Abstract
Mitochondria are well known to serve as the powerhouse for cells and also the initiator for some vital signaling pathways. A variety of diseases are discovered to be associated with the abnormalities of mitochondria, including cancers. Thus, targeting mitochondria and their metabolisms are recognized to be promising for cancer therapy. In recent years, great efforts have been devoted to developing mitochondria-targeted pharmaceuticals, including small molecular drugs, peptides, proteins, and genes, with several molecular drugs and peptides enrolled in clinical trials. Along with the advances of nanotechnology, self-assembled peptide-nanomaterials that integrate the biomarker-targeting, stimuli-response, self-assembly, and therapeutic effect, have been attracted increasing interest in the fields of biotechnology and nanomedicine. Particularly, in situ mitochondria-targeted self-assembling peptides that can assemble on the surface or inside mitochondria have opened another dimension for the mitochondria-targeted cancer therapy. Here, we highlight the recent progress of mitochondria-targeted peptide-nanomaterials, especially those in situ self-assembly systems in mitochondria, and their applications in cancer treatments.
Introduction
Mitochondria, the dynamic sub-organelles in mammalian cells, are well known to be involved in the generation of adenosine triphosphate (ATP) (Roger et al., 2017). They are composed of mitochondrial membranes that include a porous outer membrane and an inner membrane with a space, and a mitochondrial matrix inside (). With their own genome and fission signatures (; ; ), mitochondria also participate in other essential physiological functions in the body, such as macromolecule biosynthesis (Spinelli and Haigis, 2018) and cell proliferation (), differentiation (Seo et al., 2018), apoptosis (), information transmission (), etc. Dysfunctions of mitochondria are discovered to be associated with a series of diseases that threaten human health (Nunnari and Suomalainen, 2012), including neurodegeneration (), cardiovascular disease (Siasos et al., 2018), and cancer (Ward and Thompson, 2012). Increasing evidence has revealed the relevance between the energetic production, metabolic biosynthesis, and singling pathways of mitochondria with the carcinogenesis (Weinberg and Chandel, 2015). Therefore, the mitochondrion has been recognized as a promising target to improve cancer therapeutics (; Vasan et al., 2020; ).
Currently, mitochondria can be intervened by either using the mitochondria-targeted reagents or modulating the specific targets, gene transcriptions, and kinase activities within or outside mitochondria (Smith et al., 2012). Particularly, with the discovery of several types of targeted compounds, the mitochondria-targeted approach attracts increasing attentions (Zinovkin and Zamyatnin, 2019). For instance, lipophilic cations, such as triphenylphosphonium (TPP) and dequalinium, are first discovered to target mitochondria (Murphy and Smith, 2007). TPP contains a positively charged phosphorus atom delocalized over three hydrophobic benzene rings (). The unique structure allows TPP to target the mitochondrial membrane due to the negative membrane potential and the favored activation energy when crossing phospholipid bilayers, resulting in a thousand-fold enhancement in the mitochondrial accumulation (Murphy and Hartley, 2018). Till now, two TPP-based small molecular antioxidants, MitoQ and SkQ1 (; Skulachev, 2007), have been enrolled in clinical trials for treatments of Parkinson disease, chronic kidney disease, and hepatitis C, as well as the dry-eye syndrome, respectively (; ; ). The second category is the mitochondria-targeted peptides, mainly including Szeto-Schiller (SS) peptides and mitochondria-penetrating peptides (MMPs) (; ). These peptides usually consist of hydrophobic and positively charged amino acids, which are assumed to target mitochondria driven by the negative membrane potential and the interaction with phospholipids on mitochondrial inner membranes (Zhao et al., 2004; ; ). One formulation of SS peptide (MTP-131) has been enrolled in clinical trials for treatments of heart attack and skeletal muscle mitochondrial dysfunction in the elderly. Besides, the mitochondrial precursor protein is a natural mitochondria-targeted species, which enters mitochondria via the mitochondrial protein import machinery (Neupert and Herrmann, 2007). These proteins contain a cleavable N-terminal targeted sequence, which is cleaved by mitochondrial peptidases once entering mitochondria (Wasilewski et al., 2017). In recent years, self-assembled peptide-nanomaterials are emerging as a new type of mitochondria-targeted category, due to their designable feature to combine the targeting, biological responsive, self-assembling, and therapeutic properties (Qi et al., 2018).
In this review, we focus on the mitochondria-targeted self-assembled peptide-nanomaterials developed in recent years. The latest strategies and advances for constructing self-assembling peptides that target and assemble in mitochondria are highlighted, including the equipment of mitochondria-targeted ligands, the introduction of a stimuli-responsive mechanism to trigger the self-assembly in situ, and so on. Meanwhile, we briefly discuss the application of these nanomaterials in cancer therapy.
Self-Assembling Peptide
Peptides are usually defined as the biomacromolecules that contain less than 50 amino acids linked by peptide bonds, with the intrinsic characteristics of folding and bioactivities like recognition and response. Since the emergences of technologies for the peptide manufacture and screening, especially the solid-phase peptide synthesis proposed by Merrifield in 1963 (Merrifield, 1963) and the phage display described by Smith in 1985 (Smith, 1985), numerous peptide-based pharmaceuticals and functional materials have been developed (Figure 1A) (; ; Lopez-Silva and Schneider, 2021; Muttenthaler et al., 2021). Particularly, self-assembling peptides have attracted increasing interest due to their improved stability and biological performance (; ), and have been applied in a wide range of fields including the tissue engineering (; Zhang et al., 2021), drug delivery (Moitra et al., 2014; ; Yang J. et al., 2020; ; ), catalysis (Rufo et al., 2014; Wang M. et al., 2020; Liu Q. et al., 2021; ), semi-conducting device (Tao et al., 2017), and energy materials (; ; Nguyen et al., 2021). With the molecular basis to form secondary structures including the α-helix and β-sheet, the self-assembling peptides can assemble into well-defined nanostructures like nanofibrils driven by non-covalent interactions, such as the hydrophobic interaction, electrostatic interaction, π-π stacking, hydrogen bond, etc (; ; Zheng et al., 2021). For instance, the di-phenylalanine peptide (FF), the most widely investigated self-assembling peptide, can assemble into either the nanofiber, nanotube, nanosphere, or nanoarray on the surface, by using properly mixed solvents and kinetic controls, or vapor deposition (Reches and Gazit, 2003; Wei et al., 2017; Zhao et al., 2019). The rapid development of self-assembling peptides can be traced back to 1990s (Zhang, 2020). The peptides in early researches are limited and mainly inspired from natural proteins especially amyloid proteins (Zhang, 2003), like FF and KLVFF. The developments of machine learning () and one-bead one-compound (OBOC) combinatorial library () technologies make the screening of self-assembling peptides in a large-scale manner possible. For instance, Frederix et al. developed a computational simulation tool based on the aggregation propensity and amphiphilicity of peptides, to rapidly screen the self-assembling tripeptides in all 8,000 possible sequences and guided the discoveries of several unreported tripeptides that could form hydrogels (). In another work, Li et al. focused on the relationship between the chemical structures of peptides and their albitites to form hydrogels, applying machine learning to generate a hydrogel library with more than 2,000 self-assembling dipeptides (). Besides computational simulations (Moitra et al., 2017), Yang et al. recently capped a hydrophobicity-sensitive probe, the nitro-1,2,3-benzoxadiazole (NBD), to the N-terminus of peptides on beads in the OBOC library, achieving the rapid screening of self-assembling pentapeptides experimentally (Yang et al., 2021).
FIGURE 1
Self-Assembled Peptide-Nanomaterials for Targeting Mitochondria
In recent years, targeted drug delivery systems have shown promising potentials in precision and personalized medicine, with reduced side effects (Yi et al., 2019; Mi et al., 2020; Manzari et al., 2021). In this regard, the integration with the biomarker-targeting, enzyme-response, and treatment makes the self-assembling peptides as candidates for functional nanomaterials and smart nanomedicines more than scaffolds in hydrogels. This endeavor has been promoted by the establishment of several important concepts including the peptide amphiphiles (Lowik and van Hest, 2004;
TABLE 1
| Materials | Peptide componentsa | Targeting mechanism | Assembling modules | Applications | References |
|---|---|---|---|---|---|
| Peptide amphiphile | Pyrene-FFK(TPP) | TPP ligand for targeting mitochondrial membrane | Pyrene-FF | Intra-mitochondrial assembly for cancer therapy in vitro | |
| Peptide amphiphile | Pyrene-FFK(TPP) and pyrene-ffk (TPP) | TPP ligand for targeting mitochondrial membrane | Pyrene-FF and pyrene-ff | Treatment of colorectal tumor (HT-29) in vivo | ( |
| Peptide amphiphile | C16-MIASHLLAYFFTELN-KVLKQRAKKK | Targeting mitochondrial VDAC1 by the peptide (MIASHLLAYFFTELN) derived from hexokinase-II protein | C16 alkyl chain | Treatment of lung cancer (A549) cells in vitro | |
| Peptide amphiphile | DYKDDDDKGE(C16)2 | Enterokinase-induced cleavage of peptide for drug release located at mitochondria | Lipid-like E (C16)2 | Delivery of chloramphenicol to liver tumoral (HepG2) mitochondria in vitro | |
| Peptide amphiphile | Cy5-KLVFF-TPP | TPP ligand for targeting mitochondrial membrane | KLVFF | Targeted NIR imaging and dysfunction of mitochondria in cervical and lung cancer (HeLa and A549) cells in vitro | |
| Peptide amphiphile | Pyrene-FFK(TPP) | TPP ligand for targeting mitochondrial membrane | Pyrene-FF | Treatment of sorafenib-resistant hepatocellular carcinoma (Huh7) cells in vitro | |
| Peptide amphiphile | Cy3-TPP/FF and Cy5-TPP/FF | TPP ligand for targeting mitochondrial membrane | FF | Mitochondria-targeted NIR imaging and early apoptosis of cancer cells in vitro | Saha et al. (2021) |
| Self-assembling peptide | NBD-FFpYK | TPP ligand for targeting mitochondrial membrane | NBD-FF | Treatment of osteosarcoma (Saos2) cells in vitro | Wang et al. (2016) |
| Self-assembling branched peptide | Nap-ffk (GDYKDDDDK)-NBD | Enterokinase-induced cleavage of peptide for self-assembly located at mitochondria | Nap-ffk(G)-NBD | Delivery of doxorubicin and red phycoerythrin to tumoral (HeLa) mitochondria in vitro | |
| Self-assembling peptide | NBD-FFFGK (succ)G and Fmoc-FFFGK (succ)G | Mitochondria-localized SIRT5 enzyme-induced desuccinylation of peptide for intra-mitochondrial self-assembly | NBD-FFF and Fmoc-FFF | Imaging of SIRT5 in living cells and improvement of the anticancer activities of dichloroacetate, cisplatin, and paclitaxel toward cervical cancer (HeLa) cells in vitro | Yang et al. (2020b) |
| Self-assembling peptide | Nap-ffk (GDYKDDDDK)y | Enterokinase-induced cleavage of peptide for self-assembly located at mitochondria | Nap-ffky | Delivery of histone protein H2B to tumoral (HeLa) mitochondria in vitro | |
| Self-assembling peptide | PEG-thioketal-K(P18)-(KLAKLAK)2 | ROS-triggered detachment of PEG to expose KLAK peptides for disrupting mitochondria | K(P18)-LVFF | Ultrasound-mediated treatment of orthotopic human pancreatic carcinoma (PANC-1) in vivo, and photoacoustic imaging-guided and NIR irradiation-mediated treatment of cervical tumor (HeLa) in vivo | ( |
| Peptide/pDNA self-assembly | MLSLRQSIRFFK-(KH)9 and MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQ-(KH)9 | Peptides derived from yeast Cytcox (MLSLRQSIRFFK) and human hepatic enzyme ornithine transcarbamylase (MLFNLRILLNNAAFRNGHNFMVRNFRCGQPLQ) for targeting mitochondria | Complexation of (KH)9 with pDNA via electrostatic interaction | Delivery of pDNA to cellular mitochondria in vitro | |
| Polymer-peptide conjugate | CGGG-(KLAKLAK)2 and CGGG-(HLAHLAH)2 | (KLAKLAK)2 or (HLAHLAH)2 peptides for disrupting mitochondrial membrane | Poly (β-thioester) polymeric backbone | Treatments of glioblastoma (U87) and cervical cancer (HeLa) cells in vitro, and murine melanoma (B16F10) in vivo | (Qiao et al., 2016b; Qiao et al., 2017a; Qiao et al., 2017b; |
| Polymer-peptide conjugate | CGGG-(KLAKLAK)2 and CYGRKKRRQRRR | Cell-penetrating peptide CYGRKKRRQRRR for enhancing cellular uptake and KLAK peptide for disrupting mitochondrial membrane | PAMAM or poly (β-thioester) polymeric backbone | Treatments of glioblastoma (U87) cells in vitro, and breast tumor (SKBR-3) in vivo combined with photothermal therapy | ( |
| Polymer-peptide conjugate | CGGG-(KLAKLAK)2 and CGGGKLVFF-thioketal-PEG | ROS triggered detachment of PEG to exposure the KLAK peptide for disrupting mitochondrial membrane | KLVFF conjugated poly (β-thioester) | Treatment of cervical tumor (HeLa) in vivo | |
| Supramolecular polymer-peptide complex | Supramolecular complex assembled from FGG-(kalkalk)2 and PEG-cucurbit[7]uril copolymers through host-guest interaction | KLAK peptide for disrupting mitochondrial membrane | PEG-cucurbit[7]uril copolymers | Treatments of colorectal tumor (HCT116) in vivo, and drug-resistant HCT116 cancer cells in vitro | (Wang et al., 2020a; Wang et al., 2021a) |
Recent progress of mitochondrial-targeted self-assembly of peptide-nanomaterials.
Peptides are named by using the standard single-letter amino acid code. The capital letter refers to the L-type amino acid, whereas the lowercase letter means the D-type amino acid. The abbreviations used in the table include the triphenylphosphonium (TPP), voltage-dependent anion channel-1 (VDAC1), sirtuin 5 (SIRT5), nitro-1,2,3-benzoxadiazole (NBD), naphthalene (Nap), succinylated lysine [K (succ)] (KLAKLAK)2 (KLAK), near-infrared (NIR), reactive oxygen species (ROS), poly (ethylene glycol) (PEG), purpurin-18 (P18), plasmid deoxyribonucleic acid (pDNA), cytochrome c oxidase subunit IV (Cytcox), cyanine 3 and 5 (Cy3 and Cy5), and polyamidoamine (PAMAM).
A typical approach to construct the mitochondria-targeted self-assembling peptide is to equip a targeting motif to a self-assembling peptide. For instance, Standley et al. combined the α-helical (KLAKLAK)2 (KLAK) peptide, a cytotoxic peptide that breaks mitochondrial membranes (
Despite the successes in cultured cells, the self-assembling peptides still face the intrinsic nature of instability in physiological environments, as well as several physiological barriers when applied in the body, such as the rapid clearance in blood, uncontrolled transportation to diseased tissues, insufficient cellular internalization and endosomal escape, etc (Sun et al., 2017). To improve the biological performances in the body, Wang and coworkers reported a series of polymer-peptide conjugates (PPCs) as in vivo self-assembled nanomedicines (
In Situ Self-Assembly of Peptide-Nanomaterials in Mitochondria
In the previous section, we discussed the assembled peptide-nanomaterials that locate mitochondria. Recently, the in situ self-assembly attracts much attention due to its spatiotemporal precision and activable bioeffects, emerging as a frontier in the biomedical field (
To further achieve the precise self-assembly of peptides inside mitochondria, the targeted accumulation-induced assembly and the intramitochondrial protease-instructed assembly have shown promising potentials. Since enough concentration higher than the critical aggregation concentration (CAC) is the basis for molecular assemblies, making the self-assembling peptides with a spatial concentration above CAC in mitochondria selectively and a concentration below CAC in the cytoplasm is a feasible approach to achieve in situ self-assembly in mitochondria. For instance, Jeena et al. reported a system of in situ self-assembly (Mito-FF) that assembled inside mitochondria through targeted accumulation-induced assembly (Figure 1C) (
Applications in Cancer Therapy
Although peptides and peptide-based vaccines and nanomaterials have been frequently reported for cancer therapy (
To realize the mitochondria-cytotoxic peptides for improved cancer therapy, Qiao et al. developed a type of PPCs containing KLAK peptides prepared by Michael-type addition (Qiao et al., 2016a). This synthetic method allowed the facile conjugations of targeted and therapeutic peptides together with PEG chains to a polymer backbone, achieving both the improved biological stability and enhanced anticancer efficacy toward the subcutaneous glioblastoma (U87)-bearing mouse model. However, this covalent approach suffers from the long reaction time (e.g., 2 days) and the competitive reactions from the thiol and amine groups. To construct a fast and simple method for systemic delivery of peptide pharmaceuticals, Wang et al. based on the concept of non-covalent supramolecular chemotherapy (
Conclusion and Outlook
The advances in nanotechnology and biotechnology have witnessed the great progress of the self-assembling peptides from simple scaffolds of hydrogels to smart nanomaterials for versatile biomedical applications, bridging the gap between simple synthetic molecules with sophisticated biological machinery in the body. Owning to the advantages including the excellent biocompatibility and the inclusivity for multiple biological and physicochemical activities, the self-assembling peptide achieves the self-assembled accuracy from levels of the tissue, through cells, to cellular organelles. However, several challenges still exist for the further development of mitochondria-targeted self-assembling peptides. The first is the precise self-assembly. Besides the membrane potential, enzyme, and ROS, other candidates such as the mitochondrial protein import machinery and nucleic acids (Zhao et al., 2021) are also promising targets. The second one is the characterization in situ. High-resolution, real-time, and in situ technologies are highly desirable to investigate the process and kinetics of the self-assembly in organelles. The third one is the rapid design and screening. The technology of machine learning may provide a high-throughput method to develop self-assembling peptides equipped with multiple bioactive and functional modules. Last but not least, biological safety should be highly concerned. Since the prolonged retention nature of the peptide nanofibers, careful studies in the degradation, metabolism, and long-term toxicology of the self-assembling peptides are important for their further clinical applications. Despite the challenges, we believe the self-assembled peptide-nanomaterials, especially the organelle-precise self-assembling peptides, will contribute to the new paradigms of biomedical technologies and products.
Statements
Author contributions
All authors listed have made a substantial, direct, and intellectual contribution to the work and approved it for publication.
Funding
This research was financially supported by the National Key R&D Program of China (No. 2018YFE0205400) and the National Natural Science Foundation of China (Nos. 21805058 and 51890892).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fbioe.2021.782234/full#supplementary-material
References
1
AbbasM.ZouQ.LiS.YanX. (2017). Self-Assembled Peptide- and Protein-Based Nanomaterials for Antitumor Photodynamic and Photothermal Therapy. Adv. Mater.29, 1605021. 10.1002/adma.201605021
2
BattogtokhG.ChoiY. S.KangD. S.ParkS. J.ShimM. S.HuhK. M.et al (2018). Mitochondria-Targeting Drug Conjugates for Cytotoxic, Anti-Oxidizing and Sensing Purposes: Current Strategies and Future Perspectives. Acta Pharm. Sin. B8, 862–880. 10.1016/j.apsb.2018.05.006
3
BirkA. V.LiuS.SoongY.MillsW.SinghP.WarrenJ. D.et al (2013). The Mitochondrial-Targeted Compound SS-31 Re-Energizes Ischemic Mitochondria by Interacting with Cardiolipin. J. Am. Soc. Nephrol.24, 1250–1261. 10.1681/asn.2012121216
4
BockF. J.TaitS. W. G. (2020). Mitochondria as Multifaceted Regulators of Cell Death. Nat. Rev. Mol. Cell Biol.21, 85–100. 10.1038/s41580-019-0173-8
5
ChandelN. S. (2015). Evolution of Mitochondria as Signaling Organelles. Cell Metab.22, 204–206. 10.1016/j.cmet.2015.05.013
6
Chandra SahaP.DasR. S.ChatterjeeT.BhattacharyyaM.GuhaS. (2020). Supramolecular β-Sheet Forming Peptide Conjugated with Near-Infrared Chromophore for Selective Targeting, Imaging, and Dysfunction of Mitochondria. Bioconjug. Chem.31, 1301–1306. 10.1021/acs.bioconjchem.0c00153
7
ChenH.ChenY.WuH.XuJ.-F.SunZ.ZhangX. (2018a). Supramolecular Polymeric Chemotherapy Based on Cucurbit[7]uril-PEG Copolymer. Biomaterials178, 697–705. 10.1016/j.biomaterials.2018.02.051
8
ChenH.GuZ.AnH.ChenC.ChenJ.CuiR.et al (2018b). Precise Nanomedicine for Intelligent Therapy of Cancer. Sci. China Chem.61, 1503–1552. 10.1007/s11426-018-9397-5
9
ChenY.HuangZ.ZhaoH.XuJ.-F.SunZ.ZhangX. (2017). Supramolecular Chemotherapy: Cooperative Enhancement of Antitumor Activity by Combining Controlled Release of Oxaliplatin and Consuming of Spermine by Cucurbit[7]uril. ACS Appl. Mater. Inter.9, 8602–8608. 10.1021/acsami.7b01157
10
ChenY.YangY.OrrA. A.MakamP.RedkoB.HaimovE.et al (2021). Self‐Assembled Peptide Nano‐Superstructure towards Enzyme Mimicking Hydrolysis. Angew. Chem. Int. Ed.60, 17164–17170. 10.1002/anie.202105830
11
ChengD.-B.YangP.-P.CongY.LiuF.-H.QiaoZ.-Y.WangH. (2017). One-Pot Synthesis of pH-Responsive Hyperbranched Polymer-Peptide Conjugates with Enhanced Stability and Loading Efficiency for Combined Cancer Therapy. Polym. Chem.8, 2462–2471. 10.1039/c7py00101k
12
ChengD.-B.ZhangX.-H.ChenY.ChenH.QiaoZ.-Y.WangH. (2020). Ultrasound-Activated Cascade Effect for Synergistic Orthotopic Pancreatic Cancer Therapy. iScience23, 101144. 10.1016/j.isci.2020.101144
13
ChengD.-B.ZhangX.-H.GaoY.-J.JiL.HouD.WangZ.et al (2019). Endogenous Reactive Oxygen Species-Triggered Morphology Transformation for Enhanced Cooperative Interaction with Mitochondria. J. Am. Chem. Soc.141, 7235–7239. 10.1021/jacs.8b07727
14
ChiangjongW.ChutipongtanateS.HongengS. (2020). Anticancer Peptide: Physicochemical Property, Functional Aspect and Trend in Clinical Application (Review). Int. J. Oncol.57, 678–696. 10.3892/ijo.2020.5099
15
ChuahJ.-A.MatsugamiA.HayashiF.NumataK. (2016). Self-Assembled Peptide-Based System for Mitochondrial-Targeted Gene Delivery: Functional and Structural Insights. Biomacromolecules17, 3547–3557. 10.1021/acs.biomac.6b01056
16
CongY.JiL.GaoY. J.LiuF. H.ChengD. B.HuZ.et al (2019). Microenvironment‐Induced In Situ Self‐Assembly of Polymer-Peptide Conjugates that Attack Solid Tumors Deeply. Angew. Chem. Int. Ed.58, 4632–4637. 10.1002/anie.201900135
17
CuiH.WebberM. J.StuppS. I. (2010). Self-Assembly of Peptide Amphiphiles: From Molecules to Nanostructures to Biomaterials. Biopolymers94, 1–18. 10.1002/bip.21328
18
DengY.ZhanW.LiangG. (2021). Intracellular Self-Assembly of Peptide Conjugates for Tumor Imaging and Therapy. Adv. Healthc. Mater.10, e2001211. 10.1002/adhm.202001211
19
DevineM. J.KittlerJ. T. (2018). Mitochondria at the Neuronal Presynapse in Health and Disease. Nat. Rev. Neurosci.19, 63–80. 10.1038/nrn.2017.170
20
DieboldL. P.GilH. J.GaoP.MartinezC. A.WeinbergS. E.ChandelN. S. (2019). Mitochondrial Complex III Is Necessary for Endothelial Cell Proliferation during Angiogenesis. Nat. Metab.1, 158–171. 10.1038/s42255-018-0011-x
21
EllerbyH. M.ArapW.EllerbyL. M.KainR.AndrusiakR.RioG. D.et al (1999). Anti-Cancer Activity of Targeted pro-Apoptotic Peptides. Nat. Med.5, 1032–1038. 10.1038/12469
22
FanY.LiuS.YiY.RongH.ZhangJ. (2021). Catalytic Nanomaterials toward Atomic Levels for Biomedical Applications: From Metal Clusters to Single-Atom Catalysts. ACS Nano15, 2005–2037. 10.1021/acsnano.0c06962
23
FrederixP. W. J. M.ScottG. G.Abul-HaijaY. M.KalafatovicD.PappasC. G.JavidN.et al (2015). Exploring the Sequence Space for (Tri-)peptide Self-Assembly to Design and Discover New Hydrogels. Nat. Chem.7, 30–37. 10.1038/nchem.2122
24
FreyT. G.MannellaC. A. (2000). The Internal Structure of Mitochondria. Trends Biochem. Sci.25, 319–324. 10.1016/s0968-0004(00)01609-1
25
FuldaS.GalluzziL.KroemerG. (2010). Targeting Mitochondria for Cancer Therapy. Nat. Rev. Drug Discov.9, 447–464. 10.1038/nrd3137
26
GaoY.TongH.LiJ.LiJ.HuangD.ShiJ.et al (2021). Mitochondria-Targeted Nanomedicine for Enhanced Efficacy of Cancer Therapy. Front. Bioeng. Biotechnol.9, 720508. 10.3389/fbioe.2021.720508
27
GelainF.LuoZ.ZhangS. (2020). Self-Assembling Peptide EAK16 and RADA16 Nanofiber Scaffold Hydrogel. Chem. Rev.120, 13434–13460. 10.1021/acs.chemrev.0c00690
28
GrayM. W.BurgerG.LangB. F. (1999). Mitochondrial Evolution. Science283, 1476–1481. 10.1126/science.283.5407.1476
29
GuoX.YangN.JiW.ZhangH.DongX.ZhouZ.et al (2021). Mito‐Bomb: Targeting Mitochondria for Cancer Therapy. Adv. Mater.33, 2007778. 10.1002/adma.202007778
30
GuyonL.LepeltierE.PassiraniC. (2018). Self-Assembly of Peptide-Based Nanostructures: Synthesis and Biological Activity. Nano Res.11, 2315–2335. 10.1007/s12274-017-1892-9
31
HeH.GuoJ.LinX.XuB. (2020a). Enzyme‐Instructed Assemblies Enable Mitochondria Localization of Histone H2B in Cancer Cells. Angew. Chem. Int. Ed.59, 9330–9334. 10.1002/anie.202000983
32
HeH.LinX.GuoJ.WangJ.XuB. (2020b). Perimitochondrial Enzymatic Self-Assembly for Selective Targeting the Mitochondria of Cancer Cells. ACS Nano14, 6947–6955. 10.1021/acsnano.0c01388
33
HeH.TanW.GuoJ.YiM.ShyA. N.XuB. (2020c). Enzymatic Noncovalent Synthesis. Chem. Rev.120, 9994–10078. 10.1021/acs.chemrev.0c00306
34
HeH.WangJ.WangH.ZhouN.YangD.GreenD. R.et al (2018). Enzymatic Cleavage of Branched Peptides for Targeting Mitochondria. J. Am. Chem. Soc.140, 1215–1218. 10.1021/jacs.7b11582
35
HeP.-P.LiX.-D.FanJ.-Q.FanY.YangP.-P.LiB.-N.et al (2020d). Live Cells Process Exogenous Peptide as Fibronectin Fibrillogenesis In Vivo. CCS Chem.2, 539–554. 10.31635/ccschem.020.201900117
36
HendricksM. P.SatoK.PalmerL. C.StuppS. I. (2017). Supramolecular Assembly of Peptide Amphiphiles. Acc. Chem. Res.50, 2440–2448. 10.1021/acs.accounts.7b00297
37
HongT. H.JeenaM. T.KimO.-H.KimK.-H.ChoiH. J.LeeK. H.et al (2021). Application of Self-Assembly Peptides Targeting the Mitochondria as a Novel Treatment for Sorafenib-Resistant Hepatocellular Carcinoma Cells. Sci. Rep.11, 874. 10.1038/s41598-020-79536-z
38
HortonK. L.StewartK. M.FonsecaS. B.GuoQ.KelleyS. O. (2008). Mitochondria-Penetrating Peptides. Chem. Biol.15, 375–382. 10.1016/j.chembiol.2008.03.015
39
HosoyamaK.LazurkoC.MuñozM.MctiernanC. D.AlarconE. I. (2019). Peptide-Based Functional Biomaterials for Soft-Tissue Repair. Front. Bioeng. Biotechnol.7, 205. 10.3389/fbioe.2019.00205
40
HuK.JiangY.XiongW.LiH.ZhangP. Y.YinF.et al (2018). Tuning Peptide Self-Assembly by an In-Tether Chiral Center. Sci. Adv.4, eaar5907. 10.1126/sciadv.aar5907
41
HuK.XiongW.SunC.WangC.LiJ.YinF.et al (2020). Self-Assembly of Constrained Cyclic Peptides Controlled by Ring Size. CCS Chem.2, 42–51. 10.31635/ccschem.020.201900047
42
JeanS. R.AhmedM.LeiE. K.WisnovskyS. P.KelleyS. O. (2016). Peptide-Mediated Delivery of Chemical Probes and Therapeutics to Mitochondria. Acc. Chem. Res.49, 1893–1902. 10.1021/acs.accounts.6b00277
43
JeenaM. T.KimS.JinS.RyuJ. H. (2020a). Recent Progress in Mitochondria-Targeted Drug and Drug-free Agents for Cancer Therapy. Cancers (Basel)12, 4. 10.3390/cancers12010004
44
JeenaM. T.JeongK.GoE. M.ChoY.LeeS.JinS.et al (2019). Heterochiral Assembly of Amphiphilic Peptides inside the Mitochondria for Supramolecular Cancer Therapeutics. ACS Nano13, 11022–11033. 10.1021/acsnano.9b02522
45
JeenaM. T.LeeS.BaruiA. K.JinS.ChoY.HwangS.-W.et al (2020b). Intra-Mitochondria Self-Assembly to Overcome the Intracellular Enzymatic Degradation of L-Peptides. Chem. Commun.56, 6265–6268. 10.1039/d0cc02029j
46
JeenaM. T.PalanikumarL.GoE. M.KimI.KangM. G.LeeS.et al (2017). Mitochondria Localization Induced Self-Assembly of Peptide Amphiphiles for Cellular Dysfunction. Nat. Commun.8, 26. 10.1038/s41467-017-00047-z
47
JiT.LiY.DengX.RweiA. Y.OffenA.HallS.et al (2021). Delivery of Local Anaesthetics by a Self-Assembled Supramolecular System Mimicking Their Interactions with a Sodium Channel. Nat. Biomed. Eng.5, 1099–1109. 10.1038/s41551-021-00793-y
48
JiangT.LiuC.XuX.HeB.MoR. (2021). Formation Mechanism and Biomedical Applications of Protease-Manipulated Peptide Assemblies. Front. Bioeng. Biotechnol.9, 598050. 10.3389/fbioe.2021.598050
49
JiaoH.JiangD.HuX.DuW.JiL.YangY.et al (2021). Mitocytosis, a Migrasome-Mediated Mitochondrial Quality-Control Process. Cell184, 2896–2910. 10.1016/j.cell.2021.04.027
50
JumperJ.EvansR.PritzelA.GreenT.FigurnovM.RonnebergerO.et al (2021). Highly Accurate Protein Structure Prediction with Alphafold. Nature596, 583–589. 10.1038/s41586-021-03819-2
51
KangH. C. (2018). Mitochondria-Targeting Theranostics. Biomater. Res.22, 34. 10.1186/s40824-018-0145-7
52
KelsoG. F.PorteousC. M.CoulterC. V.HughesG.PorteousW. K.LedgerwoodE. C.et al (2001). Selective Targeting of a Redox-Active Ubiquinone to Mitochondria within Cells. J. Biol. Chem.276, 4588–4596. 10.1074/jbc.m009093200
53
KleeleT.ReyT.WinterJ.ZaganelliS.MahecicD.Perreten LambertH.et al (2021). Distinct Fission Signatures Predict Mitochondrial Degradation or Biogenesis. Nature593, 435–439. 10.1038/s41586-021-03510-6
54
KumarK.MoitraP.BashirM.KondaiahP.BhattacharyaS. (2020). Natural Tripeptide Capped pH-Sensitive Gold Nanoparticles for Efficacious Doxorubicin Delivery Both In Vitro and In Vivo. Nanoscale12, 1067–1074. 10.1039/c9nr08475d
55
KwekG.DoT. C.LuX.LinJ.XingB. (2021). Scratching the Surface of Unventured Possibilities with In Situ Self-Assembly: Protease-Activated Developments for Imaging and Therapy. ACS Appl. Bio Mater.4, 2192–2216. 10.1021/acsabm.0c01340
56
LamK. S.SalmonS. E.HershE. M.HrubyV. J.KazmierskiW. M.KnappR. J. (1991). A New Type of Synthetic Peptide Library for Identifying Ligand-Binding Activity. Nature354, 82–84. 10.1038/354082a0
57
LeeJ.-H.HeoK.Schulz-SchönhagenK.LeeJ. H.DesaiM. S.JinH.-E.et al (2018). Diphenylalanine Peptide Nanotube Energy Harvesters. ACS Nano12, 8138–8144. 10.1021/acsnano.8b03118
58
LevinA.HakalaT. A.SchnaiderL.BernardesG. J. L.GazitE.KnowlesT. P. J. (2020). Biomimetic Peptide Self-Assembly for Functional Materials. Nat. Rev. Chem.4, 615–634. 10.1038/s41570-020-0215-y
59
LiC.IscenA.SaiH.SatoK.SatherN. A.ChinS. M.et al (2020). Supramolecular-Covalent Hybrid Polymers for Light-Activated Mechanical Actuation. Nat. Mater.19, 900–909. 10.1038/s41563-020-0707-7
60
LiF.HanJ.CaoT.LamW.FanB.TangW.et al (2019a). Design of Self-Assembly Dipeptide Hydrogels and Machine Learning via Their Chemical Features. Proc. Natl. Acad. Sci. USA116, 11259–11264. 10.1073/pnas.1903376116
61
LiL. L.QiaoZ. Y.WangL.WangH. (2019b). Programmable Construction of Peptide-Based Materials in Living Subjects: From Modular Design and Morphological Control to Theranostics. Adv. Mater.31, e1804971. 10.1002/adma.201804971
62
LiQ.HuangY. (2020). Mitochondrial Targeted Strategies and Their Application for Cancer and Other Diseases Treatment. J. Pharm. Investig.50, 271–293. 10.1007/s40005-020-00481-0
63
LibermanE. A.TopalyV. P.TsofinaL. M.JasaitisA. A.SkulachevV. P. (1969). Mechanism of Coupling of Oxidative Phosphorylation and the Membrane Potential of Mitochondria. Nature222, 1076–1078. 10.1038/2221076a0
64
LiewS. S.QinX.ZhouJ.LiL.HuangW.YaoS. Q. (2021). Smart Design of Nanomaterials for Mitochondria‐Targeted Nanotherapeutics. Angew. Chem. Int. Ed.60, 2232–2256. 10.1002/anie.201915826
65
LiuD.AngelovaA.LiuJ.GaramusV. M.AngelovB.ZhangX.et al (2019). Self-Assembly of Mitochondria-Specific Peptide Amphiphiles Amplifying Lung Cancer Cell Death through Targeting the VDAC1-Hexokinase-II Complex. J. Mater. Chem. B7, 4706–4716. 10.1039/c9tb00629j
66
LiuF.-H.CongY.QiG.-B.JiL.QiaoZ.-Y.WangH. (2018a). Near-Infrared Laser-Driven In Situ Self-Assembly as a General Strategy for Deep Tumor Therapy. Nano Lett.18, 6577–6584. 10.1021/acs.nanolett.8b03174
67
LiuF.-H.HouC.-Y.ZhangD.ZhaoW.-J.CongY.DuanZ.-Y.et al (2018b). Enzyme-Sensitive Cytotoxic Peptide-Dendrimer Conjugates Enhance Cell Apoptosis and Deep Tumor Penetration. Biomater. Sci.6, 604–613. 10.1039/c7bm01182b
68
LiuN.ZhuL.LiZ.LiuW.SunM.ZhouZ. (2021a). In Situ Self-Assembled Peptide Nanofibers for Cancer Theranostics. Biomater. Sci.9, 5427–5436. 10.1039/d1bm00782c
69
LiuQ.WanK.ShangY.WangZ.-G.ZhangY.DaiL.et al (2021b). Cofactor-Free Oxidase-Mimetic Nanomaterials from Self-Assembled Histidine-Rich Peptides. Nat. Mater.20, 395–402. 10.1038/s41563-020-00856-6
70
Lopez-SilvaT. L.SchneiderJ. P. (2021). From Structure to Application: Progress and Opportunities in Peptide Materials Development. Curr. Opin. Chem. Biol.64, 131–144. 10.1016/j.cbpa.2021.06.006
71
LöwikD. W. P. M.Van HestJ. C. M. (2004). Peptide Based Amphiphiles. Chem. Soc. Rev.33, 234–245. 10.1039/b212638a
72
MalonisR. J.LaiJ. R.VergnolleO. (2020). Peptide-Based Vaccines: Current Progress and Future Challenges. Chem. Rev.120, 3210–3229. 10.1021/acs.chemrev.9b00472
73
MamutiM.ZhengR.AnH.-W.WangH. (2021). In Vivo Self-Assembled Nanomedicine. Nano Today36, 101036. 10.1016/j.nantod.2020.101036
74
ManzariM. T.ShamayY.KiguchiH.RosenN.ScaltritiM.HellerD. A. (2021). Targeted Drug Delivery Strategies for Precision Medicines. Nat. Rev. Mater.6, 351–370. 10.1038/s41578-020-00269-6
75
MerrifieldR. B. (1963). Solid Phase Peptide Synthesis. I. The Synthesis of a Tetrapeptide. J. Am. Chem. Soc.85, 2149–2154. 10.1021/ja00897a025
76
MiP.CabralH.KataokaK. (2020). Ligand-Installed Nanocarriers toward Precision Therapy. Adv. Mater.32, e1902604. 10.1002/adma.201902604
77
MoitraP.KumarK.KondaiahP.BhattacharyaS. (2014). Efficacious Anticancer Drug Delivery Mediated by a pH-Sensitive Self-Assembly of a Conserved Tripeptide Derived from Tyrosine Kinase NGF Receptor. Angew. Chem. Int. Ed.53, 1113–1117. 10.1002/anie.201307247
78
MoitraP.SubramanianY.BhattacharyaS. (2017). Concentration Dependent Self-Assembly of TrK-NGF Receptor Derived Tripeptide: New Insights from Experiment and Computer Simulations. J. Phys. Chem. B121, 815–824. 10.1021/acs.jpcb.6b10511
79
MurphyM. P.HartleyR. C. (2018). Mitochondria as a Therapeutic Target for Common Pathologies. Nat. Rev. Drug Discov.17, 865–886. 10.1038/nrd.2018.174
80
MurphyM. P.SmithR. A. J. (2007). Targeting Antioxidants to Mitochondria by Conjugation to Lipophilic Cations. Annu. Rev. Pharmacol. Toxicol.47, 629–656. 10.1146/annurev.pharmtox.47.120505.105110
81
MuttenthalerM.KingG. F.AdamsD. J.AlewoodP. F. (2021). Trends in Peptide Drug Discovery. Nat. Rev. Drug Discov.20, 309–325. 10.1038/s41573-020-00135-8
82
NeupertW.HerrmannJ. M. (2007). Translocation of Proteins into Mitochondria. Annu. Rev. Biochem.76, 723–749. 10.1146/annurev.biochem.76.052705.163409
83
NguyenT. P.EasleyA. D.KangN.KhanS.LimS.-M.RezenomY. H.et al (2021). Polypeptide Organic Radical Batteries. Nature593, 61–66. 10.1038/s41586-021-03399-1
84
NunnariJ.SuomalainenA. (2012). Mitochondria: In Sickness and in Health. Cell148, 1145–1159. 10.1016/j.cell.2012.02.035
85
QiG. B.GaoY. J.WangL.WangH. (2018). Self-Assembled Peptide-Based Nanomaterials for Biomedical Imaging and Therapy. Adv. Mater.30, e1703444. 10.1002/adma.201703444
86
QiaoZ.-Y.LaiW.-J.LinY.-X.LiD.NanX.-H.WangY.et al (2017a). Polymer-KLAK Peptide Conjugates Induce Cancer Cell Death through Synergistic Effects of Mitochondria Damage and Autophagy Blockage. Bioconjug. Chem.28, 1709–1721. 10.1021/acs.bioconjchem.7b00176
87
QiaoZ.-Y.LinY.-X.LaiW.-J.HouC.-Y.WangY.QiaoS.-L.et al (2016a). A General Strategy for Facile Synthesis and In Situ Screening of Self-Assembled Polymer-Peptide Nanomaterials. Adv. Mater.28, 1859–1867. 10.1002/adma.201504564
88
QiaoZ.-Y.ZhaoW.-J.CongY.ZhangD.HuZ.DuanZ.-Y.et al (2016b). Self-Assembled ROS-Sensitive Polymer-Peptide Therapeutics Incorporating Built-In Reporters for Evaluation of Treatment Efficacy. Biomacromolecules17, 1643–1652. 10.1021/acs.biomac.6b00041
89
QiaoZ.-Y.ZhaoW.-J.GaoY.-J.CongY.ZhaoL.HuZ.et al (2017b). Reconfigurable Peptide Nanotherapeutics at Tumor Microenvironmental pH. ACS Appl. Mater. Inter.9, 30426–30436. 10.1021/acsami.7b09033
90
RechesM.GazitE. (2003). Casting Metal Nanowires within Discrete Self-Assembled Peptide Nanotubes. Science300, 625–627. 10.1126/science.1082387
91
RogerA. J.Muñoz-GómezS. A.KamikawaR. (2017). The Origin and Diversification of Mitochondria. Curr. Biol.27, R1177–R1192. 10.1016/j.cub.2017.09.015
92
RongL.LeiQ.ZhangX. Z. (2020). Recent Advances on Peptide-Based Theranostic Nanomaterials. View1, 20200050. 10.1002/viw.20200050
93
RufoC. M.MorozY. S.MorozO. V.StöhrJ.SmithT. A.HuX.et al (2014). Short Peptides Self-Assemble to Produce Catalytic Amyloids. Nat. Chem.6, 303–309. 10.1038/nchem.1894
94
SahaP. C.BeraT.ChatterjeeT.SamantaJ.SenguptaA.BhattacharyyaM.et al (2021). Supramolecular Dipeptide-Based Near-Infrared Fluorescent Nanotubes for Cellular Mitochondria Targeted Imaging and Early Apoptosis. Bioconjug. Chem.32, 833–841. 10.1021/acs.bioconjchem.1c00106
95
SeoB.YoonS.DoJ. (2018). Mitochondrial Dynamics in Stem Cells and Differentiation. Int. J. Mol. Sci.19, 3893. 10.3390/ijms19123893
96
SiasosG.TsigkouV.KosmopoulosM.TheodosiadisD.SimantirisS.TagkouN. M.et al (2018). Mitochondria and Cardiovascular Diseases-From Pathophysiology to Treatment. Ann. Transl. Med.6, 256. 10.21037/atm.2018.06.21
97
SkulachevV. P. (2007). A Biochemical Approach to the Problem of Aging: "Megaproject" on Membrane-Penetrating Ions. The First Results and Prospects. Biochem. Mosc.72, 1385–1396. 10.1134/s0006297907120139
98
SmithG. P. (1985). Filamentous Fusion Phage: Novel Expression Vectors that Display Cloned Antigens on the Virion Surface. Science228, 1315–1317. 10.1126/science.4001944
99
SmithR. A. J.HartleyR. C.CocheméH. M.MurphyM. P. (2012). Mitochondrial Pharmacology. Trends Pharmacol. Sci.33, 341–352. 10.1016/j.tips.2012.03.010
100
SpinelliJ. B.HaigisM. C. (2018). The Multifaceted Contributions of Mitochondria to Cellular Metabolism. Nat. Cell Biol.20, 745–754. 10.1038/s41556-018-0124-1
101
StandleyS. M.ToftD. J.ChengH.SoukaseneS.ChenJ.RajaS. M.et al (2010). Induction of Cancer Cell Death by Self-Assembling Nanostructures Incorporating a Cytotoxic Peptide. Cancer Res.70, 3020–3026. 10.1158/0008-5472.can-09-3267
102
SunQ.ZhouZ.QiuN.ShenY. (2017). Rational Design of Cancer Nanomedicine: Nanoproperty Integration and Synchronization. Adv. Mater.29, 1606628. 10.1002/adma.201606628
103
TaoK.MakamP.AizenR.GazitE. (2017). Self-Assembling Peptide Semiconductors. Science358, eaam9756. 10.1126/science.aam9756
104
VasanK.WernerM.ChandelN. S. (2020). Mitochondrial Metabolism as a Target for Cancer Therapy. Cell Metab.32, 341–352. 10.1016/j.cmet.2020.06.019
105
WangH.FengZ.WangY.ZhouR.YangZ.XuB. (2016). Integrating Enzymatic Self-Assembly and Mitochondria Targeting for Selectively Killing Cancer Cells without Acquired Drug Resistance. J. Am. Chem. Soc.138, 16046–16055. 10.1021/jacs.6b09783
106
WangH.WuH.YiY.XueK.-F.XuJ.-F.WangH.et al (2021a). Self-Motivated Supramolecular Combination Chemotherapy for Overcoming Drug Resistance Based on Acid-Activated Competition of Host-Guest Interactions. CCS Chem.3, 1413–1425. 10.31635/ccschem.021.202100964
107
WangH.YanY.-Q.YiY.WeiZ.-Y.ChenH.XuJ.-F.et al (2020a). Supramolecular Peptide Therapeutics: Host-Guest Interaction-Assisted Systemic Delivery of Anticancer Peptides. CCS Chem.2, 739–748. 10.31635/ccschem.020.202000283
108
WangM.ZhangQ.JianH.LiuS.LiJ.WangA.et al (2020b). Role of Thermolysin in Catalytic-Controlled Self-Assembly of Fmoc-Dipeptides. CCS Chem.2, 317–328. 10.31635/ccschem.020.201900116
109
WangY.WengJ.WenX.HuY.YeD. (2021b). Recent Advances in Stimuli-Responsive In Situ Self-Assembly of Small Molecule Probes for In Vivo Imaging of Enzymatic Activity. Biomater. Sci.9, 406–421. 10.1039/d0bm00895h
110
WardP. S.ThompsonC. B. (2012). Metabolic Reprogramming: A Cancer Hallmark Even Warburg Did Not Anticipate. Cancer Cell21, 297–308. 10.1016/j.ccr.2012.02.014
111
WasilewskiM.ChojnackaK.ChacinskaA. (2017). Protein Trafficking at the Crossroads to Mitochondria. Biochim. Biophys. Acta (Bba) - Mol. Cell Res.1864, 125–137. 10.1016/j.bbamcr.2016.10.019
112
WeiG.SuZ.ReynoldsN. P.ArosioP.HamleyI. W.GazitE.et al (2017). Self-Assembled Peptide and Protein Amyloids: From Structure to Tailored Function in Nanotechnology. Chem. Soc. Rev.46, 4661–4708. 10.1039/c6cs00542j
113
WeinbergS. E.ChandelN. S. (2015). Targeting Mitochondria Metabolism for Cancer Therapy. Nat. Chem. Biol.11, 9–15. 10.1038/nchembio.1712
114
WuH.WangH.QiF.XiaT.XiaY.XuJ.-F.et al (2021). An Activatable Host-Guest Conjugate as a Nanocarrier for Effective Drug Release through Self-Inclusion. ACS Appl. Mater. Inter.13, 33962–33968. 10.1021/acsami.1c09823
115
YangJ.AnH.-W.WangH. (2020a). Self-Assembled Peptide Drug Delivery Systems. ACS Appl. Bio Mater.4, 24–46. 10.1021/acsabm.0c00707
116
YangL.PeltierR.ZhangM.SongD.HuangH.ChenG.et al (2020b). Desuccinylation-Triggered Peptide Self-Assembly: Live Cell Imaging of SIRT5 Activity and Mitochondrial Activity Modulation. J. Am. Chem. Soc.142, 18150–18159. 10.1021/jacs.0c08463
117
YangP.-P.LiY.-J.CaoY.ZhangL.WangJ.-Q.LaiZ.et al (2021). Rapid Discovery of Self-Assembling Peptides with One-Bead One-Compound Peptide Library. Nat. Commun.12, 4494. 10.1038/s41467-021-24597-5
118
YiY.KimH. J.ZhengM.MiP.NaitoM.KimB. S.et al (2019). Glucose-Linked Sub-50-nm Unimer Polyion Complex-Assembled Gold Nanoparticles for Targeted siRNA Delivery to Glucose Transporter 1-Overexpressing Breast Cancer Stem-Like Cells. J. Control. Release295, 268–277. 10.1016/j.jconrel.2019.01.006
119
ZhangD.QiG.-B.ZhaoY.-X.QiaoS.-L.YangC.WangH. (2015). In Situ Formation of Nanofibers from Purpurin18-Peptide Conjugates and the Assembly Induced Retention Effect in Tumor Sites. Adv. Mater.27, 6125–6130. 10.1002/adma.201502598
120
ZhangS. (2003). Fabrication of Novel Biomaterials through Molecular Self-Assembly. Nat. Biotechnol.21, 1171–1178. 10.1038/nbt874
121
ZhangS. (2020). Self-Assembling Peptides: From a Discovery in a Yeast Protein to Diverse Uses and Beyond. Protein Sci.29, 2281–2303. 10.1002/pro.3951
122
ZhangX.-H.ChengD.-B.JiL.AnH.-W.WangD.YangZ.-X.et al (2020). Photothermal-Promoted Morphology Transformation In Vivo Monitored by Photoacoustic Imaging. Nano Lett.20, 1286–1295. 10.1021/acs.nanolett.9b04752
123
ZhangZ.ChaiY.ZhaoH.YangS.LiuW.YangZ.et al (2021). Crosstalk between PC12 Cells and Endothelial Cells in an Artificial Neurovascular Niche Constructed by a Dual-Functionalized Self-Assembling Peptide Nanofiber Hydrogel. Nano Res. 10.1007/s12274-021-3684-5
124
ZhaoJ.LiZ.ShaoY.HuW.LiL. (2021). Spatially Selective Imaging of Mitochondrial microRNAs via Optically Programmable Strand Displacement Reactions. Angew. Chem. Int. Ed.60, 17937–17941. 10.1002/anie.202105696
125
ZhaoK.ZhaoG.-M.WuD.SoongY.BirkA. V.SchillerP. W.et al (2004). Cell-Permeable Peptide Antioxidants Targeted to Inner Mitochondrial Membrane Inhibit Mitochondrial Swelling, Oxidative Cell Death, and Reperfusion Injury. J. Biol. Chem.279, 34682–34690. 10.1074/jbc.m402999200
126
ZhaoL.LiS.LiuY.XingR.YanX. (2019). Kinetically Controlled Self-Assembly of Phthalocyanine-Peptide Conjugate Nanofibrils Enabling Superlarge Redshifted Absorption. CCS Chem.1, 173–180. 10.31635/ccschem.019.20180017
127
ZhengY.MaoK.ChenS.ZhuH. (2021). Chirality Effects in Peptide Assembly Structures. Front. Bioeng. Biotechnol.9, 703004. 10.3389/fbioe.2021.703004
128
ZhouJ.XuB. (2015). Enzyme-Instructed Self-Assembly: A Multistep Process for Potential Cancer Therapy. Bioconjug. Chem.26, 987–999. 10.1021/acs.bioconjchem.5b00196
129
ZinovkinR. A.ZamyatninA. A. (2019). Mitochondria-Targeted Drugs. Curr. Mol. Pharmacol.12, 202–214. 10.2174/1874467212666181127151059
Summary
Keywords
mitochondrion, self-assembly, peptide, enzyme, nanomaterials, cancer therapy
Citation
Luo Z, Gao Y, Duan Z, Yi Y and Wang H (2021) Mitochondria-Targeted Self-Assembly of Peptide-Based Nanomaterials. Front. Bioeng. Biotechnol. 9:782234. doi: 10.3389/fbioe.2021.782234
Received
24 September 2021
Accepted
01 November 2021
Published
26 November 2021
Volume
9 - 2021
Edited by
Bing Xia, Nanjing Forestry University, China
Reviewed by
Parikshit Moitra, University of Maryland, Baltimore, United States
Xuemei Ge, Nanjing Forestry University, China
Updates

Check for updates
Copyright
© 2021 Luo, Gao, Duan, Yi and Wang.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Zhongyu Duan, zyduan@hebut.edu.cn; Yu Yi, yiyu@nanoctr.cn; Hao Wang, wanghao@nanoctr.cn
† These authors have contributed equally to this work
This article was submitted to Nanobiotechnology, a section of the journal Frontiers in Bioengineering and Biotechnology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.