Xi-Kun Ma
Qi Peng1†- 1Department of Orthopedic Surgery and Orthopedic Research Institute, West China Hospital, Sichuan University, Chengdu, Sichuan, China
- 2Stem Cell and Tissue Engineering Research Center, State Key Laboratory of Biotherapy, West China Hospital, Sichuan University, Chengdu, Sichuan, China
Functionalized peptide hydrogels represent an emerging class of intelligent wound dressings that dynamically coordinate the multifaceted process of wound healing through stage-specific bioactivities. By leveraging programmable molecular designs, these hydrogels actively engage with key healing phases—hemostasis, antibiosis, inflammation resolution, angiogenesis, and tissue remodeling—enabling spatiotemporal control over cellular behaviors and molecular cues. For instance, antimicrobial peptides (e.g., EPL, LL37, TCP-25) not only eradicate pathogens but also modulate macrophage polarization to mitigate excessive inflammation. Angiogenic factors (e.g., VEGF, SDF-1) are sustainably released to promote vascularization, while MMP-responsive components facilitate ECM remodeling by balancing collagen deposition and degradation. Additionally, integrin-binding motifs (e.g., RGD) enhance cell adhesion and migration, further accelerating re-epithelialization. With inherent self-healing, injectability, and microenvironmental responsiveness (e.g., to pH, enzymes, or ROS), these hydrogels adapt to dynamic wound conditions, offering synergistic therapeutic outcomes. Future directions include designing multi-stimuli-responsive systems, personalized peptide sequences, and advanced delivery platforms (e.g., 3D-printed scaffolds, cell/exosome-loaded hydrogels) to advance clinical translation in precision wound management and regenerative medicine.
1 Introduction
Wound healing constitutes a highly coordinated, multicellular process encompassing five critical phases: hemostasis, antibiosis, inflammation, angiogenesis, and tissue remodeling (Peña and Martin, 2024). During the hemostatic phase, platelets adhere to the exposed subendothelial matrix via surface integrins (such as αIIbβ3 and α2β1) to form a platelet plug, and release growth factors including Platelet-Derived Growth Factor (PDGF) and Transforming Growth Factor-Beta (TGF-β) (Golebiewska and Poole, 2015). Simultaneously, the coagulation cascade is activated to generate a fibrin network, collectively establishing a provisional matrix (de Bont et al., 2019). They eliminate pathogens through the release of antimicrobial granules (e.g., elastase, cathepsin G), formation of neutrophil extracellular traps (NETs), and phagocytosis (Chen et al., 2018; Sollberger et al., 2018). The inflammatory phase is primarily orchestrated by macrophages. Initially, M1-type macrophages secrete pro-inflammatory cytokines such as Tumor Necrosis Factor-Alpha (TNF-α) and Interleukin-6 (IL-6), and phagocytose pathogens. These subsequently transition to M2-type macrophages, which promote angiogenesis via vascular endothelial growth factor (VEGF) secretion and resolve inflammation through efferocytosis of apoptotic neutrophils (Murray, 2017; Van Dyken and Locksley, 2013). During angiogenesis, endothelial cells—guided by factors such as VEGF—drive new vessel formation. Pericytes and macrophages provide structural support and paracrine signaling, facilitating the assembly of a functional vascular network (Eilken and Adams, 2010). Finally, in the remodeling phase, myofibroblasts mediate wound contraction through α-smooth muscle actin (α-SMA) expression and secrete extracellular matrix (ECM) components, before being cleared via apoptosis. Macrophages contribute to fibrinolytic activity and remove excess matrix, while the balance between matrix metalloproteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) regulates collagen remodeling, ultimately leading to tissue repair and scar formation (Eilken and Adams, 2010). This multicellular process is finely regulated, and dysregulation at any step may result in impaired healing (Figure 1).
Figure 1. Multicellular involvement across the stages of wound healing.
2 Functionalized peptide hydrogel
In recent years, functionalized peptide hydrogels have emerged as advanced wound dressings demonstrating significant potential in promoting the healing of both acute and chronic wounds (Shaw et al., 2025). Certain antimicrobial peptides (AMPs), such as ε-polylysine (EPL), GL13L, LLKKK18, and TCP-25, not only exert antibacterial effects by directly disrupting bacterial membrane structures (Liang et al., 2021), but also mitigate excessive inflammatory responses by modulating macrophage polarization—such as promoting the M2 phenotype—thereby reducing pro-inflammatory cytokines (e.g., TNF-α, IL-6) and upregulating reparative cytokines (e.g., TGF-β, IL-10) to achieve phase-appropriate antibacterial and anti-inflammatory effects (Zhou et al., 2023). In terms of angiogenesis, peptide hydrogels can be loaded with and sustainably release VEGF, stromal cell-derived factor-1 (SDF-1), and other factors to promote endothelial cell proliferation and lumen formation, thereby improving local blood supply and oxygen delivery to the wound site (Xu et al., 2018; Zhu et al., 2016). Certain peptides, such as the laminin-mimetic peptide SIKVAV, can directly activate endothelial signaling pathways and enhance angiogenic capacity (Chen et al., 2015). Furthermore, during the collagen remodeling phase, peptide hydrogels regulate the balance between MMPs and TIMPs, facilitating the transition from type III to type I collagen and enhancing the mechanical strength of the tissue (Caley et al., 2015). It is noteworthy that peptide hydrogels can mimic the physicochemical properties of the ECM, providing a biomimetic microenvironment that supports cell migration, proliferation, and differentiation. For instance, peptides containing the Arg-Gly-Asp (RGD) sequence specifically recognize integrin receptors, enhancing the adhesion and migration of fibroblasts and keratinocytes to accelerate re-epithelialization and granulation tissue formation (Kemker et al., 2021). Moreover, peptide hydrogels exhibit excellent self-healing properties and injectability, allowing them to adapt to irregular wound shapes and maintain structural integrity within the dynamic wound microenvironment for sustained functionality (Chen et al., 2020). Their high molecular design flexibility enables responsiveness to microenvironmental changes such as pH, enzymes, or redox potential, facilitating intelligent drug release and precise modulation of cellular behaviors. Thus, through multi-target and multi-mechanistic synergistic actions, functionalized peptide hydrogels promote wound healing by enhancing cell adhesion, combating bacterial infection, regulating inflammation, stimulating angiogenesis, and supporting tissue remodeling, positioning them as next-generation intelligent wound dressings with broad application prospects.
3 Functionalized peptide hydrogels promote wound healing through dynamic stage-matching mechanisms
Functionalized peptide hydrogels represent a highly promising strategy by employing stage-responsive design to dynamically coordinate multicellular behaviors—including hemostasis, antimicrobial defense, inflammation resolution, angiogenesis, and tissue remodeling—thereby synergistically promoting wound healing (Figure 2).
Figure 2. Functionalized hydrogels promote wound healing through dynamic stage-matching mechanisms (Zuev et al., 2024; Yu et al., 2022; Santi et al., 2021; Wang et al., 2024; Petruk et al., 2020; Martynowycz et al., 2019; Nogara et al., 2023; Ivanchenko et al., 2023; Wolkersdorfer et al., 2024; Kemker et al., 2021; Laronha et al., 2020).
3.1 Hemostasis
Most hydrogels achieve hemostasis through adhesive effects to physically seal wounds (Rodrigues et al., 2019; Yang et al., 2024). While this simple mechanism is effective to some extent, improved outcomes can be achieved by dynamically matching the physiological mechanisms of hemostasis. This process can be modulated through two key pathways: platelet aggregation and activation of the coagulation cascade.
In 2012, Kumar et al. developed a series of nano-composite hydrogel bandages based on chitosan (CS) or chitin, demonstrating that cationic CS interacts with negatively charged blood cells to activate platelets and promote coagulation (Kumar et al., 2012). Subsequently, Fan et al. fabricated a CS/gelatin/PVA composite hydrogel and further elucidated the hemostatic mechanisms involving CS-induced platelet activation and coagulation factor production, in addition to physical sealing by the hydrogel (Fan et al., 2016). Further studies have shown that grafting positively charged components onto hydrogels enhances interactions with platelets, blood cells, and plasma fibronectin via electrostatic attraction, thereby inducing platelet activation and blood cell aggregation to promote coagulation. Besides CS, such cationic components include quaternary ammonium groups (Wang et al., 2019a; Venault et al., 2019), and cationic peptides (Yang et al., 2017). For example, gelatin exhibits strong water absorption and effective hemostatic activity. Studies have confirmed that it not only expands upon absorbing blood and tissue fluids to occlude bleeding wounds but also activates and aggregates platelets to facilitate coagulation (Huang et al., 2020; Han et al., 2021). Additionally, Rahmany et al. demonstrated that the loose, porous cross-linked network formed by keratin self-assembly can mimic the ECM, promoting platelet adhesion, activation, and the coagulation cascade (Rahmany et al., 2013; Wang et al., 2019b).
Wang et al. developed a quaternized hydroxyethyl cellulose/mesocellular silica foam hydrogel sponge (QHM) for hemostasis. The hydrophilic and highly absorbent QHM hydrogel attracts blood cells into its network. Besides the electrostatic interaction between quaternary ammonium groups and blood cells—which initiates clotting and platelet aggregation—an appropriate amount of mesoporous silica foam further activates factor XII (FXII). Thus, the QHM hydrogel significantly reduces in vitro plasma clotting time through these synergistic effects (Wang C. et al., 2019). Similarly, Lei et al. found that low-molecular-weight silk fibroin (SF) promotes activation of the coagulation cascade, accelerates fibrin formation, and strengthens blood clots to achieve hemostasis (Lei et al., 2016). Rahmany et al. also confirmed that keratin shortens plasma clotting lag time, promotes fibrinogen polymerization into fibrin, enhances coagulation, and reduces blood loss (Rahmany et al., 2013; Wang et al., 2019b). Furthermore, as a coagulation factor, calcium ions (Ca2+) promote blood clotting. Accordingly, Zhou et al. prepared an acetate chitosan/CaCO3 hydrogel in which H+ ions from acetate chitosan react with CaCO3 upon water absorption, releasing Ca2+ that not only strengthens the hydrogel network but also participates in hemostasis (Zhou et al., 2019).
Beyond dynamically matching the physiological process of hemostasis, functionalized peptide hydrogels can also deeply participate in subsequent healing phases. For instance, after platelet aggregation, growth factors and cytokines such as PDGF, transforming growth factor (TGF), epidermal growth factor (EGF), and insulin-like growth factor (IGF) are released—key mediators for subsequent healing stages (Rodrigues et al., 2019). This represents a significant advancement over mere physical sealing for hemostasis.
3.2 Antimicrobial
In the early wound phase, neutrophils and macrophages are recruited through various factors to eliminate pathogens by releasing antimicrobial granules (e.g., elastase, cathepsin G), forming NETs, and phagocytosis (Rodrigues et al., 2019).
As part of the innate epithelial chemical barrier, AMPs have recently garnered significant attention as promising broad-spectrum antibacterial agents against infections (Thakur et al., 2022). EPL, a natural polycationic homopolymer produced by Streptomyces albulus, has been widely investigated (Wang et al., 2024). Wang et al. developed a hydrogel co-loaded with EPL and MnO2 nanosheets, which demonstrated exceptional antibacterial efficacy against multidrug-resistant (MDR) bacteria, particularly S. aureus and MRSA, due to their synergistic effects (Wang et al., 2020). Liu et al. fabricated a self-healing bioadhesive hydrogel by blending modified hyaluronic acid (HA) and EPL. This inherently antibacterial hydrogel effectively eradicated Escherichia coli and S. aureus on wound surfaces and accelerated healing in an infected rat model (Liu et al., 2020). LL37, a human host defense peptide, is the only known cathelicidin in humans and plays a vital role in the innate immune system (Martynowycz et al., 2019). Yang et al. developed an LL-37/CS hydrogel dressing via physical mixing, which significantly inhibited the growth of S. aureus in vitro (Yang et al., 2020). Ma et al. designed a porcine small intestinal submucosa hydrogel incorporating LL37, which exhibited potent antibacterial properties (Ma et al., 2022). Other researchers developed a keratin-based hydrogel containing LL37, which not only promoted fibroblast proliferation, adhesion, and migration but also effectively eradicated both Gram-negative and Gram-positive bacteria and significantly enhanced microvascular density (Jelodari et al., 2023). TCP-25, a thrombin-derived C-terminal peptide consisting of 25 amino acids, has also shown therapeutic potential (Petruk et al., 2020). Puthia et al. developed a TCP-25-loaded hydrogel and thoroughly validated its antibacterial (against S. aureus and Pseudomonas aeruginosa) and anti-inflammatory activities in both mouse and partial-thickness porcine wound models. However, the stability of this hydrogel in human and porcine plasma requires further improvement, likely because TCP-25 does not bind to hydroxyethyl cellulose and is rapidly released into bodily fluids, resulting in a short half-life (Puthia et al., 2020).
Beyond these three widely studied AMPs, numerous other AMPs have been discovered and developed in various forms—such as nanoparticles, films, and hydrogels—to promote wound healing.
3.3 Anti-inflammatory
Following the antibacterial phase, persistent retention of neutrophils in the wound bed leads to excessive release of reactive oxygen species (ROS), activation of inflammatory signaling pathways, and further recruitment of immune cells, establishing a pro-inflammatory–ROS positive feedback loop (Rodrigues et al., 2019). In such cases, the impaired antioxidant system—including compromised function of superoxide dismutase and glutathione peroxidase—fails to clear ROS in a timely manner, resulting in sustained tissue damage. Therefore, controlling ROS levels and interrupting this feedback loop are central to anti-inflammatory strategies.
Given the strong context-dependence of ROS functions, there is a critical need to monitor and regulate ROS generation and concentration in wounds, which has motivated the development of tailored ROS-responsive biomaterials. Currently, ROS-responsive motifs can be classified into two major categories based on their mechanisms: The first category involves degradable motifs that undergo oxidative cleavage, leading to polymer chain dissociation and consequent changes in material properties—such as direct release of active ingredients or modulation of swelling behavior for indirect release. Commonly used motifs in this category include thioketal, diselenide, boronate ester, and aryl oxalate bonds. The second category relies on solubility-switching motifs that transition from hydrophobic to hydrophilic upon oxidation, thereby altering the swelling behavior of the material to achieve desired release profiles. Typical examples include thioether, ferrocene, and organochalcogen-based (e.g., selenium, tellurium) motifs. The development of diselenide-based ROS-responsive systems was pioneered by Ma and colleagues, who synthesized ROS-cleavable micelles capable of releasing glutathione upon hydrogen peroxide stimulation (Ma et al., 2010). Such designs have now been widely adopted. For instance, the research team led by Guo developed a gelatin-thioketal hydrogel that effectively reduced inflammation and promoted healing in diabetic wounds (Guo et al., 2022). Although numerous ROS-responsive materials have been explored, most current applications focus on fields such as oncology. Future efforts could leverage ROS-responsive mechanisms to deliver peptide-based therapeutics using hydrogels tailored for dynamic anti-inflammatory modulation in wound healing.
Furthermore, during the inflammatory phase, keratin has been shown to suppress the M1 phenotype while promoting polarization toward the M2 phenotype, resulting in reduced levels of pro-inflammatory cytokines (e.g., IL-1β, IL-6) and increased production of anti-inflammatory cytokines (e.g., IL-10) (Fearing and Van Dyke, 2014). This provides a mechanistic basis for developing anti-inflammatory stage-matched peptide hydrogels.
3.4 Angiogenesis
Angiogenesis is one of the most critical stages of wound healing, involving a complex interplay of cells (Rodrigues et al., 2019). Peptides most closely integrated with hydrogels can be classified into three categories: growth factor-related peptides (Xie et al., 2023), cell-adhesive peptides (Li et al., 2025b), and peptides that promote the macrophage polarization (Zhou et al., 2023; Li et al., 2025a).
During the pro-angiogenic process, growth factor-related peptides such as VEGF, PDGF, and bFGF play a fundamental role in promoting cellular proliferation. Wang et al. developed a VEGF-loaded hydrogel patch that achieves accelerated healing of diabetic wounds through rapid VEGF release in the high-glucose wound environment (Wang et al., 2025). In a similar approach, Zhang et al. developed a nano-responsive hydrogel loaded with PDGF, which also demonstrated efficacy in promoting the healing of diabetic wounds in animal studies (Zhang et al., 2025).
Cell-adhesive peptides primarily promote angiogenesis by facilitating the adhesion and migration of endothelial cells. The RGD sequence derived from fibrin not only provides critical support for endothelial cell migration and exerts selective chemotaxis (Montalbano et al., 2018), but also serves as an essential factor that synergistically drives neovascularization and granulation tissue formation (Dvorak et al., 1987; Heher et al., 2018). Zhu et al. demonstrated that the peptide YIGSR enhanced angiogenesis in a murine dorsal skin defect model, thereby accelerating wound healing (Li et al., 2025b). During the normal healing phase, pro-inflammatory M1 macrophages polarize toward an anti-inflammatory M2 phenotype as inflammation resolves (Galli et al., 2011). M2 macrophages release growth factors such as VEGF, which promotes vascular sprouting (Willenborg et al., 2012). Accordingly, Zhou et al. developed a hydrogel with dual antibacterial and anti-inflammatory activities; its loaded GL13L antimicrobial peptide not only combats pathogens but also promotes the transition from M1 to M2 macrophage polarization (Zhou et al., 2023). Similarly, Li et al. designed a gelatin methacryloyl hydrogel capable of sustained release of calcitonin gene-related peptide (CGRP), which was demonstrated both in vitro and in vivo to enhance macrophage polarization and angiogenesis (Li et al., 2025a).
These insights suggest that further elucidating the activation mechanisms and signaling pathways of other pro-angiogenic cells—such as through targeted agonism of specific receptors—may enable the development of more efficient and directly responsive hydrogels for dynamic stage-matched wound healing.
3.5 Remodeling
The remodeling phase is characterized by the regression of nascent vasculature, cyclical deposition and remodeling of the ECM, and the transformation of granulation tissue into scar tissue (Rodrigues et al., 2019). A key event in ECM remodeling is the targeted degradation of specific components by MMPs (Caley et al., 2015). During this process, de novo matrix synthesis slows significantly, leading to the gradual replacement of type III collagen with type I collagen within the granulation tissue (Caley et al., 2015). Upon ECM modification, TIMPs act to suppress MMP activity; an imbalance between TIMP and MMP expression can result in aberrant ECM remodeling and even contribute to chronic wound development (Gill et al., 2003; Taylor et al., 2000).
The MMP-responsive behavior of hydrogel systems is primarily mediated by proteins or peptides that serve as substrates for MMP cleavage. When exposed to sufficient MMP concentrations, these protease-sensitive motifs are hydrolyzed, leading to degradation of the hydrogel or drug-loaded microparticles and subsequent release of therapeutic agents. For example, Shao et al. encapsulated the pro-angiogenic drug deferoxamine (DFO) within gelatin microspheres. Incorporated into a chitosan-polyvinyl alcohol hydrogel matrix featuring ROS-responsive boronate ester bonds, these microspheres additionally responded to highly expressed MMP-9, enabling controlled DFO release. This system reduced oxidative stress in diabetic wounds while promoting angiogenesis, thereby creating a favorable microenvironment for remodeling and accelerating healing (Shao et al., 2023). Similarly, Zhang et al. developed a hydrogel composed of dopamine-functionalized oxidized hyaluronic acid, carboxymethyl chitosan, and collagen, which incorporated curcumin-loaded gelatin nanoparticles to enhance wound remodeling and repair (Zhang et al., 2023). Jeong et al. designed a hydrogel system based on functionalized hyaluronic acid and adamantane, where the latter was conjugated to AMPs via a cyclic peptide linker containing both MMP- and ROS-cleavable sequences. This dual-responsive strategy showed significant potential for treating chronic diabetic wounds (Jeong et al., 2023).
As demonstrated in these examples, the two most common strategies for incorporating MMP responsiveness into hydrogels are: (1) using gelatin as an MMP substrate—either as a matrix material or in drug/RNA-loaded microparticles; and (2) introducing MMP-sensitive peptide side chains or using MMP-cleavable cross-linkers within the hydrogel network. Both approaches effectively leverage MMP-responsive behavior to promote wound remodeling and healing, offering distinct advantages for treating chronic wounds such as diabetic ulcers. Furthermore, the design of hydrogels that act as dual sensors for MMP and TIMP to dynamically control therapeutic responses—thus enabling stage-specific interventions and promoting orderly tissue remodeling—represents a highly compelling strategy.
4 Summary and prospects
Functionalized peptide hydrogels represent a transformative advancement in wound care, moving beyond static barrier functions to actively orchestrate the dynamic healing process. By targeting multiple cellular behaviors and molecular pathways in a stage-specific manner, these hydrogels promote synergistic therapeutic outcomes, addressing the complexity of healing, particularly in challenging chronic wounds like diabetic ulcers. This review establishes a clear roadmap for developing “intelligent” wound dressings. The concept of designing materials that sense and respond to specific wound biomarkers (pH, enzymes, ROS) moves the field beyond one-size-fits-all solutions towards personalized, feedback-driven treatments. Future research should focus on developing sequentially multi-stimuli-responsive systems (e.g., synergistic sensing of MMP/ROS/pH), designing personalized peptide sequences, fabricating 3D-printed structural scaffolds, and engineering composite hydrogels loaded with cells or exosomes. Such advances are expected to accelerate the clinical translation and application of peptide hydrogels in wound management and precision regenerative medicine.
Author contributions
X-KM: Conceptualization, Data curation, Investigation, Methodology, Validation, Software, Writing – original draft, Writing – review and editing. QP: Conceptualization, Data curation, Investigation, Methodology, Software, Supervision, Writing – original draft. G-HM: Conceptualization, Data curation, Investigation, Methodology, Formal Analysis, Software, Writing – original draft. X-ZZ: Formal Analysis, Funding acquisition, Project administration, Resources, Supervision, Validation, Visualization, Writing – review and editing.
Funding
The author(s) declare financial support was received for the research and/or publication of this article. This research was supported by the National Natural Science Foundation of China (Grant No. 32301140) and Science and Technology Program of Sichuan Province (2024NSFSC1660).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Generative AI statement
The author(s) declare that no Generative AI was used in the creation of this manuscript.
Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Abbreviations
AMPs, Antimicrobial Peptides; EPL, ε-polylysine; GL13L, Derived from Parotid Secretory Protein; LLKKK18, A synthetic antimicrobial peptide sequence; TCP-25, A thrombin-derived C-terminal peptide; LL-37, [LL-37, 37 aa]; VEGF, Vascular Endothelial Growth Factor; PDGF, Platelet-Derived Growth Factor; bFGF, Basic Fibroblast Growth Factor; SDF-1, Stromal Cell-Derived Factor-1; RGD, Arginine-Glycine-Aspartic Acid; YIGSR, Tyr-Ile-Gly-Ser-Arg; CGRP, Calcitonin Gene-Related Peptide; SIKVAV, Ser-Ile-Lys-Val-Ala-Val; TGF-β, Transforming Growth Factor-Beta.
References
Caley, M. P., Martins, V. L., and O'toole, E. A. (2015). Metalloproteinases and wound healing. Adv. Wound Care New Rochelle 4, 225–234. doi:10.1089/wound.2014.0581
Chen, S., Zhang, M., Shao, X., Wang, X., Zhang, L., Xu, P., et al. (2015). A laminin mimetic peptide SIKVAV-conjugated chitosan hydrogel promoting wound healing by enhancing angiogenesis, re-epithelialization and collagen deposition. J. Mater Chem. B 3, 6798–6804. doi:10.1039/c5tb00842e
Chen, K. W., Monteleone, M., Boucher, D., Sollberger, G., Ramnath, D., Condon, N. D., et al. (2018). Noncanonical inflammasome signaling elicits gasdermin D-dependent neutrophil extracellular traps. Sci. Immunol. 3, eaar6676. doi:10.1126/sciimmunol.aar6676
Chen, B., Liang, Y., Bai, L., Xu, M., Zhang, J., Guo, B., et al. (2020). Sustained release of magnesium ions mediated by injectable self-healing adhesive hydrogel promotes fibrocartilaginous interface regeneration in the rabbit rotator cuff tear model. Chem. Eng. J. 396, 125335. doi:10.1016/j.cej.2020.125335
De Bont, C. M., Boelens, W. C., and Pruijn, G. J. M. (2019). NETosis, complement, and coagulation: a triangular relationship. Cell Mol. Immunol. 16, 19–27. doi:10.1038/s41423-018-0024-0
Dvorak, H. F., Harvey, V. S., Estrella, P., Brown, L. F., Mcdonagh, J., and Dvorak, A. M. (1987). Fibrin containing gels induce angiogenesis. Implications for tumor stroma generation and wound healing. Lab. Invest 57, 673–686.
Eilken, H. M., and Adams, R. H. (2010). Dynamics of endothelial cell behavior in sprouting angiogenesis. Curr. Opin. Cell Biol. 22, 617–625. doi:10.1016/j.ceb.2010.08.010
Fan, L., Yang, H., Yang, J., Peng, M., and Hu, J. (2016). Preparation and characterization of chitosan/gelatin/PVA hydrogel for wound dressings. Carbohydr. Polym. 146, 427–434. doi:10.1016/j.carbpol.2016.03.002
Fearing, B. V., and Van Dyke, M. E. (2014). In vitro response of macrophage polarization to a keratin biomaterial. Acta Biomater. 10, 3136–3144. doi:10.1016/j.actbio.2014.04.003
Galli, S. J., Borregaard, N., and Wynn, T. A. (2011). Phenotypic and functional plasticity of cells of innate immunity: macrophages, mast cells and neutrophils. Nat. Immunol. 12, 1035–1044. doi:10.1038/ni.2109
Gill, S. E., Pape, M. C., Khokha, R., Watson, A. J., and Leco, K. J. (2003). A null mutation for tissue inhibitor of metalloproteinases-3 (Timp-3) impairs murine bronchiole branching morphogenesis. Dev. Biol. 261, 313–323. doi:10.1016/s0012-1606(03)00318-x
Golebiewska, E. M., and Poole, A. W. (2015). Platelet secretion: from haemostasis to wound healing and beyond. Blood Rev. 29, 153–162. doi:10.1016/j.blre.2014.10.003
Guo, C., Wu, Y., Li, W., Wang, Y., and Kong, Q. (2022). Development of a microenvironment-responsive hydrogel promoting chronically infected diabetic wound healing through sequential hemostatic, antibacterial, and angiogenic activities. ACS Appl. Mater Interfaces 14, 30480–30492. doi:10.1021/acsami.2c02725
Han, K., Bai, Q., Wu, W., Sun, N., Cui, N., and Lu, T. (2021). Gelatin-based adhesive hydrogel with self-healing, hemostasis, and electrical conductivity. Int. J. Biol. Macromol. 183, 2142–2151. doi:10.1016/j.ijbiomac.2021.05.147
Heher, P., Mühleder, S., Mittermayr, R., Redl, H., and Slezak, P. (2018). Fibrin-based delivery strategies for acute and chronic wound healing. Adv. Drug Deliv. Rev. 129, 134–147. doi:10.1016/j.addr.2017.12.007
Huang, Y., Zhao, X., Zhang, Z., Liang, Y., Yin, Z., Chen, B., et al. (2020). Degradable gelatin-based IPN cryogel hemostat for rapidly stopping deep noncompressible hemorrhage and simultaneously improving wound healing. Chem. Mater. 32, 6595–6610. doi:10.1021/acs.chemmater.0c02030
Ivanchenko, O., Mazières, S., Harrisson, S., and Destarac, M. (2023). On-Demand degradation of thioester/thioketal functions in vinyl pivalate-derived copolymers with thionolactones. Macromolecules 56, 4163–4171. doi:10.1021/acs.macromol.3c00312
Jelodari, S., Daemi, H., Mohammadi, P., Verdi, J., M, J. A.-A., Ai, J., et al. (2023). Assessment of the efficacy of an LL-37-Encapsulated keratin hydrogel for the treatment of full-thickness wounds. ACS Appl. Bio Mater 6, 2122–2136. doi:10.1021/acsabm.2c01068
Jeong, S. H., Cheong, S., Kim, T. Y., Choi, H., and Hahn, S. K. (2023). Supramolecular hydrogels for precisely controlled antimicrobial peptide delivery for diabetic wound healing. ACS Appl. Mater Interfaces 15, 16471–16481. doi:10.1021/acsami.3c00191
Kemker, I., Schröder, D. C., Feiner, R. C., Müller, K. M., Marion, A., and Sewald, N. (2021). Tuning the biological activity of RGD peptides with Halotryptophans. J. Med. Chem. 64, 586–601. doi:10.1021/acs.jmedchem.0c01536
Kumar, P. T., Lakshmanan, V. K., Anilkumar, T. V., Ramya, C., Reshmi, P., Unnikrishnan, A. G., et al. (2012). Flexible and microporous chitosan hydrogel/nano ZnO composite bandages for wound dressing: in vitro and in vivo evaluation. ACS Appl. Mater Interfaces 4, 2618–2629. doi:10.1021/am300292v
Laronha, H., Carpinteiro, I., Portugal, J., Azul, A., Polido, M., Petrova, K. T., et al. (2020). Challenges in matrix metalloproteinases inhibition. Biomolecules 10, 717. doi:10.3390/biom10050717
Lei, C., Zhu, H., Li, J., Feng, X., and Chen, J. (2016). Preparation and hemostatic property of low molecular weight silk fibroin. J. Biomater. Sci. Polym. Ed. 27, 403–418. doi:10.1080/09205063.2015.1136918
Li, X., Yi, M., Song, Z., Ni, T., Tu, L., Yu, M., et al. (2025a). A calcitonin gene-related peptide co-crosslinked hydrogel promotes diabetic wound healing by regulating M2 macrophage polarization and angiogenesis. Acta Biomater. 196, 109–122. doi:10.1016/j.actbio.2025.02.046
Li, Z., Sun, H., Yin, Z., Shi, X., Zhao, R., Wang, W., et al. (2025b). Electrospun scaffold Co-Modified with YIGSR peptide and heparin for enhanced skin wound healing. Adv. Healthc. Mater 14, e2501745. doi:10.1002/adhm.202501745
Liang, Y., He, J., and Guo, B. (2021). Functional hydrogels as wound dressing to enhance wound healing. ACS Nano 15, 12687–12722. doi:10.1021/acsnano.1c04206
Liu, S., Liu, X., Ren, Y., Wang, P., Pu, Y., Yang, R., et al. (2020). Mussel-inspired dual-cross-linking hyaluronic Acid/ε-Polylysine hydrogel with self-healing and antibacterial properties for wound healing. ACS Appl. Mater Interfaces 12, 27876–27888. doi:10.1021/acsami.0c00782
Ma, N., Li, Y., Xu, H., Wang, Z., and Zhang, X. (2010). Dual redox responsive assemblies formed from diselenide block copolymers. J. Am. Chem. Soc. 132, 442–443. doi:10.1021/ja908124g
Ma, S., Wang, C., Dong, Y., Jing, W., Wei, P., Peng, C., et al. (2022). Microsphere-gel composite system with mesenchymal stem cell recruitment, antibacterial, and immunomodulatory properties promote bone regeneration via sequential release of LL37 and W9 peptides. ACS Appl. Mater Interfaces 14, 38525–38540. doi:10.1021/acsami.2c10242
Martynowycz, M. W., Rice, A., Andreev, K., Nobre, T. M., Kuzmenko, I., Wereszczynski, J., et al. (2019). Salmonella membrane structural remodeling increases resistance to antimicrobial peptide LL-37. ACS Infect. Dis. 5, 1214–1222. doi:10.1021/acsinfecdis.9b00066
Montalbano, G., Toumpaniari, S., Popov, A., Duan, P., Chen, J., Dalgarno, K., et al. (2018). Synthesis of bioinspired collagen/alginate/fibrin based hydrogels for soft tissue engineering. Mater Sci. Eng. C Mater Biol. Appl. 91, 236–246. doi:10.1016/j.msec.2018.04.101
Murray, P. J. (2017). Macrophage polarization. Annu. Rev. Physiol. 79, 541–566. doi:10.1146/annurev-physiol-022516-034339
Nogara, P. A., Oliveira, C. S., Madabeni, A., Bortoli, M., Rocha, J. B. T., and Orian, L. (2023). Thiol modifier effects of diphenyl diselenides: insight from experiment and DFT calculations. New J. Chem. 47, 5796–5803. doi:10.1039/d2nj05976b
Peña, O. A., and Martin, P. (2024). Cellular and molecular mechanisms of skin wound healing. Nat. Rev. Mol. Cell Biol. 25, 599–616. doi:10.1038/s41580-024-00715-1
Petruk, G., Petrlova, J., Samsudin, F., Giudice, R. D., Bond, P. J., and Schmidtchen, A. (2020). Concentration- and pH-Dependent oligomerization of the thrombin-derived C-Terminal peptide TCP-25. Biomolecules 10, 1572. doi:10.3390/biom10111572
Puthia, M., Butrym, M., Petrlova, J., Strömdahl, A. C., Andersson, M., Kjellström, S., et al. (2020). A dual-action peptide-containing hydrogel targets wound infection and inflammation. Sci. Transl. Med. 12, eaax6601. doi:10.1126/scitranslmed.aax6601
Rahmany, M. B., Hantgan, R. R., and Van Dyke, M. (2013). A mechanistic investigation of the effect of keratin-based hemostatic agents on coagulation. Biomaterials 34, 2492–2500. doi:10.1016/j.biomaterials.2012.12.008
Rodrigues, M., Kosaric, N., Bonham, C. A., and Gurtner, G. C. (2019). Wound healing: a cellular perspective. Physiol. Rev. 99, 665–706. doi:10.1152/physrev.00067.2017
Santi, S., Mancini, I., Dirè, S., Callone, E., Speranza, G., Pugno, N., et al. (2021). A bio-inspired multifunctionalized silk fibroin. ACS Biomater. Sci. Eng. 7, 507–516. doi:10.1021/acsbiomaterials.0c01567
Shao, Z., Yin, T., Jiang, J., He, Y., Xiang, T., and Zhou, S. (2023). Wound microenvironment self-adaptive hydrogel with efficient angiogenesis for promoting diabetic wound healing. Bioact. Mater 20, 561–573. doi:10.1016/j.bioactmat.2022.06.018
Shaw, R., Patel, K., Chimthanawala, N. M. A., Sathaye, S., and Maji, S. K. (2025). Peptide-based functional amyloid hydrogel enhances wound healing in normal and diabetic rat models. Adv. Healthc. Mater 14, e2403560. doi:10.1002/adhm.202403560
Sollberger, G., Choidas, A., Burn, G. L., Habenberger, P., Di Lucrezia, R., Kordes, S., et al. (2018). Gasdermin D plays a vital role in the generation of neutrophil extracellular traps. Sci. Immunol. 3, eaar6689. doi:10.1126/sciimmunol.aar6689
Taylor, G., Lehrer, M. S., Jensen, P. J., Sun, T. T., and Lavker, R. M. (2000). Involvement of follicular stem cells in forming not only the follicle but also the epidermis. Cell 102, 451–461. doi:10.1016/s0092-8674(00)00050-7
Thakur, A., Sharma, A., Alajangi, H. K., Jaiswal, P. K., Lim, Y. B., Singh, G., et al. (2022). In pursuit of next-generation therapeutics: antimicrobial peptides against superbugs, their sources, mechanism of action, nanotechnology-based delivery, and clinical applications. Int. J. Biol. Macromol. 218, 135–156. doi:10.1016/j.ijbiomac.2022.07.103
Van Dyken, S. J., and Locksley, R. M. (2013). Interleukin-4- and interleukin-13-mediated alternatively activated macrophages: roles in homeostasis and disease. Annu. Rev. Immunol. 31, 317–343. doi:10.1146/annurev-immunol-032712-095906
Venault, A., Bai, Y. W., Dizon, G. V., Chou, H. E., Chiang, H. C., Lo, C. T., et al. (2019). Healing kinetics of diabetic wounds controlled with charge-biased hydrogel dressings. J. Mater Chem. B 7, 7184–7194. doi:10.1039/c9tb01662g
Wang, C., Niu, H., Ma, X., Hong, H., Yuan, Y., and Liu, C. (2019a). Bioinspired, injectable, quaternized hydroxyethyl cellulose composite hydrogel coordinated by mesocellular silica foam for rapid, noncompressible hemostasis and wound healing. ACS Appl. Mater Interfaces 11, 34595–34608. doi:10.1021/acsami.9b08799
Wang, D., Li, W., Wang, Y., Yin, H., Ding, Y., Ji, J., et al. (2019b). Fabrication of an expandable keratin sponge for improved hemostasis in a penetrating trauma. Colloids Surf. B Biointerfaces 182, 110367. doi:10.1016/j.colsurfb.2019.110367
Wang, S., Zheng, H., Zhou, L., Cheng, F., Liu, Z., Zhang, H., et al. (2020). Nanoenzyme-reinforced injectable hydrogel for healing diabetic wounds infected with multidrug resistant bacteria. Nano Lett. 20, 5149–5158. doi:10.1021/acs.nanolett.0c01371
Wang, Y., Wang, L., Hu, Y., Qin, J., and Yu, B. (2024). Design and optimization of ε-poly-l-lysine with specific functions for diverse applications. Int. J. Biol. Macromol. 262, 129513. doi:10.1016/j.ijbiomac.2024.129513
Wang, L., Fan, L., Filppula, A. M., Wang, Y., Bian, F., Shang, L., et al. (2025). Dual physiological responsive structural color hydrogel particles for wound repair. Bioact. Mater. 46, 494–502. doi:10.1016/j.bioactmat.2025.01.002
Willenborg, S., Lucas, T., Van Loo, G., Knipper, J. A., Krieg, T., Haase, I., et al. (2012). CCR2 recruits an inflammatory macrophage subpopulation critical for angiogenesis in tissue repair. Blood 120, 613–625. doi:10.1182/blood-2012-01-403386
Wolkersdorfer, A. M., Jugovic, I., Scheller, L., Gutmann, M., Hahn, L., Diessner, J., et al. (2024). PEGylation of human vascular endothelial growth factor. ACS Biomater. Sci. Eng. 10, 149–155. doi:10.1021/acsbiomaterials.3c00253
Xie, X., Lei, H., and Fan, D. (2023). Antibacterial hydrogel with pH-responsive microcarriers of slow-release VEGF for bacterial infected wounds repair. J. Mater. Sci. & Technol. 144, 198–212. doi:10.1016/j.jmst.2022.09.062
Xu, Q., A, S., Gao, Y., Guo, L., Creagh-Flynn, J., Zhou, D., et al. (2018). A hybrid injectable hydrogel from hyperbranched PEG macromer as a stem cell delivery and retention platform for diabetic wound healing. Acta Biomater. 75, 63–74. doi:10.1016/j.actbio.2018.05.039
Yang, C., Xue, R., Zhang, Q., Yang, S., Liu, P., Chen, L., et al. (2017). Nanoclay cross-linked semi-IPN silk sericin/poly(NIPAm/LMSH) nanocomposite hydrogel: an outstanding antibacterial wound dressing. Mater Sci. Eng. C Mater Biol. Appl. 81, 303–313. doi:10.1016/j.msec.2017.08.008
Yang, X., Guo, J. L., Han, J., Si, R. J., Liu, P. P., Zhang, Z. R., et al. (2020). Chitosan hydrogel encapsulated with LL-37 peptide promotes deep tissue injury healing in a mouse model. Mil. Med. Res. 7, 20. doi:10.1186/s40779-020-00249-5
Yang, J., Wang, Z., Liang, X., Wang, W., and Wang, S. (2024). Multifunctional polypeptide-based hydrogel bio-adhesives with pro-healing activities and their working principles. Adv. Colloid Interface Sci. 327, 103155. doi:10.1016/j.cis.2024.103155
Yu, B., Kong, D., Cheng, C., Xiang, D., Cao, L., Liu, Y., et al. (2022). Assembly and recognition of keratins: a structural perspective. Semin. Cell Dev. Biol. 128, 80–89. doi:10.1016/j.semcdb.2021.09.018
Zhang, L., Luo, B., An, Z., Zheng, P., Liu, Y., Zhao, H., et al. (2023). MMP-responsive nanoparticle-loaded, injectable, adhesive, self-healing hydrogel wound dressing based on dynamic covalent bonds. Biomacromolecules 24, 5769–5779. doi:10.1021/acs.biomac.3c00773
Zhang, Y., Lin, S., Xu, X., Yao, Y., Feng, S., Jiang, S., et al. (2025). Programmable hierarchical hydrogel dressing for sequential release of growth factor and DNase to accelerate diabetic wound healing. J. Control. Release 383, 113825. doi:10.1016/j.jconrel.2025.113825
Zhou, Y., Li, H., Liu, J., Xu, Y., Wang, Y., Ren, H., et al. (2019). Acetate chitosan with CaCO3 doping form tough hydrogel for hemostasis and wound healing. Polym. Adv. Technol. 30, 143–152. doi:10.1002/pat.4452
Zhou, L., Xing, Y., Ou, Y., Ding, J., Han, Y., Lin, D., et al. (2023). Prolonged release of an antimicrobial peptide GL13K-loaded thermosensitive hydrogel on a titanium surface improves its antibacterial and anti-inflammatory properties. RSC Adv. 13, 23308–23319. doi:10.1039/d3ra03414c
Zhu, Y., Hoshi, R., Chen, S., Yi, J., Duan, C., Galiano, R. D., et al. (2016). Sustained release of stromal cell derived factor-1 from an antioxidant thermoresponsive hydrogel enhances dermal wound healing in diabetes. J. Control Release 238, 114–122. doi:10.1016/j.jconrel.2016.07.043
Keywords: functionalized peptide hydrogels, dynamic regulation, multistage targeting, tissue regeneration, wound healing
Citation: Ma X-K, Peng Q, Miao G-H and Zhang X-Z (2025) Functionalized peptide hydrogels: enabling dynamic stage-adaptive modulation for wound healing. Front. Cell Dev. Biol. 13:1710175. doi: 10.3389/fcell.2025.1710175
Received: 21 September 2025; Accepted: 22 October 2025;
Published: 12 November 2025.
Edited by:
Bo Zhang, University of California, Los Angeles, United StatesReviewed by:
Yingze Zhang, Nankai University, ChinaCopyright © 2025 Ma, Peng, Miao and Zhang. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Xiu-Zhen Zhang, MTIwNjkwOTg1NUBxcS5jb20=
†These authors have contributed equally to this work