Abstract
Biocatalytic cascades play a fundamental role in sustainable chemical synthesis. Fusion enzymes are one of the powerful toolboxes to enable the tailored combination of multiple enzymes for efficient cooperative cascades. Especially, this approach offers a substantial potential for the practical application of cofactor-dependent oxidoreductases by forming cofactor self-sufficient cascades. Adequate cofactor recycling while keeping the oxidized/reduced cofactor in a confined microenvironment benefits from the fusion fashion and makes the use of oxidoreductases in harsh non-aqueous media practical. In this mini-review, we have summarized the application of various fusion enzymes in aqueous and non-aqueous media with a focus on the discussion of linker design within oxidoreductases. The design and properties of the reported linkers have been reviewed in detail. Besides, the substrate loadings in these studies have been listed to showcase one of the key limitations (low solubility of hydrophobic substrates) of aqueous biocatalysis when it comes to efficiency and economic feasibility. Therefore, a straightforward strategy of applying non-aqueous media has been briefly discussed while the potential of using the fusion oxidoreductase of interest in organic media was highlighted.
1 Introduction
Biocatalytic cascades have been widely explored to mimic natural biosynthetic routes to produce high value-added chemicals (; ; ; ; ; ). In this context, the spatial organization of multi-enzymes plays a pivotal role in surmounting barriers between different enzyme classes, averting the mutual inhibition, limiting the long-range diffusion of intermediates, and enhancing the reaction efficiency (). Up to now, a variety of enzyme co-localization strategies have been developed including 1) enzyme fusion (; ), 2) co-immobilization (attachment on a carrier or encapsulation in a matrix) (; ), and 3) scaffolding (; ). In particular, the direct fusion of enzymes has emerged as a fascinating toolbox in its own right (; ; ). It brings multiple enzymes in close proximity to form a single multifunctional catalyst through genetic fusion () or covalent bonds between proteins formed post-transcriptionally (). By enzyme fusion, the sequential channeling of substrates between enzyme active sites can be easily achieved with a high degree of controllability (; ). Consequently, the delicately tethered enzymes gain many benefits, such as improved stability and catalytic efficiency, as well as enhanced expression and ease of production as a single construct.
Fusion approaches have been well-illustrated with many types of cofactor-dependent enzymes including the combination of cytochrome P450 with their redox partners (; ; ; ; ; ), and Baeyer-Villiger monooxygenases (BVMOs) with alcohol dehydrogenases and transaminases (; ; ) (Scheme 1). These studies have largely demonstrated the practicability and effectiveness of the fusion approach. However, there are still some limitations to overcome in order to make it practicable. The trial-and-error in the design of linkers and time-consuming molecular experiments can lead to a huge workload. Furthermore, most of these proofs of concept were explored at low substrate loadings usually in μM ranges, which lags far behind practical applications at a technical scale.
SCHEME 1
Some enzymes are of high interest for their use in cascades for the biocatalytic production of valuable chemicals. In particular, cyclohexanone monooxygenase (CHMO) has been extensively investigated for the synthesis of ɛ-caprolactone, an important precursor for polymer synthesis (; ; ). Generally, most cascades have been developed by coupling various alcohol dehydrogenases (ADHs) (; ; ; ; ; ) as well as newly reported thioredoxin/thioredoxin reductases pairs () with CHMO to form redox-neutral self-sufficient systems. Despite these advances, in most one-pot systems, substrate concentrations have been used up to 100 mM given the strong substrate and product inhibition. By harnessing the fusion approach not only the inhibition caused by substrates and intermediates could be relieved but also the transport distance of cofactors between active sites can be shortened to avoid the degradation of nicotinamide cofactors in non-aqueous media (). This has inspired the design and generation of various fusions of CHMO with its cofactor regenerating enzymes as effective catalysts for cascades, demonstrating the practicality of fusions for this type of enzyme ().
Enzymes have naturally evolved to function optimally in aqueous media. Accordingly, most enzyme-catalyzed transformations take place in buffer systems to maintain enzymatic stability and activity. However, for industrial applications that mostly use hydrophobic non-natural substrates, this can be a key obstacle (). In most studies, the concentrations of poorly water-soluble reagents are often adjusted to the millimolar range. The ‘diluted’ biocatalysis with low substrate loadings is both poorly economical and unsustainable (). Using non-aqueous media with the presence of co-solvents can effectively enable high substrate loadings required by the industrial scale-up and commercialization (; ). Biocatalysis in non-aqueous media has seen a big rise since the pioneering work of on enzyme catalysis in organic solvents (), which mainly focused on lipases with distinctive stability (). However, applying redox biocatalysis in non-aqueous media confronts several major concerns, e.g., enzyme stability and cofactor recycling (; ; ). A recent study proved the feasibility of using a fused type II flavin-containing monooxygenase (FMO-E) and horse liver alcohol dehydrogenase (HLADH) in organic media (). Benefits can be promisingly envisioned by applying these fusions for cascades with high substrate loadings in non-aqueous media (). Inspiringly, many enzymes of interest especially the above-mentioned CHMO can be optimized by a similar way for the cascades toward an industrial application.
Here we present recent advances in the design and application of fusion enzymes, which cover not only the traditional aqueous systems but also non-aqueous media (e.g., organic solvents, and deep eutectic solvents). In detail, the development and application of various fusion enzymes in an aqueous environment (Section 1) and some recent examples especially about oxidoreductases in non-aqueous media (Section 2) have been outlined. Meanwhile, the linker design regarding classification, flexibility and rigidity, length, and orientation is discussed in both sections. In particular, the potential of using fusion enzymes for redox cascades with high substrate loadings in pursuit of satisfactory space-time-yields is highlighted.
2 Fusion enzymes in aqueous media
Most fused enzymes are constructed by genetic fusion, which requires a linker peptide to connect target proteins. A linker peptide is a segment of the polypeptide, consisting of several or hundreds of amino acids in length (). The presence of linkers allows for the separation of two enzymes and thus avoids mutual interference during the folding and catalytic processes. There are at least two factors to consider when designing an enzyme fusion: 1) which type of linker to use and 2) in which order proteins should be placed. In the first aspect, the composition and length of a linker are two determining factors of its physicochemical properties regarding flexibility vs. rigidity and hydrophilicity vs. hydrophobicity. This can highly affect the spatial distribution of fused subunits. According to the characteristics of linkers, they are generally classified into two types: 1) flexible linker peptides and 2) linker peptides that can form α-helices (). As a simple summary, Table 1 lists the enzyme pairs in fused or non-fused forms and the used linkers of mainly oxidoreductases described in this mini-review. All examples are explained in more detail in the entries.
TABLE 1
| Entry | Enzyme pairs | Fusion name | Linker | Application of enzyme pairs | Substrate concentration (mM) | Reaction media | Organic solvent (vol%) | References |
|---|---|---|---|---|---|---|---|---|
| 1 | ADH, BVMO | CHMO-ADHA | L1: (13) SSGGSGGSGGSAG | cascade reaction, cyclic alcohol to lactone | 0.25, 10 | water | 0 | |
| CHMO-ADHM | ||||||||
| ADH-CHMO | ||||||||
| 2 | ADH, BVMO | FDH-CHMO | L1: (6) SGSAAG L2: (6) SRSAAG | NADPH-recycling system | 5 | water, MTBE, DES (choline chloride and glycerol) | 0, 10, 40, 20 | |
| GDH-CHMO | ||||||||
| PTDH-CHMO | ||||||||
| FDH-ADH | ||||||||
| GDH-ADH | ||||||||
| PTDH-ADH | ||||||||
| 3 | ADH, BVMO | ADH-Gly-BVMO | L1: (12) SGGSGGSGGSAG L2: (30) SASNCLIGLFLNDQELKKKAKVYDKIAKDV L3: none | cascade reaction, alcohol to ester | 0.2 | water | 0 | |
| ADH-FOM-BVMO | ||||||||
| ADH-BVMO | ||||||||
| 4 | Ene reductase, BVMO | XenB-CHMO | L1: (13) SSGGSGGSGGSAG L2: (12) SSATGSATGSAG L3: (1) W | cascade reaction, unsaturated cyclic alcohols to chiral lactones | 3 | water | 0 | |
| 5 | PTDH, P450 | BF2 | L1: (6) SGGGGS L2: (6) EPPPPK L3: (24) (SGGGGS) × 4 | NADPH-recycling system | 0.2 | water | 0 | |
| F2B | ||||||||
| F2B-P1 | ||||||||
| F2B-G1 | ||||||||
| F2B-G4 | ||||||||
| 6 | PTDH, P450 | pCRE2-P450-BM3 | L1: (6) SRSAAG | NADPH-recycling system | 0.1 | water | 0 | |
| 7 | Styrene monooxygenase (StyA), Flavin reductase (StyB) | Fus-SMO | L1: (30) ASGGGGSGGGGSGGGGSGGGGSGGGGSGAS L2: (20) (GGGGS) × 4 | electron transfer for epoxidation of styrene | 0.5 | water | 0 | |
| 8 | P450, Alcohol oxidase | OleTJE-AldO | L1: (18) GSGLEVLFQGPGSGGGGS L2: (45) A (EAAAK) × 4-LEA-(EAAAK) × 4A | hydrogen peroxide supply for decarboxylation reaction | 0.5–10 | water | 0 | |
| 9 | Formate dehydrogenase | FDH-AzoRo | L1: (30) His Tag × 10 | NAD+ regeneration | 0.025 | water | 0 | |
| 10 | ADH, aminotransferase | ADH-AT | L1: PAS linker: (20) ASPAAPAPASPAAPAPSAPA L2: (40) PAS × 2 L3: (60) PAS × 3 | cascade reaction, alcohol to amine, stabilization through linker | 300 | water | 0 | |
| 11 | Formate dehydrogenase, Leucine dehydrogenase | FDH-LeuDH | L1: none L2: (5) EAAAK L3: (10) (EAAAK) × 2 L4: (15) (EAAAK) × 3 L5: (5) GGGGS L6: (10) (GGGGS) × 2 L7: (15) (GGGGS) × 3 | L-tert leucine biotransformation | 4.5 | water | 0 | |
| 12 | P450 BM3 | BM3-ADH | L1: none L2: (10) (GGGGS) × 2 L3: (9) A × 9 L4: (10) (EAAAK) × 2 | NADPH-recycling system | 0.2, 0.5, 10 | water | 0 | |
| ADH-BM3 | ||||||||
| 13 | Flavin-dependent halogenase, flavin reductase | FH-FR | L1: (10) PSPSTDQSPS L2: (16) VLHRHQPVTIGEPAAR L3: (22) VLHRHQPVSPIHSRTIGEPAAR | electron transfer for halogenation | 0.5 | water | 0 | |
| 14 | CHMO, ADH, CAL-A | No fused | — | — | 20, 100 | water | 0 | |
| 15 | CHMO | No fused | — | — | 3.4–11 | water | 0 | |
| 16 | CHMO, ADH, CAL-B | No fused | — | — | 1–25 | water | 0 | |
| 17 | P450, ADH | No fused | — | — | 2, 20 | water | 0 | |
| 18 | PTDH, BVMO | PockeMO-PTDH | L1: (6) SRSAAG | NADPH-recycling system | 0.2–0.8 | water, dioxane | 10 | |
| CPDMO-PTDH | ||||||||
| CHMO-PTDH | ||||||||
| 19 | CHMO, ADH, CAL-B | No fused | — | — | 20 | water | 0 | |
| 20 | CHMO, ADH, CAL-B | No fused | — | — | 40–100 | water | 0 | |
| 21 | CHMO, ADH | No fused | — | — | 0, 100 | water | 0 | |
| 22 | CHMO, GDH | No fused | — | — | 10, 140 | water, methanol | 10 | |
| 23 | CHMO, GDH | No fused | — | — | 30, 240 | water, methanol | 1.25, 10 | |
| 24 | FMO, ADH | FMO-ADH | L1: (6) SGSAAG | NADPH-recycling system | 10–20 | microaqueous | 95 | |
| 25 | PSMO, FDH | No fused | — | — | 10 | water, methanol | 10 | Zhu et al. (2022) |
| 26 | CHMO, FDH | No fused | — | — | 5 | water, methanol | 10 | Zhu et al. (2022) |
List of fused and non-fused oxidoreductases, and their biocatalytic applications with varying substrate concentrations in various aqueous and non-aqueous media.
CHMO, Cyclohexanone monooxygenase; ADH, Alcohol dehydrogenase; PTDH, Phosphite dehydrogenase; FDH, Formate dehydrogenase; GDH, Glucose dehydrogenase; PockeMO, Polycyclic ketone monooxygenase; CPDMO, Pseudomonad cyclopentadecanone monooxygenase; MTBE, Methyl tert-butyl ether; DES, Deep eutectic solvent.
The composition is a determinant factor for the flexibility or rigidity of linkers. Flexible linkers are glycine-rich and can produce a disordered loop, which usually could improve protein solubility and provide flexibility for catalysis domain separation (). The flexible linker peptide does not interfere with the folding domain of the protein, thus theoretically allowing for natural folding and other conformational movements (). This type of linker has been widely used in biocatalysis with relative success, such as cytochrome P450 fusions (; ; ; ), flavin reductase (FR) fusions (; ), formate dehydrogenase (FDH) fusions (), and Baeyer-Villiger Monooxygenases (BVMOs) fusions (entries 1–13, Table 1). In detail, Fraaije and coworkers reported a fusion of an ADH from Thermoanaerobacter brockii (TbADH) and a CHMO from Thermocrispum municipal (TmCHMO) with a glycine-rich linker, which was used in a linear cascade fashion to synthesize ε-caprolactone (entry 1, Table 1) (). They found the fused TmCHMO exhibited around two-fold higher oxygenation activity compared to the individual protein. The obtained fusion achieved 99% conversion using 200 mM substrate (substrate-feeding applied) and gave a turnover number (TON) of >13,000 (). Glycine-rich peptide linkers are structurally flexible and thus hardly restrict the natural movement of enzymes, which to a high extent leads to a more favourable performance of fusion enzymes compared to that with rigid linkers. There is another example of such enzyme that TmCHMO was fused with three different cofactor regeneration enzymes using short flexible linkers. Therein all fusion enzymes resulted in good soluble expression and excellent conversions (entry 2, Table 1) (). Not only for isolated enzyme fusions, but also the biotransformation activity of recombinant cells containing overexpressed fusion enzymes was markedly influenced by the type of fusion linkers. Therein, it turned out that flexible linkers allowed for higher conversions than rigid α-helix linkers (entry 3, Table 1) (). In general, other studies have shown some similar effects by using flexible linkers, reaching higher conversions (; ), improving catalytic activities (; ; ), and yielding higher productions () (entries 4–7, Table 1). Therefore, flexible glycine-rich linkers are safe options to try when it comes to the preliminary linker design.
The inclusion of helix-associated amino acids such as alanine and lysine enables the introduction of stiff tethers in glycine-rich linkers, providing the advantage of being resistant to proteolysis and the well-controlled domain separation (). In some research, it has been studied that fusions with rigid peptide linkers exhibited better activities than that with flexible linkers due to the effective separation of protein moieties (; ). For example, the α-helix-based rigid linker between alditol oxidase (AldO) and cytochrome P450 OleTJE (CYP152L1) highly contributed to the improved decarboxylation of myristic acid in the presence of peroxide (H2O2) when compared to equal amounts of isolated OleTJE and AldO (entry 8, Table 1). The authors also mentioned the enhanced activity may be attributed to the more efficient channeling of H2O2 between enzyme active sites within the proximity of these domains ().
Despite the potential of rigid linkers, flexible linkers have received more attention than the research done so far on rigid linkers. Overall, various studies have described glycine-rich linkers are beneficial by enhancing flexibility between the two partners, which could provide degrees of freedom for proper folding and conformational changes (). When most studies have focused on the use of flexible or rigid linkers, there is an interesting study that reported a fusion of FDH from Candida boidinii and azoreductase from Rhodococcus opacus 1CP (AzoRo) with His 10-tag as the linker (). Due to its high affinity for nickel-containing resins, histidine (His) is often designed as a tag for affinity purification of recombinant proteins. Since most recombinant proteins usually have His-tags at the N or C-terminal, His-tags are used to combine the two proteins with the expectation that it can have multiple biological functions of proteins purification and fusion linkers at the same time. The result showed using His-tag as a linker is achievable, but it might affect the solubility of the fusion protein (entry 9, Table 1). Evidently, each of these linkers has its own pros and cons, and the application will depend on the specific reaction to be achieved.
Besides the composition of linkers, the length of linkers has recently been found to have a pronounced effect on the properties of fusion enzymes. In one case, the effect of the length of a glycine-rich linker with 15 amino acids as the basic linker on the biocatalytic properties of TbADH-TmCHMO fusion was investigated by evaluating 14 lengths (). All variants exhibited a high expression level but varying activities. The fusions with linker lengths of 10, 12, and 15 amino acids, showed a slight increase in kobs for both activities while the fusions with 2, 3, 6, 7, 13, and 14 amino acid linkers resulted in the highest TONs (). Despite that, no clear correlation between linker length and the catalytic performance of fusions was established within limited studies. Nevertheless, the length of linkers can be adjusted to make space for proper folding of both enzymes, which consequently affects the expression and activity of fusions. For example, three linkers consisting of repeated PAS sequences (20, 40, and 60 amino acids) (entry 10, Table 1) were used in the fusion of an ADH with an aminotransferase (AT) to synthesize amines from alcohols. Therein, they found specific effects for each linker, from short to long: PAS20 achieved two-fold higher conversion compared to the individual enzymes; PAS40 showed the highest activity while PAS60 resulted in the highest soluble expression (). Likewise, in another study using NHase as a subunit, proper longer linkers resulted in higher stability while overlong linkers had a negative effect on the activity and expression of NHase. (). Based on current studies, there is still no clear consensus on whether longer or shorter linkers are better. Therefore, it is necessary to design and evaluate different lengths of linkers in a certain case, which, obviously, can be time-consuming. For this reason, a recent study reported a three-step process in straightforward PCR that utilized reiterative primer design, PCR-mediated linker library generation, and restriction enzyme-free cloning methods to generate linker libraries. The authors stated it to be applicable for most fusion constructs ().
In addition to the composition and length of linkers, the order of fused moieties is also critical for the catalytic performance of fusions. An in-depth study of loops and linkers illustrated that linkers are not just ‘connectors’ but have a significant impact on the microenvironment and orientation of fusions (). The order of protein sequences (N and C-terminal orientation) can influence the correct folding, oligomerization state, stability, and activity of the fusion constructs (). Given that, the gene order for a fusion enzyme was exemplarily optimized by using simulations (; ). predicted the orientation of the cofactor binding domain of leucine dehydrogenase (LeuDH) and formate dehydrogenase (FDH) by structural modelling approach with an online server to ensure the favorable orientation of active sites in the fusion enzyme complex (entry 11, Table 1). This simulation revealed that fusing the C-terminus of FDH with the N-terminus of LeuDH formed a favorable face-to-face active cleft orientation. This would promote the formation of intramolecular tunnelling and accelerate the cofactor channel between FDH and LeuDH. However, such a result could not be obtained in the other direction (). In the case of BVMOs, changing the order of the same linker led to a significant increase in ADH activity: TbADH-TmCHMO showed higher kcat than TmCHMO-TbADH (). While in another study of P450, there is no difference (entry 12, Table 1) (). In general, the orientation between the two enzymes can have a significant impact on the efficiency of the reaction. Although, with the assistance of computational simulations or using linker databases, the orientation between enzymes can be designed in a more rational way. However, in practice, this is still difficult to control ().
In addition to genetic fusion, post-transcriptional interactions between tags have become popular to bring multiple enzymes in close proximity to form a single multifunctional catalyst (). SpyTag/SpyCatcher is one such protein coupling approach and it is by far the most used tag. reported that locking the termini (often the most flexible part of a protein) together through SpyTag/SpyCatcher altered the enzyme robustness. The thermal and proteolytic stability of β-lactamase has been improved significantly. Another proven way to enhance stability and performance was to encapsulate enzymes with SpyTag/SpyCatcher in protein cages (). For example, Pamela and coworkers encapsulated two enzymes via SpyTag/SpyCatcher for the biosynthesis of indigo, enhancing intracellular indigo production and increasing the stability by 90% (). SpyTag/SpyCatcher was shown to facilitate substrate recruitment, thus improving enzyme performance (). Moreover, Spy technology has increased resilience, promoted substrate channeling, and assembled hydrogels for continuous flow biocatalysis (). Based on these studies, we can see that using a combination of these tags could contribute to a better enzymic performance, especially improving the stability of enzymes. It will be exciting to see how the Spy toolbox develops in the field of biocatalysis in the future.
3 Oxidoreductases in organic media and perspectives
As aforementioned, the use of fusion proteins is mostly documented for aqueous media. However, the use of water as a “green” solvent has been intensely debated within the biocatalysis field, which made it clear that the impact of contaminated water surely needs to be quantified when assessing the greenness of an enzymatic process (). For this reason, water has been included in the recently modified E-factor to emphasize a fair comparison between the use of water and other solvents (). When using water as reaction media for chemical synthesis, not only wastewater but also several other limitations should be considered, such as 1) lower substrate solubility, 2) laborious downstream processing, 3) unwanted water-related side reactions, 4) enzyme inhibition, and 5) microbial contamination. Given these problems especially the limited substrate loadings, there is a high interest in the use of non-aqueous media for enzymatic catalysis (; ; ). In this context, organic solvents are often widely used in most synthetic processes, especially in the pharmaceutical industry (; ) and can be seen as a possible improvement for different biocatalytic systems.
Research on biocatalysis in organic media has focused on hydrolases (EC 3) mainly lipases some of which have been applied at technical scales. Although oxidoreductases-mediated selective oxidation is considered one of the most important transformations in organic chemistry, studies on oxidoreductases (EC 1) are still limited (; ; ). Between 2000 and 2015, 68% of the patents covering biocatalytic applications were based on oxidoreductases, despite the fact that they account for “only” one-third approximately of all the known enzymes (). The limited use of oxidoreductase at technical scales in organic media is not only due to the instability of redox enzymes per se but also the fact that up to 50% approximately of known oxidoreductases are cofactor-dependent [NAD(P)H]. Given the expensive and unstable nature of NAD(P)H, their regeneration and re-utilization are often necessary for the economic feasibility on an industrial scale (; ). In this case, enzyme-coupled cofactor regeneration approaches have emerged as powerful tools to meet this demand. In particular, dehydrogenase-promoted in situ cofactor regeneration in whole cells (so-called “designer cells”) () and in vitro multi-enzymatic cascades have been widely reported in aqueous media. In the case of cascade reactions, the distance between enzymes’ active sites has a significant effect. Fusing enzymes or co-immobilizing enzymes are some of the different approaches that can be used to shorten the transport distance of reaction intermediates between active sites while increasing the enzyme stability, jointly contributing to the improved efficiency of cofactor regeneration (; Zhu et al., 2022).
Baeyer-Villiger monooxygenases (BVMOs) can oxidize ketones to furnish value-added esters and lactones, which rely on both NADPH and molecular oxygen (; ). One preparative application of BVMO overexpressed in whole cells has been demonstrated in an in situ substrate feeding and product removal process by using adsorbent resin within a bubble column reactor (; ; ). This set-up has been scaled up to the kilogram level in a 50 L reactor. Therein, it is concluded that overcoming the oxygen limitation could afford higher productivity. Given the use of organic solvents offers magnitudes higher oxygen solubility than water (), applying BVMOs in organic media to achieve oxygen limitation removal is appealing. Furthermore, reported that the oxygen solubility increases with larger alkyl chains of alcohol solvents while with decreased alkyl chains of alkane solvents, which provided a basic guideline for solvent selection.
Various multi-enzymatic cascades have been designed and established involving oxidoreductases mostly in water and water-organic mixtures to produce bulk and fine chemicals especially active pharmaceutical ingredients (APIs). Some of representative studies have been summarized in Table 1 which has a focus on cyclohexanone monooxygenases and widely used cofactor regeneration enzymes ADHs. These studies demonstrated the screening, the characterization including mutation and fusion (entries 1, 18, 2, and 24, Table 1) for more stable enzymes, and the application of these enzymes in different reaction conditions and set-ups. In addition, the optimization of an oxidative process by using air or pure oxygen was illustrated. All these studies were performed with a broad range of substrate concentrations and various enzymes for the cofactor regeneration (14–17, 19–22, 25, and 26, Table 1). A successful scale-up of a sequential cascade reaction has been reported by adding the two enzymes separately, optimizing the dosing factor, and increasing the reaction volume up to 100 L in a 200 L-reactor (entry 23, Table 1) (). Despite these advances, there is still room for further improvement especially concerning the cofactor recycling, substrate loadings, oxygen supply, and enzyme stability. This is where enzyme fusions in organic media can fit in and provide counterpart solutions.
To the best of our knowledge, there has been only one study on the use of fused oxygenating enzymes in low-water media (micro-aqueous media) so far. reported the use of fused type II flavin-containing monooxygenase (FMO-E) and horse liver alcohol dehydrogenase (HLADH) by using a flexible linker in micro-aqueous media (5 vol% aqueous buffer in organic solvent) for the synthesis of γ-butyrolactone. It was reported that the enzymes’ tolerance toward organic solvents could be transmitted when enzymes are fused. Depending on the art of combination, different stabilities can be obtained. For instance, reported that BsFDH-TmCHMO fusion achieved around 10% conversion in 1 vol% 1,4-dioxane, while fusing PsPTDH with TmCHMO by using two different short-flexible linkers led to full conversion. These examples demonstrate the great potential of applying fusion enzymes in organic media. However, it is undoubtable that the rational design of fusion enzymes with suitable linkers and the application of fused enzymes for biocatalytic cascades in non-aqueous media still remains complex and challenging. Moreover, further research is urgently needed to bridge the gap between laboratory-level study and the application under industrially relevant conditions.
4 Conclusion and outlook
Overall, the development of fusion enzymes has highly facilitated the design and application of enzymatic cascades to produce valuable compounds in a more efficient manner. Many gains have been firmly demonstrated. The fusion approach enables the combination of target functional domains to easily modularize these multifunctional catalysts for custom applications. For cofactor-dependent enzymes, especially oxidoreductases, fusions have been used to provide efficient cofactor regeneration by shortening diffusion pathways and stabilizing unstable cofactors both in whole cells and in vitro using enzyme systems. Not only the improved catalytic performance but also the enhanced co-expression is achievable by optimizing fusion linkers. Given complicated structure-function correlations, rational and efficient design of linkers has so far remained a challenge. However, it is becoming easier with the help of in-silico modeling and the establishment of linker database libraries. Along this path, more and more studies have emerged, some of which have been outlined here to provide a general overview. In particular, fusions of oxidoreductase have been highlighted due to high interest in them as well as their infinite potential for chemical synthesis. Benefiting from the fusion mode, the applications of cofactor-dependent oxidoreductases not only in aqueous media but also in non-aqueous media can be realized, expanding the biocatalytic toolbox for sustainable industrial chemistry.
Statements
Author contributions
Conception of the work: SK, NZ, YM, and GV; Drafting the article: YM, NZ, and GV. Critical revision of the article: all authors.
Funding
SK thanks to Aarhus University Research Foundation (AUFF). YM thanks the China Scholarship Council (CSC) for the financial support (No. 202108610066).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
References
1
AalbersF. S.FraaijeM. W. (2017). Coupled reactions by coupled enzymes: Alcohol to lactone cascade with alcohol dehydrogenase-cyclohexanone monooxygenase fusions. Appl. Microbiol. Biotechnol.101 (20), 7557–7565. 10.1007/s00253-017-8501-4
2
AalbersF. S.FraaijeM. W. (2019). Enzyme fusions in biocatalysis: Coupling reactions by pairing enzymes. ChemBioChem20 (1), 20–28. 10.1002/cbic.201800394
3
AndorferM. C.BelsareK. D.GirlichA. M.LewisJ. C. (2017). Aromatic halogenation by using bifunctional flavin reductase-halogenase fusion enzymes. ChemBioChem18 (21), 2099–2103. 10.1002/cbic.201700391
4
AraiR. (2021). Design of helical linkers for fusion proteins and protein-based nanostructures. Methods Enzymol.647, 209–230. 10.1016/bs.mie.2020.10.003
5
AraiR.UedaH.KitayamaA.KamiyaN.NagamuneT. (2001). Design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Eng. Des. Sel.14 (8), 529–532. 10.1093/protein/14.8.529
6
BakkesP. J.RiehmJ. L.SagadinT.RühlmannA.SchubertP.BiemannS.et al (2017). Engineering of versatile redox partner fusions that support monooxygenase activity of functionally diverse cytochrome P450s. Sci. Rep.7 (1), 9570. 10.1038/s41598-017-10075-w
7
BelsareK. D.RuffA. J.MartinezR.SchwanebergU. (2020). Insights on intermolecular fmn-heme domain interaction and the role of linker length in cytochrome P450cin fusion proteins. Biol. Chem.401 (11), 1249–1255. 10.1515/hsz-2020-0134
8
Benítez-MateosA. I.Roura PadrosaD.ParadisiF. (2022). Multistep enzyme cascades as a route towards green and sustainable pharmaceutical syntheses. Nat. Chem.14 (5), 489–499. 10.1038/s41557-022-00931-2
9
BeyerN.KuligJ. K.BartschA.HayesM. A.JanssenD. B.FraaijeM. W.et al (2017). P450bm3 fused to phosphite dehydrogenase allows phosphite-driven selective oxidations. Appl. Microbiol. Biotechnol.101 (6), 2319–2331. 10.1007/s00253-016-7993-7
10
BeyerN.KuligJ. K.FraaijeM. W.HayesM. A.JanssenD. B. (2018). Exploring PTDH-P450BM3 variants for the synthesis of drug metabolites. ChemBioChem19 (4), 326–337. 10.1002/cbic.201700470
11
BollingerA.MolitorR.ThiesS.KochR.CoscolínC.FerrerM.et al (2020). Organic-solvent-tolerant carboxylic ester hydrolases for organic synthesis. Appl. Environ. Microbiol.86 (9), e00106–20. 10.1128/AEM.00106-20
12
BornadelA.Hatti-KaulR.HollmannF.KaraS. (2015). A Bi-enzymatic convergent cascade for ε-caprolactone synthesis employing 1,6-hexanediol as a 'double-smart cosubstrate'. ChemCatChem7 (16), 2442–2445. 10.1002/cctc.201500511
13
CaronS.DuggerR. W.RuggeriS. G.RaganJ. A.RipinD. H. (2006). Large-scale oxidations in the pharmaceutical industry. Chem. Rev.106 (7), 2943–2989. 10.1021/cr040679f
14
ChenX.ZaroJ.ShenW.-C. (2013). Fusion protein linkers: Property, design and functionality. Adv. Drug Deliv. Rev.65 (10), 1357–1369. 10.1016/j.addr.2012.09.039
15
CorradoM. L.KnausT.MuttiF. G. (2018). A chimeric styrene monooxygenase with increased efficiency in asymmetric biocatalytic epoxidation. ChemBioChem19 (7), 679–686. 10.1002/cbic.201700653
16
de GonzaloG.AlcántaraA. R. (2021). Multienzymatic processes involving baeyer-villiger monooxygenases. Catalysts11 (5), 605. 10.3390/catal11050605
17
DelgoveM. A. F.ValenciaD.SoléJ.BernaertsK. V.De WildemanS. M. A.GuillénM.et al (2019). High performing immobilized Baeyer-Villiger monooxygenase and glucose dehydrogenase for the synthesis of ε-caprolactone derivative. Appl. Catal. A General572, 134–141. 10.1016/j.apcata.2018.12.036
18
Domínguez de MaríaP.HollmannF. (2015). On the (Un)Greenness of biocatalysis: Some challenging figures and some promising options. Front. Microbiol.6, 1257. 10.3389/fmicb.2015.01257
19
DongJ.Fernández-FueyoE.HollmannF.PaulC. E.PesicM.SchmidtS.et al (2018). Biokatalytische oxidationsreaktionen - aus der sicht eines chemikers. Angew. Chem.130 (30), 9380–9404. 10.1002/ange.201800343
20
DrenthJ.YangG.PaulC. E.FraaijeM. W. (2021). A tailor-made deazaflavin-mediated recycling system for artificial nicotinamide cofactor biomimetics. ACS Catal.11 (18), 11561–11569. 10.1021/acscatal.1c03033
21
ElleucheS. (2015). Bringing functions together with fusion enzymes-from nature's inventions to biotechnological applications. Appl. Microbiol. Biotechnol.99 (4), 1545–1556. 10.1007/s00253-014-6315-1
22
EllisG. A.KleinW. P.Lasarte-AragonésG.ThakurM.WalperS. A.MedintzI. L.et al (2019). Artificial multienzyme scaffolds: Pursuing in vitro substrate channeling with an overview of current progress. ACS Catal.9 (12), 10812–10869. 10.1021/acscatal.9b02413
23
EngelJ.CordellierA.HuangL.KaraS. (2019a). Enzymatic ring-opening polymerization of lactones: Traditional approaches and alternative strategies. ChemCatChem11 (20), 4983–4997. 10.1002/cctc.201900976
24
EngelJ.MthethwaK. S.OppermanD. J.KaraS. (2019b). Characterization of new baeyer-villiger monooxygenases for lactonizations in redox-neutral cascades. Mol. Catal.468, 44–51. 10.1016/j.mcat.2019.02.006
25
FranceS. P.HepworthL. J.TurnerN. J.FlitschS. L. (2017). Constructing biocatalytic cascades: in vitro and in vivo approaches to de novo multi-enzyme pathways. ACS Catal.7 (1), 710–724. 10.1021/acscatal.6b02979
26
FürstM. J.SavinoS.DudekH. M.Gómez CastellanosJ. R.Gutiérrez de SouzaC.RovidaS.et al (2017). Polycyclic ketone monooxygenase from the thermophilic fungus thermothelomyces thermophila: A structurally distinct biocatalyst for bulky substrates. J. Am. Chem. Soc.139 (2), 627–630. 10.1021/jacs.6b12246
27
GiessenT. W.SilverP. A. (2016). A catalytic nanoreactor based on in vivo encapsulation of multiple enzymes in an engineered protein nanocompartment. ChemBioChem17 (20), 1931–1935. 10.1002/cbic.201600431
28
Gran-ScheuchA.AalbersF.WoudstraY.ParraL.FraaijeM. W. (2021). Optimizing the linker length for fusing an alcohol dehydrogenase with a cyclohexanone monooxygenase. Methods Enzymol.647, 107–143. 10.1016/bs.mie.2020.09.008
29
GrögerH.ChamouleauF.OrologasN.RollmannC.DrauzK.HummelW.et al (2006). Enantioselective reduction of ketones with "designer cells" at high substrate concentrations: Highly efficient access to functionalized optically active alcohols. Angew. Chem. Int. Ed.45 (34), 5677–5681. 10.1002/anie.200503394
30
GuoJ.ChengZ.BerdychowskaJ.ZhuX.WangL.PeplowskiL.et al (2021). Effect and mechanism analysis of different linkers on efficient catalysis of subunit-fused nitrile hydratase. Int. J. Biol. Macromol.181, 444–451. 10.1016/j.ijbiomac.2021.03.103
31
HilkerI.AlphandV.WohlgemuthR.FurstossR. (2004a). Microbial transformations, 56. Preparative scale Asymmetric baeyer-villiger oxidation using a highly Productive"Two-in-one" resin-basedin situ SFPR concept. Adv. Synthesis Catal.346 (23), 203–214. 10.1002/adsc.200303183
32
HilkerI.GutiérrezM. C.AlphandV.WohlgemuthR.FurstossR. (2004b). Microbiological transformations 57. Facile and efficient resin-based in situ SFPR preparative-scale synthesis of an enantiopure "unexpected" lactone regioisomer via a Baeyer−Villiger oxidation process. Org. Lett.6 (12), 1955–1958. 10.1021/ol049508n
33
HilkerI.WohlgemuthR.AlphandV.FurstossR. (2005). Microbial transformations 59: First kilogram scale Asymmetric microbial baeyer-villiger oxidation with optimized productivity using a resin-based in situ sfpr strategy. Biotechnol. Bioeng.92 (6), 702–710. 10.1002/bit.20636
34
HollmannF.ArendsI. W. C. E.BuehlerK.SchallmeyA.BühlerB. (2011). Enzyme-mediated oxidations for the chemist. Green Chem.13 (2), 226–265. 10.1039/c0gc00595a
35
HollmannF.KaraS.OppermanD. J.WangY. (2018). Biocatalytic synthesis of lactones and lactams. Chem. Asian J.13 (23), 3601–3610. 10.1002/asia.201801180
36
HollmannF.OppermanD. J.PaulC. E. (2021). Biocatalytic reduction reactions from a chemist's perspective. Angew. Chem. Int. Ed.60 (11), 5644–5665. 10.1002/anie.202001876
37
HoltmannD.HollmannF. (2022). Is water the best solvent for biocatalysis?Mol. Catal.517, 112035. 10.1016/j.mcat.2021.112035
38
HuangL.AalbersF. S.TangW.RölligR.FraaijeM. W.KaraS.et al (2019). Convergent cascade catalyzed by monooxygenase-alcohol dehydrogenase fusion applied in organic media. ChemBioChem20 (13), 1653–1658. 10.1002/cbic.201800814
39
HuangL.Domínguez de MaríaP.KaraS. (2018). The 'water challenge': Opportunities and challenges of using oxidoreductases in non-conventional media. Chim. Oggi36, 48–56.
40
HuangX.HoldenH. M.RaushelF. M. (2001). Channeling of substrates and intermediates in enzyme-catalyzed reactions. Annu. Rev. Biochem.70 (1), 149–180. 10.1146/annurev.biochem.70.1.149
41
HuangZ.ZhangC.XingX.-H. (2021). Design and construction of chimeric linker library with controllable flexibilities for precision protein engineering. Methods Enzymol.647, 23–49. 10.1016/bs.mie.2020.12.004
42
HuffmanM. A.FryszkowskaA.AlvizoO.Borra-GarskeM.CamposK. R.CanadaK. A.et al (2019). Design of an in vitro biocatalytic cascade for the manufacture of islatravir. Science366 (6470), 1255–1259. 10.1126/science.aay8484
43
IllanesA. (2015). CHAPTER 3. Biocatalysis in organic media. White Biotechnol. Sustain. Chem., 36–51. 10.1039/9781782624080-00036
44
JeonE.-Y.BaekA. H.BornscheuerU. T.ParkJ.-B. (2015). Enzyme fusion for whole-cell biotransformation of long-chain sec-alcohols into esters. Appl. Microbiol. Biotechnol.99 (15), 6267–6275. 10.1007/s00253-015-6392-9
45
KaraS.SchrittwieserJ. H.HollmannF. (2013). Strategies for cofactor regeneration in biocatalyzed reductions. Synthetic Methods Biol. Act. Mol., 209–238. 10.1002/9783527665785.ch08
46
KeebleA. H.HowarthM. (2020). Power to the protein: Enhancing and combining activities using the Spy toolbox. Chem. Sci.11 (28), 7281–7291. 10.1039/d0sc01878c
47
KlibanovA. M. (1989). Enzymatic catalysis in anhydrous organic solvents. Trends Biochem. Sci.14 (4), 141–144. 10.1016/0968-0004(89)90146-1
48
KokkonenP.BednarD.PintoG.ProkopZ.DamborskyJ. (2019). Engineering enzyme access tunnels. Biotechnol. Adv.37 (6), 107386. 10.1016/j.biotechadv.2019.04.008
49
KokorinA.ParshinP. D.BakkesP. J.PometunA. A.TishkovV. I.UrlacherV. B.et al (2021). Genetic fusion of P450 Bm3 and formate dehydrogenase towards self-sufficient biocatalysts with enhanced activity. Sci. Rep.11 (1), 21706. 10.1038/s41598-021-00957-5
50
KokorinA.UrlacherV. B. (2022). Artificial fusions between P450 BM3 and an alcohol dehydrogenase for efficient (+)-Nootkatone production. ChemBioChem23 (12), e202200065. 10.1002/cbic.202200065
51
KüchlerA.YoshimotoM.LuginbühlS.MavelliF.WaldeP. (2016). Enzymatic reactions in confined environments. Nat. Nanotech11 (5), 409–420. 10.1038/nnano.2016.54
52
KumarA.DharK.KanwarS. S.AroraP. K. (2016). Lipase catalysis in organic solvents: Advantages and applications. Biol. Proced. Online18 (1), 2. 10.1186/s12575-016-0033-2
53
LaiY.-T.JiangL.ChenW.YeatesT. O. (2015). On the predictability of the orientation of protein domains joined by a spanning alpha-helical linker. Protein Eng. Des. Sel.28 (11), 491–500. 10.1093/protein/gzv035
54
LerchnerA.DaakeM.JaraschA.SkerraA. (2016). Fusion of an alcohol dehydrogenase with an aminotransferase using a pas linker to improve coupled enzymatic alcohol-to-amine conversion. Protein Eng. Des. Sel.29 (12), 557–562. 10.1093/protein/gzw039
55
MatthewsS.TeeK. L.RattrayN. J.McLeanK. J.LeysD.ParkerD. A.et al (2017). Production of alkenes and novel secondary products by P450 Oletje using novel H2O2-generating fusion protein systems. FEBS Lett.591 (5), 737–750. 10.1002/1873-3468.12581
56
MittmannE.MickoleitF.MaierD. S.StäblerS. Y.KleinM. A.NiemeyerC. M.et al (2022). A magnetosome-based platform for flow biocatalysis. ACS Appl. Mat. Interfaces14, 22138–22150. 10.1021/acsami.2c03337
57
Mourelle-InsuaÁ.AalbersF. S.LavanderaI.Gotor-FernándezV.FraaijeM. W. (2019). What to sacrifice? Fusions of cofactor regenerating enzymes with baeyer-villiger monooxygenases and alcohol dehydrogenases for self-sufficient redox biocatalysis. Tetrahedron75 (13), 1832–1839. 10.1016/j.tet.2019.02.015
58
MunroA. W.GirvanH. M.McLeanK. J. (2007). Cytochrome P450-redox partner fusion enzymes. Biochimica Biophysica Acta (BBA) - General Subj.1770 (3), 345–359. 10.1016/j.bbagen.2006.08.018
59
MuschiolJ.PetersC.OberleitnerN.MihovilovicM. D.BornscheuerU. T.RudroffF.et al (2015). Cascade catalysis - strategies and challenges en route to preparative synthetic biology. Chem. Commun.51 (27), 5798–5811. 10.1039/C4CC08752F
60
NgoA. C. R.SchultesF. P. J.MaierA.HadewigS. N. H.TischlerD. (2022). Improving biocatalytic properties of an azoreductase via the N- terminal fusion of formate dehydrogenase. Chembiochem.23 (6), e202100643. 10.1002/cbic.202100643
61
NiY.HoltmannD.HollmannF. (2014). How green is biocatalysis? To calculate is to know. ChemCatChem6 (4), 930–943. 10.1002/cctc.201300976
62
NorrisJ. L.HughesR. M. (2018). protaTETHER - a method for the incorporation of variable linkers in protein fusions reveals impacts of linker flexibility in a PKAc‐GFP fusion protein. FEBS Open Bio8 (6), 1029–1042. 10.1002/2211-5463.12414
63
OsterbergP. M.NiemeierJ. K.WelchC. J.HawkinsJ. M.MartinelliJ. R.JohnsonT. E.et al (2015). Experimental limiting oxygen concentrations for nine organic solvents at temperatures and pressures relevant to aerobic oxidations in the pharmaceutical industry. Org. Process Res. Dev.19 (11), 1537–1543. 10.1021/op500328f
64
PapaleoE.SaladinoG.LambrughiM.Lindorff-LarsenK.GervasioF. L.NussinovR.et al (2016). The role of protein loops and linkers in conformational dynamics and allostery. Chem. Rev.116 (11), 6391–6423. 10.1021/acs.chemrev.5b00623
65
PetersC.RudroffF.MihovilovicM. D.T. BornscheuerU. T. (2017). Fusion proteins of an enoate reductase and a baeyer-villiger monooxygenase facilitate the synthesis of chiral lactones. Biol. Chem.398 (1), 31–37. 10.1515/hsz-2016-0150
66
QuinM. B.WallinK. K.ZhangG.Schmidt-DannertC. (2017). Spatial organization of multi-enzyme biocatalytic cascades. Org. Biomol. Chem.15 (20), 4260–4271. 10.1039/c7ob00391a
67
RabeK. S.MüllerJ.SkoupiM.NiemeyerC. M. (2017). Cascades in compartments: En route to machine-assisted Biotechnology. Angew. Chem. Int. Ed.56 (44), 13574–13589. 10.1002/anie.201703806
68
RameshH.MayrT.HobischM.BorisovS.KlimantI.KrühneU.et al (2016). Measurement of oxygen transfer from air into organic solvents. J. Chem. Technol. Biotechnol.91 (3), 832–836. 10.1002/jctb.4862
69
Reddy ChichiliV. P.KumarV.SivaramanJ. (2013). Linkers in the structural biology of protein-protein interactions. Protein Sci.22 (2), 153–167. 10.1002/pro.2206
70
RenS.LiC.JiaoX.JiaS.JiangY.BilalM.et al (2019). Recent progress in multienzymes Co-immobilization and multienzyme system Applications. Chem. Eng. J.373, 1254–1278. 10.1016/j.cej.2019.05.141
71
RingborgR. H.Toftgaard PedersenA.WoodleyJ. M. (2017). Automated determination of oxygen-dependent enzyme kinetics in a tube-in-tube flow reactor. ChemCatChem9 (17), 3285–3288. 10.1002/cctc.201700811
72
RomeroE.CastellanosJ. R. G.MatteviA.FraaijeM. W. (2016). Characterization and crystal structure of a robust cyclohexanone monooxygenase. Angew. Chem.128 (51), 16084–16087. 10.1002/ange.201608951
73
Rosinha GrundtvigI. P.HeintzS.KrühneU.GernaeyK. V.AdlercreutzP.HaylerJ. D.et al (2018). Screening of organic solvents for bioprocesses using aqueous-organic two-phase systems. Biotechnol. Adv.36 (7), 1801–1814. 10.1016/j.biotechadv.2018.05.007
74
SatoT.HamadaY.SumikawaM.ArakiS.YamamotoH. (2014). Solubility of oxygen in organic solvents and calculation of the hansen solubility parameters of oxygen. Ind. Eng. Chem. Res.53 (49), 19331–19337. 10.1021/ie502386t
75
ScherkusC.SchmidtS.BornscheuerU. T.GrögerH.KaraS.LieseA.et al (2016). A fed-batch synthetic strategy for a three-step enzymatic synthesis of poly-ϵ-caprolactone. ChemCatChem8 (22), 3446–3452. 10.1002/cctc.201600806
76
ScherkusC.SchmidtS.BornscheuerU. T.GrögerH.KaraS.LieseA.et al (2017). Kinetic insights into ϵ-caprolactone synthesis: Improvement of an enzymatic cascade reaction. Biotechnol. Bioeng.114 (6), 1215–1221. 10.1002/bit.26258
77
SchmidtS.ScherkusC.MuschiolJ.MenyesU.WinklerT.HummelW.et al (2015). An enzyme cascade synthesis of ε-caprolactone and its oligomers. Angew. Chem. Int. Ed.54 (9), 2784–2787. 10.1002/anie.201410633
78
SchoeneC.FiererJ. O.BennettS. P.HowarthM. (2014). Spytag/spycatcher cyclization confers resilience to boiling on a mesophilic enzyme. Angew. Chem. Int. Ed.53 (24), 6101–6104. 10.1002/anie.201402519
79
Sellés VidalL.KellyC. L.MordakaP. M.HeapJ. T. (2018). Review of nad(P)H-dependent oxidoreductases: Properties, engineering and application. Biochimica Biophysica Acta (BBA)—Proteins Proteomics1866 (2), 327–347. 10.1016/j.bbapap.2017.11.005
80
SoléJ.BrummundJ.CaminalG.ÁlvaroG.SchürmannM.GuillénM.et al (2019). Enzymatic synthesis of trimethyl-ε-caprolactone: Process intensification and demonstration on a 100 L scale. Org. Process Res. Dev.23 (11), 2336–2344. 10.1021/acs.oprd.9b00185
81
TavantiM.ParmeggianiF.CastellanosJ. R. G.MatteviA.TurnerN. J. (2017). One-pot biocatalytic double oxidation of α-isophorone for the synthesis of ketoisophorone. ChemCatChem9 (17), 3338–3348. 10.1002/cctc.201700620
82
TievesF.ToninF.Fernández-FueyoE.RobbinsJ.BommariusB.BommariusA.et al (2019). Energising the e-factor: The E&-Factor. Tetrahedron75, 1311–1314. 10.1016/j.tet.2019.01.065
83
Torres-PazmiñoD. E.SnajdrovaR.BaasB.-J.GhobrialM.MihovilovicM. D.FraaijeM. W.et al (2008). Self-sufficient baeyer-villiger monooxygenases: Effective coenzyme regeneration for biooxygenation by fusion engineering. Angew. Chem.120 (12), 2307–2310. 10.1002/ange.200704630
84
van SchieM.SpöringJ. D.BocolaM.Domínguez de MaríaP.RotherD. (2021). Applied biocatalysis beyond just buffers - from aqueous to unconventional media. Options and guidelines. Green Chem.23 (9), 3191–3206. 10.1039/d1gc00561h
85
Velasco-LozanoS.Benítez-MateosA. I.López‐GallegoF. (2017). Co-immobilized phosphorylated cofactors and enzymes as self‐sufficient heterogeneous biocatalysts for chemical processes. Angew. Chem. Int. Ed.56 (3), 771–775. 10.1002/anie.201609758
86
VidalL. S.KellyC. L.MordakaP. M.HeapJ. T. (2018). Review of NAD(P)H-Dependent oxidoreductases: Properties, engineering and application. Bba-Proteins Proteom.1866 (2), 327–347. 10.1016/j.bbapap.2017.11.005
87
WalshC. T.MooreB. S. (2019). Enzymatic cascade reactions in biosynthesis. Angew. Chem. Int. Ed.58 (21), 6846–6879. 10.1002/anie.201807844
88
WangH. H.AltunB.NweK.TsourkasA. (2017). Proximity-based sortase-mediated ligation. Angew. Chem. Int. Ed.56 (19), 5349–5352. 10.1002/anie.201701419
89
WeddeS.RommelmannP.ScherkusC.SchmidtS.BornscheuerU. T.LieseA.et al (2017). An alternative approach towards poly-ε-caprolactone through a chemoenzymatic synthesis: Combined hydrogenation, bio-oxidations and polymerization without the isolation of intermediates. Green Chem.19 (5), 1286–1290. 10.1039/c6gc02529c
90
WildingM.ScottC.WardenA. C. (2018). Computer-guided surface engineering for enzyme improvement. Sci. Rep.8 (1), 11998. 10.1038/s41598-018-30434-5
91
XuK.ChenX.ZhengR.ZhengY. (2020). Immobilization of multi-enzymes on support materials for efficient biocatalysis. Front. Bioeng. Biotechnol.8, 660. 10.3389/fbioe.2020.00660
92
ZaksA.KlibanovA. M. (1988). Enzymatic catalysis in nonaqueous solvents. J. Biol. Chem.263 (7), 3194–3201. 10.1016/s0021-9258(18)69054-4
93
ZhangN.MüllerB.KirkebyT. Ø.KaraS.LodererC. (2022). Development of a thioredoxin-based cofactor regeneration system for NADPH-dependent oxidoreductases. ChemCatChem14 (7), e202101625. 10.1002/cctc.202101625
94
ZhangY.WangY.WangS.FangB. (2017). Engineering Bi-functional enzyme complex of formate dehydrogenase and leucine dehydrogenase by peptide linker mediated fusion for accelerating cofactor regeneration. Eng. Life Sci.17 (9), 989–996. 10.1002/elsc.201600232
95
ZhouY.WuS.BornscheuerU. T. (2021). Recent advances in (Chemo)Enzymatic cascades for upgrading bio-based resources. Chem. Commun.57 (82), 10661–10674. 10.1039/D1CC04243B
96
ZhuJ.GengQ.LiuY.-Y.PanJ.YuH. L.XuJ.-H.et al (2022). Co-Cross-Linked aggregates of baeyer-villiger monooxygenases and formate dehydrogenase for repeated use in asymmetric biooxidation. Org. Process Res. Dev.10.1021/acs.oprd.1c00382
Summary
Keywords
fusion enzymes, biocatalytic cascades, oxidoreductases, fusion linkers, aqueous and non-aqueous media
Citation
Ma Y, Zhang N, Vernet G and Kara S (2022) Design of fusion enzymes for biocatalytic applications in aqueous and non-aqueous media. Front. Bioeng. Biotechnol. 10:944226. doi: 10.3389/fbioe.2022.944226
Received
14 May 2022
Accepted
30 June 2022
Published
22 July 2022
Volume
10 - 2022
Edited by
Jennifer Ann Littlechild, University of Exeter, United Kingdom
Reviewed by
Robson Carlos Alnoch, University of São Paulo, Brazil
Updates
Copyright
© 2022 Ma, Zhang, Vernet and Kara.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Selin Kara, selin.kara@bce.au.dk
This article was submitted to Bioprocess Engineering, a section of the journal Frontiers in Bioengineering and Biotechnology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.