY.HanH.De LoeraR.WenY.ZhangX.SunT.et al. (2016). Winner of the student award in the hospital intern category, 10th World Biomaterials Congress, May 17–22, 2016, Montreal QC, Canada: peptide biomaterials raising adaptive immune responses in wound healing contexts. J. Biomed. Mat. Res. A104, 1853–1862. 10.1002/jbm.a.35767
143
Von MaltzahnG.VautheyS.SantosoS.ZhangS. (2003). Positively charged surfactant-like peptides self-assemble into nanostructures. Langmuir19, 4332–4337. 10.1021/la026526
144
WangC.LiuY.FanY.LiX. (2017). The use of bioactive peptides to modify materials for bone tissue repair. Regen. Biomater.4, 191–206. 10.1093/rb/rbx011
145
WebberM. J.HanX.Prasanna MurthyS. N.RajangamK.StuppS. I.LomasneyJ. W. (2010a). Capturing the stem cell paracrine effect using heparin-presenting nanofibres to treat cardiovascular diseases. J. Tissue Eng. Reg. Med.4, 600–610. 10.1002/term.273
146
WebberM. J.KesslerJ. A.StuppS. I. (2010b). Emerging peptide nanomedicine to regenerate tissues and organs. J. Int. Med.267, 71–88. 10.1111/j.1365-2796.2009.02184.x
147
WebberM. J.TongersJ.RenaultM.-A.RoncalliJ. G.LosordoD. W.StuppS. I. (2010c). Development of bioactive peptide amphiphiles for therapeutic cell delivery. Acta Biomater.6, 3–11. 10.1016/j.actbio.2009.07.031
148
WestJ. L.HubbellJ. A. (1999). Polymeric biomaterials with degradation sites for proteases involved in cell migration. Macromolecules32, 241–244. 10.1021/ma981296k
149
WojtowiczA. M.ShekaranA.OestM. E.DupontK. M.TemplemanK. L.HutmacherD. W.et al. (2010). Coating of biomaterial scaffolds with the collagen-mimetic peptide GFOGER for bone defect repair. Biomaterials31, 2574–2582. 10.1016/j.biomaterials.2009.12.008
150
World Health Organization (2017). The Top 10 Causes of Death. Available online at: http://www.who.int/mediacentre/factsheets/fs310/en/ (accessed March 2019).
151
XinX.YangS.IngleG.ZlotC.RangellL.KowalskiJ.et al. (2001). Hepatocyte growth factor enhances vascular endothelial growth factor-induced angiogenesis in vitro and in vivo. Am. J. Pathol.158, 1111–1120. 10.1016/S0002-9440(10)64058-8
152
YamadaK. M. (1991). Adhesive recognition sequences. J. Biol. Chem.266, 12809–12812.
153
YamadaM.KadoyaY.KasaiS.KatoK.MochizukiM.NishiN.et al. (2002). Ile-Lys-Val-Ala-Val (IKVAV)-containing laminin α1 chain peptides form amyloid-like fibrils. FEBS Lett.530, 48–52. 10.1016/S0014-5793(02)03393-8
154
YoshidaN.IshiiE.NomizuM.YamadaY.MohriS.KinukawaN.et al. (1999). The laminin-derived peptide YIGSR (Tyr-Ile-Gly-Ser-Arg) inhibits human pre-B leukaemic cell growth and dissemination to organs in SCID mice. Br. J. Cancer80, 1898–1904. 10.1038/sj.bjc.6690618
155
YuJ.DuK. T.FangQ.GuY.MihardjaS. S.SieversR. E.et al. (2010). The use of human mesenchymal stem cells encapsulated in RGD modified alginate microspheres in the repair of myocardial infarction in the rat. Biomaterials31, 7012–7020. 10.1016/j.biomaterials.2010.05.078
156
YuJ.GuY.DuK. T.MihardjaS.SieversR. E.LeeR. J. (2009). The effect of injected RGD modified alginate on angiogenesis and left ventricular function in a chronic rat infarct model. Biomaterials30, 751–756. 10.1016/j.biomaterials.2008.09.059
157
ZachmanA. L.CrowderS. W.OrtizO.ZienkiewiczK. J.BronikowskiC. M.YuS. S.et al. (2013). Pro-angiogenic and anti-inflammatory regulation by functional peptides loaded in polymeric implants for soft tissue regeneration. Tissue Eng. Part A19, 437–447. 10.1089/ten.tea.2012.0158
158
ZhangS. (2003). Fabrication of novel biomaterials through molecular self-assembly. Nat. Biotechnol.21, 1171–1178. 10.1038/nbt874
159
ZhangS.HolmesT.LockshinC.RichA. (1993). Spontaneous assembly of a self-complementary oligopeptide to form a stable macroscopic membrane. PNAS90, 3334–3338. 10.1073/pnas.90.8.3334
160
ZhangY.ZhuD.WeiY.WuY.CuiW.LiuqinL.et al. (2019). A collagen hydrogel loaded with HDAC7-derived peptide promotes the regeneration of infarcted myocardium with functional improvement in a rodent model. Acta Biomater.86, 223–234. 10.1016/j.actbio.2019.01.022
161
ZhouZ.WangJ.CaoR.MoritaH.SoininenR.ChanK. M.et al. (2004). Impaired angiogenesis, delayed wound healing and retarded tumor growth in perlecan heparan sulfate-deficient mice. Cancer Res.64, 4699–4702. 10.1158/0008-5472.CAN-04-0810
Summary
Keywords
peptides, biomaterials, tissue engineering, functional materials, synthetic polymers
Citation
Hosoyama K, Lazurko C, Muñoz M, McTiernan CD and Alarcon EI (2019) Peptide-Based Functional Biomaterials for Soft-Tissue Repair. Front. Bioeng. Biotechnol. 7:205. doi: 10.3389/fbioe.2019.00205
Received
06 May 2019
Accepted
09 August 2019
Published
23 August 2019
Volume
7 - 2019
Edited by
Hasan Uludag, University of Alberta, Canada
Reviewed by
Oscar Castano, University of Barcelona, Spain; Jennifer Patterson, KU Leuven, Belgium
Updates

Check for updates
Copyright
© 2019 Hosoyama, Lazurko, Muñoz, McTiernan and Alarcon.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Emilio I. Alarcon ealarcon@ottawaheart.ca
This article was submitted to Biomaterials, a section of the journal Frontiers in Bioengineering and Biotechnology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.