Your new experience awaits. Try the new design now and help us make it even better

HYPOTHESIS AND THEORY article

Front. Endocrinol., 22 August 2025

Sec. Experimental Endocrinology

Volume 16 - 2025 | https://doi.org/10.3389/fendo.2025.1633449

This article is part of the Research TopicFunction of hormones, their receptors and binding proteinsView all 12 articles

The use of intuitive AF-based modelling for the understanding of activation and signalling through insulin-like receptors

  • 1York Structural Biology Laboratory, Department of Chemistry, University of York, Heslington, York, United Kingdom
  • 2de Duve Institute, Faculté de Pharmacie et des Sciences Biomédicales, Université Catholique de Louvain, Brussels, Belgium

The understanding of the conformational events occurring through the Insulin-like Receptors (ILRs) upon binding of their cognate hormones is very advanced, thanks to multidisciplinary efforts and breakthroughs, from molecular/cell biology to structural studies. However, the full length structures of this class of Tyrosine Kinase (TK) receptors are still not available. This is due to fundamental methodological constraints: a need for lipid micelles or nanodiscs required for the stabilisation of the full-length single receptor molecule. They tend to occlude the transmembrane (TM) and intra-cellular parts of the receptors, which, together with their inherent dynamic characters, prohibits - so far - determination of their full, continuous structures. Nevertheless, there is plenty of crystallographic evidences about separate TKs, some also with parts of the Juxtamembrane (JM) region that links the TM helices with the TKs. There are well over 40 known structures of the ectodomains (ECDs) of the ILRs in different complexes with hormones and their analogues, representing a wide spectrum of conformations. However, there is still a remaining question how a particular stage of ECD:hormone binding is translated into activation of the TKs. Here, we attempt to fill this ECD - TM-JM-TK structural gap by employing a simple AlphaFold2-based modelling of these regions, and combining AF2-derived models with the already determined ECD structures. This allows us to propose here a general ILRs activation model where the JM-TK close contacts with the inner leaf of the cell membrane contribute to the activation of the receptors. A possible dual role of the JM region in this process – both TK auto-inhibitory and stabilizing - has been highlighted as well. It also seems that the diverse natures of receptors:membrane lipid interactions require more experimental attention for the full understanding of the signal transduction through Insulin-like Receptors.

Introduction

The Insulin Receptor-like (IRL) family of Tyrosine Kinase receptors (TKRs) governs some of the key hormonal signalling with pleiotropic control of metabolism, growth and life span (13). All these receptors share very similar (αβ)2 subunits, domains and general 3-D structures organisation, comprising of the ectodomain (ECD), transmembrane (TM) and juxta-membrane (JM) regions, leading to tyrosine kinase (TK) which ends with C-terminal tails (Figure 1A) (for reviews see (4, 5)). In humans, IRLs include two isoforms of Insulin Receptor (hIR-A, hIR-B (with additional 12 amino acids insert at the ends of the α-subunits)) (6) and Insulin-Like Growth Factor Receptor 1 (IGF-1R). Recent structure of insect Drosophila melanogaster IR (dmIR) ECD in complex with DILP5 - one of this insect’s seven insulin-like hormones - revealed its remarkable similar blueprint to human homologous complexes (Figure 1B, PDB ID 8CLS) (7). These findings suggest that a general conservation of the IR-like template can be expected in other invertebrates as well, underpinning the molecular and structural bases of a remarkable conservation of the insulin signalling axis in the animal kingdom.

Figure 1
Schematic diagrams of human and Drosophila insulin receptors (top) show structural domains labeled L1, CR, L2, FnIII, ID, TM, JM, TK, and CTD, with numerical values indicating region lengths. The bottom part shows representations of these domains as interacting structures with color-coded circles, labeled by PDB codes 6HN5, 7PG4, 7STK, 7STJ, 7PG0, 8CLS, 7STH, and 6PXV on an orange line.

Figure 1. General organisation of the subunits of human Insulin Receptor (hIR), IGF-1R and Drosophila melanogaster Insulin Receptor (dmIR) (A), and examples of structural conformers of Insulin-Like Receptors and hormone:receptor stoichiometries (B, A) Subunit organisation of the hIR/hIGF-1R (top) and dmIR (bottom) receptors. Hormone Site 1 binding domains (L1 and α−CT terminal helix of the IDα) are highlighted in magenta; main Site 2 binding FnIII-1 domain in yellow. Red arrow indicates processing of the 368 amino acids CTD C-terminal dmIR unique; dmIR N-terminal ‘0’ domain is indicated, but its role is unclear, and it has not been included in any dmIR structural work. Dash lines represent -SS- bridges, and numbers correspond to sequence identities between hIR and dmIR. See main text for the abbreviations. (B) Schematic representations of examples of the known structures of receptors ectodomains (ECD) indicating a variety of hormone:receptor stoichiometries; hormones at Site 1 are in magenta, at Site 2 in yellow and between these sites - in blue. PDB IDs of representative structures are given below yellow (membrane) line.

The last ~12 years brought a long-awaited first insight into the structures of human IRs and IGF-1R, firstly crystallographic (8), and, subsequently, by cryo-EM microscopy (9), followed by many of their apo- and holo-forms in complexes with endogenous hormones (insulin, IGF-1, IGF-2), as well as viral insulins, de-novo engineered functionally-active (insulin agonists/antagonists) peptides and monoclonal antibodies (reviewed (4, 5). They revealed a wide spectrum of hormone:receptor binding modes, stoichiometries of these complexes (Figure 1B), and the adaptability/dynamic character of their ECDs (Figure 1B).

The IR/IGF-1R structures point towards the likely key steps of the apo-holo transitions of these receptors, such as: (i) a large (~110 Å) separation of the receptors TKs in the inverted V: ᐱ-like form in hormone-free apo-IRLs that maintains their inactive states, (ii) hormone(s) binding to the receptors’ ECDs triggers their large structural rearrangements, closing the gap between the FnIII-1/2/3 domains of the ‘legs’ of the receptors, resulting in the proximity of the TKs and their activity-releasing trans cross-phosphorylation.

In one-insulin:hIR (and one-IGF-1:IGF-1R) complexes the hormones are bound to the upper arm of the hIR in T-like conformation (so-called high affinity site 1), while the other arm remains close to the stem of the receptor formed by FnIII-2/FnIII-3 domains (Figure 1B – e.g. PDB ID 6HN5/4) (e.g (1014). Such hormone binding mode is sufficient to bring together (~30-10 Å) the membrane-proximal FnIII-3/3’ domains, hence, possibly, translating these close contacts onto an ‘active’ engagements of the TMs, JM and TKs part of the IRs (() denotes corresponding sites in the other subunit)). On the opposite range of insulin:hIR complexes, four insulins saturate the almost symmetrical T-like conformer of the receptor by binding to both sites 1/1’, and to so called low affinity sites 2/2 that are located on the FnIII-1 (and parts of the FnIII-2 in dmIR) domains (Figure 1B – 6PXV) (15) (16). Structures of many other conformers of the complexes have been determined with two, three and four insulins in one receptor; they usually appear in often subtle variations of asymmetrical T and T -like conformations, with different occupancies of 1/1 and 2/2 sites, and, in some cases, with insulin ‘bridging’ the lower arm and the stem of the IR, not being fully engaged with either site 1 or site 2’ (Figure 1B – 7PG0) (17). Overall, site-1/site-2 binding modes correspond to a well-established two different receptor-binding epitopes on hormones’ surface (18). Interestingly, hIGF-1:IGF-1R complex has only been obtained with one IGF-1 bound, with the α−CT helix threading through the IGF-1 C-domain-forming loop that joins in this hormone equivalents of insulin’s B- and A-chains (11). The first invertebrate dmIR-ECD structure in complex with three insect DILP5 insulins also falls – in general – into the landscape of hIR/IGF-1R conformations, despite that two DILP5 hormones are sitting on the lower arm in close contacts neighbouring site-1 and site-2, while the third DILP5 occupies the classical site-1 on the T-like upper arm of the receptor (Figure 1B – PDB ID 8CLS) (7).

The intracellular TK components of the IRLs have also been studied extensively, resulting in many 3-D structures of their both inactive and active conformations (1925), allowing outlining a general catalytic and activation mechanisms of these kinases (2629). The TKs of the ILR receptors are very homologues, following also a very similar 3-D structural blueprint, with a typical protein-kinase fold, which is also greatly maintained in monomeric classes of the TK receptors (e.g., EGFR, Ron, c-Kit etc.) which dimerise upon hormone binding (30) (Figure 2). Both human hIR and hIGF-1R TKs have typical two domains - N- and C-terminal lobes – organisation (19, 22), with the C-lobe containing most of the active site residues and so-called activation loop. The activation of the ILR’s kinase involves trans-phosphorylation of three tyrosine side chains of the activation loop, and its flipping over, revealing the active, ATP- and substrate binding sites which are occluded by this loop in the kinase inactive state (28) (Figure 2). TK activation relies also on a significant closure of the N- and C-lobes, that results – among other structural changes – in the shift of so-called αC helix that places then catalytically important residues close to the ATP binding site. (Figure 2). Subsequently, three tyrosines in the C-terminal tails of the TKs, and two in the JM region can be phosphorylated for the recruitment of the key downstream signalling effectors (e.g., Insulin Receptor Substrate-1/2, Shc, SH2B1, SH2B2), or for the internalisation of the receptor (3133). It is also envisaged – mostly via biochemical evidences - that the kinase-proximal part of the JM region (still very elusive in structural studies) plays a TK auto-inhibitory role, maintaining ILR basal, quiescent state (3437); this was also confirmed in some apo-monomeric type receptors’ TKs, such as in the EGFR (3850). Structural studies of this mechanism in the hIR showed that JM Tyr972 – conserved in all ILRs in the animal kingdom – interacts in the TK apo state with also conserved residues of kinase’s N-lobe, stabilising the αC helix in a catalytically non-productive conformation (36) (Figure 2).

Figure 2
Molecular structure diagram showing protein conformations. Key elements include: N-lobe in blue with S962 and S969 labeled, C-lobe in yellow with K1283 labeled, and juxtaposition membrane (JM) helix in pink. The active conformation A-loop is highlighted in green, and inactive conformation in red. Key residues like Y1146 and Y1151 are identified.

Figure 2. Schematic representation of the inactive and active conformation of hIR tyrosine kinase. The apo TK inactive form (PDB ID 1IRK) (hIRTK-0P) is in white; the holo – active form - of the TK kinase (PDB ID 4XLV) (hIRTK-3P) N-lobe is in blue and C-lobe in yellow. The JM-including segment (962–984) of the holo hIRTK-3P is in dark blue, JM in apo hIRTK-0P (969–984) in pink, and non-hydrolyzable ATP analogue AMPPCP in hIRTK-3P as surface in light blue/white. The six visible residues of 18 amino acid peptide substrate derived from rat IRS-1 determined in the hIRTK-3P:peptide complex (PDB ID 1IR3) are shown as dark yellow surface. The inactive conformation of the activation loop (A loop) in hIRTK-0P is shown in red, with its active conformer in the hIRTK-3P:peptide complex in green. A-loop phosphorylated Tyr1146, 1150 and 1151 (as in 1IR3) are also shown. Stars correspond to position of Tyr972 in the apo (red) and holo (green) TK forms. Please note that TK constructs had mutations that could affect the conformation of the JM/N-terminal parts of these TKs: Cys969Ser, Tyr972Phe (1IRK, 1IR3) and Cys969Ser, Tyr952Phe (4XLV).

Insect Drosophila dmIR has a unique additional ~368 amino acids extension of each TK (with some homology to the IRS-1), which can be processed (cleaved off) in certain tissues (51)(Figure 1A); its role is still not fully known.

The exact mechanism of activation of the whole hIR/IGF-1R, and dmIR upon hormone binding has not been clearly visualised, but structural and functional data point towards the trans-phosphorylation of their TKs being brought together upon transition from apo-to-holo states of the receptors. It seems that the TKs trans-phosphorylation of ILRs follows, to some extent, a symmetrical pattern, which is in contrast to some monomeric TK-receptors, e.g., EGFR, in which ligand-induced dimer only one kinase is active upon cis-phosphorylation, being allosterically stabilised by TK from the associated receptor subunit (aka CDK: CD-like functioning) (52).

Despite recent astonishing progress and breakthroughs in the structural/functional characterisation of ILRs, the insight into the actual structural path of signal transduction through these receptors is still rather binary, with separate focuses on the roles of ECDs and TKs in this process. This extra-/intra-cellular division of our understanding of the IRL receptors results mainly from current methodological constraints. The studies of ECD-to-TK signal transduction are hampered by the occlusion of the transmembrane, JM and TK regions by lipids necessary for the extraction and stabilisation of the whole ILRs, as well as due to an inherent dynamic character of these downstream components of the receptors (16, 53).

Such methodological challenges lead to alternative views about the nature of the ‘native’, transmembrane signal-inducing ILR ECD conformer (e.g (17, 54). However, it can be envisaged, that considering the low pM concentrations of circulating insulin (going potentially towards nM range after meals), one-insulin:IR asymmetric complex should suffice to activate the whole receptor. It may emerge in this state via a transient low-affinity site 2 complex which initiate destabilisation the apo - ᐱ-like (or dynamically similar) – IR conformer (5). However, this single-hormone bound receptor model supports well IGF-1:IGF-1R as the main signalling conformer, but it does not fully explain the overall sub-nM (~0.02 nM) high hIR affinity of insulin, not covering quite the interactions of low affinity (~0.2 nM – 2μM (hIR construct dependent)) sites 2 on insulin surface and the hIR (17, 55) Structures of two-insulins:IR complexes can correspond to some transient states towards the final single-molecule assembly; although three/four-insulins:IR complexes are rather unlikely prevailing native forms of the hIR due to a limited physiological presence of the hormone, they cannot be excluded.

Therefore, prompted by the still existing structural gap between ILRs’ ECDs and their TKs we attempted to probe whether the use of AlphaFold2 (AF2) (56) can provide more structural and functional insights into bridging the knowledge about the ECDs and TKs of these receptors, by shedding some light on possible 3-D arrangements of the TM, JM and TKs modules, in the context of different, known structures of Insulin:IR (and IGF-1:IGF-R) complexes. NMR structure of IR TM helices in lipid micelle is available (57), and the longest known structure of the JM segment was described in the IGF-1R apo-TK mutant (referred here as to IGFRTK-0P, PDB-ID: 1P4O) which starts at Pro948 (Pro958 in IR-A isoform of which numbering is used through this text) (58), while the whole hIGF-1R JM spans ~Asn934-Ile969 (app. ~Pro945-Ile984 in hIR-A, including first 12 linker regions in both receptors). However, the JM chain is stabilised in IGFRTK-0P by the crystallographic dimer interface between the kinase molecules. Similarly, the longest structurally-visible JM in the hIR – from Ser962 onwards - has been observed in the crystal structure of the holo-dimer of triple-phosphorylated TK (IRTK-3P, PDB ID: 4XLV) (24). Hence, the known conformations of some parts of the JMs of IL receptor can be biased by crystal packing-related inter-molecular contacts.

Therefore we undertook a simple exploratory modelling exercise where we employed the AlphaFold2 (56) to predict the structures of FnIII-3-TM-JM-TK parts of the hIR, hIGF-1R and dmIR, superposing subsequently the AF2-derived FnIII-3 domains of the FnIII-3-TM-JM-TK segment on their counterparts in the experimentally determined representative ECD conformers of these receptors (Figure 3 – see details in the following chapter). We expected that the relevance of these FnIII-3-TM-JM-TK AF2-derived models can be enhanced by excellent, known 3-D templates for the flanking FnIII-3 and TK domains, for which AF2-generated folds obtained here should be very accurate, and ‘native’-like. Although AF2 predictions discussed here lacks 100% reproducibility, i.e., their repetitions always result in an overall slightly different relative spatial distribution of FnIII-3-TM-JM-TK domains, the key motifs of these models (e.g., JM engagement with the TK discussed below) are still present, and are – overall – consistently repetitive.

Figure 3
Diagram illustrating the AF2 (AlphaFold 2) modeling process. Steps A-F show the protein structure prediction sequence, focusing on elements like the extracellular domain (ECD), transmembrane (TM) segments, and juxtamembrane (JM) regions. Arrows indicate the flow of the modeling process, with labels for elements like F1, F2, F3, and TK. The diagram highlights amino acid sequence input, TM alignment, JM positioning, and structure fitting.

Figure 3. Schematic representation of the main (A-F) stages of the performed AF2 modelling exercise. Known 3-D structures of the parts of the ILRs are indicated by green tick (scheme of only one representative example of hIR is used here (e.g., PDB ID: 6HN5/6HN4)). Question marks indicate limited available structural definition of the TM and JM regions; m1 – model 1 (denotes an example of one of the top five models selected here). F1, F2 and F3 are simplified notations of the respective FnIII-1, 2, 3 domains, and the ID segments were omitted for the clarity of the scheme. See main text for details.

The key questions we tried to address here were as follows: (a) whether the AF2 can help to correlate the orientations of the FnIII-3/3’ domains observed in the structures of different IR and IGF-1R complexes with the orientations of the downstream TM-JM-TK parts of the receptors, (b) whether the AF2-driven FnIII-3-TM-JM-TK modelling, and the fusion of these models with the experimental receptors’ ECDs structures, is capable of revealing any new - potentially in vivo significant - types of interactions in the TM-JM-TK regions, especially of the ‘elusive’ JM domains, and (c) whether the full length IR and IGF-1R conformers observed in combined true-ECD-structures+AF2-models can shed any light on the receptor activation process, i.e., signal transduction through these receptors, which still awaits unambiguous, experimental structural elucidation.

AF2 modelling exercise

The models of the FnIII-3-TM-JM-TK segments of hIR, hIGF-1R and dmIR were obtained by the AF2 programme in the CCP4 Cloud (59) for the following IRL amino acid sequences: hIR - Val801-Ser1343, hIGF-1R – Val791-Cys1337, dmIR – Tyr1191-Gln1828. The TK-following dmIR-unique C-terminal Domain (CD domain) (Figure 1A) was not included here as (a) it was clear after initial trials that the AF2 was not able to predict its relevant structure (as expected: no known-template for CD sequence in the databases), and (b) its occurrence is limited exclusively to dmIR. The flow of the whole modelling process in outlined schematically in Figure 3. Firstly, the representative ECD structures of the ILR-family, with different hormone:receptor stoichiometries and variety of conformers (from one arm up/one fully down to almost symmetrical T-state ones) (Figure 1B) were selected (Figure 3– stage A. Next, the abovementioned sequences of the receptors’ FnIII-3-TM-JM-TK regions were submitted for the prediction of their structures to the AF2 programme (Figure 3 – stage B). AF2 produced several models for each FnIII-3-TM-JM-TK sequence, and top five for each receptor (m1-m5) were used for further analysis (Figure 3– stage C). Subsequently, the FnIII-3 domains of the AF2 models m1-m5 were superposed on their corresponding FnIII-3 and FnIII-3 equivalents in each representative receptor ECD in programme COOT LSQ option, on their Cα atoms (60) (Figure 3– stage D). The Cα target atom ranges for these superpositions was Asp813-Val905 for the hIR, except for 6HN5/6HN4 structure (10) with a different numbering where models Ala811-Thr906 were superposed on 6HN4/5 Ala792-Thr887, while for the dmIR this FnIII-3 Cα target atom range span Asp1209-Val1302 for both models and the dmIR. For the mIGF-1R:hIGF-1 structure (PDB ID 6PYH) (14) the Cα range for the FnIII-3 domains was Gly800-Phe893 that were superposed with models Gly801-Phe892; this was due to differences between the structure and model sequences here (6PYH is a highly homologous mice IGF-1R (mIGF-1R) (96% seq. identity with the hIR) complexed with hIGF-1).

Subsequently, after these superpositions, the redundant/duplicated now pairs of models’ FnIII-3/FnIII-3’ domains were deleted in COOT (Figure 3– stage D), yielding a ILR’s full-length ‘hybrid’ model, comprising of an experimentally-known ECD structure of a particular receptor that was followed by the AF2-modelled TM-JM-TK (Figure 3– stage E). Finally, these full-length IRLs models were manually placed (translate/rotate option in COOT) in a phosphocholine lipids bilayer: one of the typical models of human cell membrane - derived from the NMR structure of the hEGFR TM helices determined in these lipids (PDB ID 2M20). Lipids DMPC-to-DHPC ratio of in the 2M20 was 1:0.25, where DMPC is 1,2-ditetradecanoyl-sn-glycero-3-phosphocholine, and DHPC - 1,2-dihexanoyl-sn-glycero-3-phosphocholine (61). Finally, some lipid molecules were deleted in COOT to accommodate TM segments. Analysis of the models have been performed in COOT, and the best models, i.e., without steric clashes, were finally analysed, and presented here in figures made by the CCP4MG programme (62).

It should be noted that the conformation/proximity of the Fn-III-3 domains, and, in general, overall conformations of the ILRs’ stems, hence the structure of the full receptors’ models presented here, could be affected by different tagging of the C-termini used for the expression and purification of a particular receptor construct. Here, the C-termini of the FnIII-3 domains were as follows: PDB ID 6HN5/6HN4 – hIRA ECD (1–916) ended with 33-residue GCN4 zipper sequence (RMKQLEDKVEELLSKNYHLENEVARLKKLVGER), and with Y144H, I421T, and Q465K mutation; Fv83–7 monoclonal antibodies were used for complex stabilization (10); 7PG4 – was a full-length hIRA with human protein C-tag (17); 7PG0 – the same as for 7PG4; 6PXV - full-length hIRA with endocytosis-preventing mutations Y960F, S962A, D1120N, R1333A, I1334A, L1335A, L1337A, untagged (Tsi3 and His8 tags were removed during purification) (16); 6PYH – Mus musculus IGF-1R (mIGF-1R), full-length with C-terminal truncation (1–1262), and Y951A, D1107N kinase internalization-preventing mutations (Tsi3 tags removed upon purification) (14); 8CLS – dmIR ECD (264-1309), C-terminal StrepII-tag (7). Nevertheless, despite the C-terminal differences in these constructs, their consistently recurring structural convergences, i.e., similar proximities of their FnIII-3 domains in their full-length, or ECD, liganded states, allow to assume a considerable physiological meaning of these conformations.

Results and discussion

Overall, the LSQs-derived rms for the corresponding structures with known-models of FnIII-3 and TK, were very low - in the range of ~0.8-0.9A - as the AF2 predictions of these domains were very accurate due to their many known 3-D templates/structures. The dmIR TK was also predicted with an excellent accuracy due to its very high homology with hIR and hIGF-1R TKs (~60% identity), and its similar AF-based model has already been analysed (25). The trans-membrane sequence peculiarity of the TM helices, together with some known NMR structures (57, 61), resulted in their typical helical models, as expected.

The AF2 predicted local difference test (pLDDT) scores (0-100, score >80 shows high confidence of the prediction) were low, usually below 50, for the TM, JM and TKs’ active loops regions, remaining well >80 for the remaining parts of the proteins. However, a fully truthful conformations of these ILRs’ regions was not really expected, but rather their possible 3-D arrangements in the context of well known, hence reliably predicted, flanking FnIII-3 and TK domains.

The most anticipated predictions here were the putative folds of the JM regions, especially in the context of their neighbouring TM and TK domains, as their available 3-D definitions are very limited. As mentioned above, the JM hIR region is structurally best defined in hIRTK-3P crystal structure (PDB ID 4XLV) (24) – from Ser962 onwards (IR-A notation), but it points away from the TK’s core, being trapped in crystal-symmetry JM-JM contacts from the other TK, and is also wedged there between the β-sheet and alpha-helix (αC) surface of the second TK molecule (residues 944–961 are disordered/invisible there). This JM conformation is also stabilised there by the interaction of its N-terminal part with the third TK crystal-symmetry related molecule. The JM region from Val966 is also visible in the crystal structure of the inactive hIR TK (PDB ID 1P14) (36), where the Val966-Glu976 JM chain – in contrast to hIR TK-3P (PDB ID 4XLV) structure (24) - runs close to the core of the TK. This work also provides an evidence for the auto-inhibitory role of Tyr972 which interacts there with several conserved residues of the TK’s N-terminal lobe, stabilising a catalytically nonproductive position of the αC helix. The best 3-D evidence for the conformation of the hIGF-1R Pro948-Tyr957 JM segment is in the apo-form of this TK, but it is an important part of the TK-dimer inter-molecular interface (58). It’s worth noting that the JM segment is shorter in the IGF-1R TK, missing the equivalent of Val966-Cys969 peptide present in the IR-A were unpaired Cys969 is frequently mutated in structural studies to avoid protein non-specific aggregating.

Here, the top five FnIII-3-TM-JM-TK models for each AF folding exercise were analysed for packing against the lipid cell membrane model, and potential clashes with kinase counterparts from another subunit of the receptor. Models with the TKs domains too much embedded into the membrane due to a very ‘parallel’ run of their TMs along the lipid bilayer, or where TKs were significantly overlapping, were discarded.

Interestingly, the activation loop was predicted in both active and inactive conformation for the dmIR TK, while it was always in the active conformation in hIGF-1R TK models, and an inactive one in the hIR models.

Also, our attempts to predict the FnIII-3-TM-JM-TK dimers in the next generation AF3 programme (63) were unsuccessful, not yielding any sensible structures. Even more surprisingly, similar AF3 attempts to generate TK dimers (i.e., TKs without any other domains) also failed, despite many excellent structural templates.

The AF2 predicted folds of the JM region

The first, striking correlation of the conformations of the JM regions was their trend to run - practically immediately after the TM helix - in the groove between N- and C-lobes of the TKs, and close to the surface of the kinase (Figure 4). The JMs chains were either very extended (dmIR, hIR) or more compact (hIGF-1R), with their C-terminal/distal parts wrapped around the N-lobe of the TK – as observed in some crystal structures. Interestingly, the in-groove JM conformation was observed for both the active and inactive position of the activation loop. This suggests that the already postulated autoinhibitory role of the JM (e.g (36, 37) could also be expanded to its opposite functionality, involving stabilisation of the activation loop in its flipped, active conformation. Hence, the JM region may possess double, Janus-like properties: it may function as an auto-TK-inhibitory element (already well documented (see above)), or, following receptor activation, it may contribute to the maintenance of TKs activity, thereby supporting prolonged downstream signalling.

Figure 4
Molecular models showing activation loops of insulin receptor and IGF-1 receptor proteins in two states. The top row displays inactive (red) conformations with dmIR(1), hIR(2), and hIGF-1R(1). The bottom row shows active (green) conformations with dmIR(2), hIR(4), and hIGF-1R(2). Yellow highlights key molecular structures, and pink spirals represent transmembrane regions. Green check marks indicate active conformations.

Figure 4. AF models of the TM-JM-TK domains of the dmIR, hIR and hIGF-1R. TKs’ N- and C-lobes are in white and grey spheres, respectively; TM helices are in pink and the JM regions in yellow. The TKs’ activation loop (main chain only) in the inactive conformation is in red, and in its active conformation in green (also indicated by a green tick). In brackets – the number of one of the top five models used here.

We refrain here from discussing structural details, e.g., hydrogen bonds and other JM-TK interactions, as this may be an over-interpretation of the AF2 models. However, JM important Tyr953/965 (IRA/IRB notation), Tyr960/972 and Tyr972/984 are generally involved in contacts similar to those described elsewhere (36, 37). Interestingly, the NMR and functional studies of the Tyr953-Tyr960 octapeptide from the hIR JM region suggested its β-hairpin-like conformation and IR-internalisation signalling role (64); indeed, such β-hairpin was observed in some hIR AF2 JM models (especially model 1), providing some additional retro-experimental validation of the models discussed here and their likelihood.

The relation of the experimentally-observed FnIII-3/3’ conformations to the 3-D organisation of the downstream TM-JM-TK modules

The analysis of this aspect of our modelling was performed for selected, representative variety of full-length AF-derived hybrid hIR/mIGF-1R models, embedded manually in the widely used model of the lipid bilayer (61) (PDB ID 2M20). Several observations can be outlined here. (i) Placements of the IRLs’ full-length hybrid models into the model of human cell membrane indicate a possibility of very close contacts of the JM-TK with the inner leaf of the lipid bilayer (Figure 5). (ii) The respective conformations of the FnIII-3/3’ (i.e., the nature of their relative orientation and proximity) - at the membrane-proximal regions of the experimentally determined 3-D structures of the ILRs’ ECDs - do not show here any clear correlation with the ligand:receptor stoichiometry, and the wide dynamic ranges of the lower/upper arms of the receptors (Figure 6). (iii) Predicted TM helices are not clustering in one, closely intertwined-like pairs, but show many orientations, some relatively straight through the membrane – some being more parallel to the lipid bilayer. It must be stressed, however, that the variety of TM pairings obtained here should be treated with caution, as they can result from the lack of an external biochemical constraints (i.e., lipid bilayer) during the AF2 modelling process. One of the other reasons of their wide conformational heterogeneity – and probably more physiologically relevant - can be the presence of conserved proline residues at the C-terminal end of the FnIII-3/3’ domains. It is present at these ends of the stems of the receptors in practically all ILRs, making a very specific and narrow point of ECD:membrane contact that is both conformationally robust due its strong ring structure, but simultaneously capable of isomerisation and occupying rather narrow, but very different regions of the Ramachandran plot.

Figure 5
Illustration of a molecular structure with labeled parts: F3, F3', TM, TM', TK, and TK'. The central region features a green gradient, indicating a transmembrane segment, while peripheral areas are in black, white, yellow, pink, and blue, showing different protein domains. The image includes rotational views at 90 degrees, highlighting structural conformation.

Figure 5. Zoom-in on membrane:FnIII-3-TM-JM-TK surface. The hIR(ECD):one insulin complex (PDB ID 6HN5/6HN4) and AF2 model 2 (centre top) was selected as a typical example of JM-TM:membrane proximity that is typical for all other complexes studied here (see Figure 6). F3 – FnIII-3 domain, TM – trans-membrane domain, TK – tyrosine kinase domains. The first, so-called linker, 957–956 residues of the JM region are in blue, the remaining 957–984 JM region is in magenta. Membrane bi-layer model structure (PDB ID 2M20) surface representation is in green (alkyl chains) are in red (polar atoms).

Figure 6
Three panels display structural models of receptors hIR, mIR, hIGF-1R, and dmlR, with each receptor depicted from two perspectives: a frontal view and a rotated side view. The receptors are composed of clusters in gray, yellow, and red, spanning a green lipid bilayer. Each model is annotated with identifiers like 6HN5, 7PG4, and more. Arrows indicate the rotational perspective shift by ninety degrees.

Figure 6. Examples of representative whole Insulin-Like receptors models: experimental ECDs combined with AF2-derived models. Each panel presents the same receptor (in spheres) with its PDB ID and the number (in brackets) of the two best AF2 models used for the two, representative whole ILR assemblies for each particular receptor. The upper T-like arm/subunit is in white, the flexible lower arm is in yellow, hormones in red. Lipid bilayer is in ball-stick representation. Green ticks are next to the TKs where the active loop has been predicted in the active conformation (see Figure 4). A simple graphical representation of the hormone:receptor stoichiometry is given as a black stick/ball scheme.

The IR/IGF-1R drag and friction activation model

The AF modelling-based observations highlighted here tempted us to propose a very general IR/IGF-1R activation model which combines experimental structural evidences with the AF2 models (Figure 7). This ILRs activation model assumes following steps of this process. (i) Ligand binding to the apo-receptors is causing conformational changes in their ECDs leading to bringing together their FnIII-1-3/FnIII-1-3 subunits. (ii) The FnIII-3/3 terminal proline residues are pivots of this movement; while facilitating a conformational stability (i.e., low protein:lipid friction point) for the FnIII-3/3:outer-membrane leaf contact site, they are also able to isomerise/flip into other typical proline stereochemical region if necessary. These proline’s properties (frequently used in proteins’ structural mechano-sensing switches (e.g (65, 66)) can enable quite fast, but controlled (e.g., by lowering random flexibility of the site) getting-together movements of these parts of the receptors. (iii) In contrast, close contacts of the JM/TK domains with the inner leaf of the cell membrane (Figures 5, 6) can result in a substantial molecular protein:membrane friction on this intra-cellular receptor:membrane interface, which, subsequently, is slowing down the dragging of the TKs and their gap-closing movement. (iv) This molecular friction, and the difference in dragging forces between outer-intra-cellular parts of the receptors at their membrane interface, can lead to the unzipping of the JM protein chain from its in-TK-grove, their activation-loop blocking conformation, allowing subsequently flipping of these loops that may be synchronised with their trans-phosphorylation in final TK-dimeric-like receptor activation stage (Figure 7). The discrepancies between outer-inner membrane leafs dragging forces can be amplified further by their chemical heterogeneity, with the inner leaf being usually a denser one (6773). The postulated correlation between Type 2 Diabetes (T2D) and some ‘degeneration’ of cell membrane (e.g., its increasing denser/rigid character) (7476) can also be – to some extent – highlighted by this model. The disturbance (e.g., decrease in T2D) of the JM/TK:membrane ‘friction potential’ can contribute to a lower efficiency of activation of the TKs. Interestingly, conformations of the JM chains in the DFA model can be relatively similar (i.e., in-between TKs’ lobes) in both apo- and holo-forms of the receptors, giving the JM polypeptide chains a Janus-like function in receptor activation.

Figure 7
Diagram illustrating the activation of an insulin-like receptor. It shows three stages: apo-ILR, hormone binding, and activation. Components such as L1, L2, F1, F2, F3, CR, and αCT are labeled. A hormone binds to the receptor, triggering fast and slow activation pathways indicated by arrows, leading to changes in the transmembrane domain and intracellular TK regions.

Figure 7. Schematic representation of the drag-friction activation model. The likely dynamic character of the apo-ILR is depicted with a range of conformers of the L1-CR-L2 arms of the receptors in lighter colours. The activation loops are given as triangles with ‘i’ and ‘a’ indicating their inactive or active conformations, respectively. The dynamic character of these loops upon activation (central panel) is indicated by dashed contours; circled P symbolises phosphorylated states of these loops in their active conformations. The JMs regions are in red, and their unzipping from the TK’s groves between N-/C-lobes upon activation of the TKs are given as staggered red triangles in the middle panel/conformer. FnIII-3 (F3) C-terminal Proline ‘pivot’ on the membrane interface is depicted as a bright yellow circle. The hormone in magenta and blue reflect the postulated migration of the hormone from site 2 (blue) to final site 1 (magenta). Two types of yellow colours reflect the chemical and structural differences between the inner and outer leaves of cell membrane.

It should be noted that the proposed DFA activation model – for the sake of its simplicity and a very general character – is based on one, identical FnIII-3-TM-JM-TK structural AF2 model which is then being fitted onto FnIII-3 and FnIII-F3’ receptor’s ECD domains. Hence both β-subunits’ TM-JM-TK parts of a full-length receptor model - downstream from its FnIII-3/3’ domains - are structurally identical. Certainly, different combinations of models, e.g., model 1 and model 2, could be fitted onto FnIII-3/3’ domains respectively; this would lead though to plethora of permutations of not very informative IRLs models, generating unnecessary at this stage, and too speculative, complexity of the overall system. However, it can be envisaged that in cases of the asymmetrical, e.g., one/two hormone:receptor complexes, with different upper/lower arm conformations, the movement of each FnIII-3 and FnIII-3’ domain, and associated TM helices, along the membrane can occur at different rates/speeds for each FnIII-3-TM and FnIII-3’-TM’ group. This, in turn may have varying effects on the ‘unzipping’ of the JMs from the TKs, leading – importantly - to differential, and spatial-temporally diverse kinase activation. For example, this could result in a transient, ‘touch-and-go’ trans-phosphorylation involving only a single TK, rather than a prolonged and symmetrical activation of both TKs.

It can also be assumed that a non-symmetrical TK activation, and, ultimately, the degree of the TK’s trans-phosphorylation, can be modulated and dictated by the receptor-binding properties of the ligand, i.e., its kon/koff rates. Such on/off rates dependence of functioning of the IRLs have already been proposed (77, 78), and the DFA model tries to provide here a most general mechanistic explanations of these phenomena.

Although the lack of AF3 success in generating FnIII-3-TM-JM-TK dimers was not surprising here, its failing to provide dimers of TKs alone is more puzzling. Does this mean that the TK dimers contacts/trans-phosphorylations are very transient (as mentioned above), or do they involve – still structurally unseen – more significant conformational changes in the TK upon receptor activation and their dimerization? Nevertheless, the simplicity of use, fast – minutes – runs of the AF programmes, and, most importantly, their very dynamic development allow to hope for some answers here in the foreseeable future.

Finally, the importance of the heterogenic ‘dragging potential’ proposed here in the DFA model (i.e., speedy for the ECD stems – slow for the intracellular JM-TK) can be amplified further by the very likely intracellular interaction of C-terminal tails of the receptors (and CD domains in the dmIR) with the membrane-underpinning cytoskeleton, different lipids composition, density and fluidity of the membrane and membrane micro-structures (e.g., with or without caveolin) (79, 80), IR-clustering membrane dynamic condensates (81), changes in activities of membrane-lipids sorting flippases (82, 83), and many other physiological processes affecting chemistry and structure of cell membranes.

Summary

The DFA model outlined here is a very simple attempt to unify structural and biochemical evidences reported for ILRs ectodomains and their intracellular components. Its general character is striving to maintain a holistic approach to the knowledge about the components of the receptors, combining all their elements needed for an effective signal transduction. It cannot/does not pretend to be a final view of signal transduction through the ILRs, but it aims to provoke alternative thinking about this process, highlighting some of its aspects that – so far - eluded unambiguous experimental approaches.

Firstly, the DFA model underlines the importance of the already well postulated JMs domains inhibitory effect on the TKs (3537), especially extensively investigated and evident in EGFR and other classes of the TK receptors (e.g., the EGFR’s JM is even partially helical being in very close interactions with the cell membrane) (47, 48), (8486) (87). However, the DAF model expands the JMs’ auto-inhibitory role onto their possible stabilisation of the activated forms of the TKs’ active loops, thus giving the JMs’ dual and opposite functionalities in the activation process of the receptors.

Secondly, the DFA model highlights the likelihood of a very intimate character of the JM/TK interaction with cell membrane: possibly an important feature of receptors’ activation process that relies on the JM/TK:membrane-inner-leaf ‘friction’, hence taming the intracellular movement of the TKs in response to hormone binding in order to allow unzipping of the JMs from their in-TK-groove auto-inhibitory conformation. Different qualitative roles of the protein:protein and protein:lipid interactions for the EGFR-like receptors have already been highlighted (88).

Surprisingly, the DFA model translate molecularly very sophisticated, specific (atomic – ‘quantum-like”) receptors’ ECD:hormone mechano-sensing interactions into activation of their TKs, and the initiation of a chemical signalling, by a very inter-molecularly “crude” (“Newtonian-like”) drag-and-friction forces. However, the distinctive properties of the hormone/analogue, and its interactions with the ILRs-ECDs sites 1/2, remain invariably crucial for the nature of the functionality of the hormone, and its downstream signalling signatures as they dictate the dynamics of TM/JM/TK movements. Interestingly, the emphasis of a possible importance of ‘simple’ mechanical forces as a part of ILRs activation parallels a growing recognition of such interactions, mechanical stress concentrations, and resulting feedback loops, being crucial for such diverse life’s phenomena like formation of embryo and organogenesis, to cancer (89, 90) and geometry of rose’s petals (91).

Finally, the DFA model emphasise the emerging role of the heterogeneity of cell membrane inner/outer leaves, their different chemical composition and structural micro-/macro-diversity in modulation of activation of Insulin-Like Receptors. It also underlines the necessity of more frontal – although methodologically most challenging – attack on the phenomena that occur on outer/inner membrane leaf:receptor interfaces, without understanding of which the insight into the signal transduction through ILRs may remain incomplete.

Data availability statement

The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.

Author contributions

AB: Conceptualization, Data curation, Formal analysis, Investigation, Methodology, Validation, Visualization, Writing – original draft, Writing – review & editing, Funding acquisition, Project administration, Supervision. TS: Investigation, Visualization, Writing – review & editing. OM: Investigation, Methodology, Writing – review & editing. PD: Writing – review & editing.

Funding

The author(s) declare that financial support was received for the research and/or publication of this article. AMB and TS were supported by BBSRC grant BB/W003783/1, and OM was supported by GG Dodson Fund provided by Novo Nordisk (Copenhagen).

Acknowledgments

This paper is dedicated to our co-author, the late Guy Pierre De Meyts, in recognition of his lifetime contribution to the study of insulin/IGF signalling: inspiring scientist, formidable friend and colleague.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Generative AI statement

The author(s) declare that no Generative AI was used in the creation of this manuscript.

Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

References

1. Ullrich A, Bell JR, Chen EY, Herrera R, Petruzzelli LM, Dull TJ, et al. Human insulin receptor and its relationship to the tyrosine kinase family of oncogenes. Nature. (1985) 313:756–61. doi: 10.1038/313756a0

PubMed Abstract | Crossref Full Text | Google Scholar

2. Ullrich A, Gray A, Tam AW, Yang-Feng T, Tsubokawa M, Collins C, et al. Insulin-like growth factor I receptor primary structure: comparison with insulin receptor suggests structural determinants that define functional specificity. EMBO J. (1986) 5:2503–12. doi: 10.1002/j.1460-2075.1986.tb04528.x

PubMed Abstract | Crossref Full Text | Google Scholar

3. Ullrich A and Schlessinger J. Signal transduction by receptors with tyrosine kinase activity. Cell. (1990) 61:203–12. doi: 10.1016/0092-8674(90)90801-k

PubMed Abstract | Crossref Full Text | Google Scholar

4. Forbes BE. The three-dimensional structure of insulin and its receptor. Vitam Horm. (2023) 123:151–85. doi: 10.1016/bs.vh.2022.12.001

PubMed Abstract | Crossref Full Text | Google Scholar

5. Choi E, Duan C, and Bai XC. Regulation and function of insulin and insulin-like growth factor receptor signalling. Nat Rev Mol Cell Biol. (2025) 26:558–80. doi: 10.1038/s41580-025-00826-3

PubMed Abstract | Crossref Full Text | Google Scholar

6. Kosaki A, Nelson J, and Webster NJ. Identification of intron and exon sequences involved in alternative splicing of insulin receptor pre-mRNA. J Biol Chem. (1998) 273:10331–7. doi: 10.1074/jbc.273.17.10331

PubMed Abstract | Crossref Full Text | Google Scholar

7. Viola CM, Frittmann O, Jenkins HT, Shafi T, De Meyts P, and Brzozowski AM. Structural conservation of insulin/IGF signalling axis at the insulin receptors level in Drosophila and humans. Nat Commun. (2023) 14:6271. doi: 10.1038/s41467-023-41862-x

PubMed Abstract | Crossref Full Text | Google Scholar

8. Menting JG, Whittaker J, Margetts MB, Whittaker LJ, Kong GK, Smith BJ, et al. How insulin engages its primary binding site on the insulin receptor. Nature. (2013) 493:241–5. doi: 10.1038/nature11781

PubMed Abstract | Crossref Full Text | Google Scholar

9. Scapin G, Dandey VP, Zhang Z, Prosise W, Hruza A, Kelly T, et al. Structure of the insulin receptor-insulin complex by single-particle cryo-EM analysis. Nature. (2018) 556:122–5. doi: 10.1038/nature26153

PubMed Abstract | Crossref Full Text | Google Scholar

10. Weis F, Menting JG, Margetts MB, Chan SJ, Xu Y, Tennagels N, et al. The signalling conformation of the insulin receptor ectodomain. Nat Commun. (2018) 9:4420. doi: 10.1038/s41467-018-06826-6

PubMed Abstract | Crossref Full Text | Google Scholar

11. Xu Y, Kong GK, Menting JG, Margetts MB, Delaine CA, Jenkin LM, et al. How ligand binds to the type 1 insulin-like growth factor receptor. Nat Commun. (2018) 9:821. doi: 10.1038/s41467-018-03219-7

PubMed Abstract | Crossref Full Text | Google Scholar

12. Xu Y, Margetts MB, Venugopal H, Menting JG, Kirk NS, Croll TI, et al. How insulin-like growth factor I binds to a hybrid insulin receptor type 1 insulin-like growth factor receptor. Structure. (2022) 30:1098–108 e6. doi: 10.1016/j.str.2022.05.007

PubMed Abstract | Crossref Full Text | Google Scholar

13. Xu Y, Kirk NS, Venugopal H, Margetts MB, Croll TI, Sandow JJ, et al. How IGF-II binds to the human type 1 insulin-like growth factor receptor. Structure. (2020) 28:786–98 e6. doi: 10.1016/j.str.2020.05.002

PubMed Abstract | Crossref Full Text | Google Scholar

14. Li J, Choi E, Yu H, and Bai XC. Structural basis of the activation of type 1 insulin-like growth factor receptor. Nat Commun. (2019) 10:4567. doi: 10.1038/s41467-019-12564-0

PubMed Abstract | Crossref Full Text | Google Scholar

15. Gutmann T, Schafer IB, Poojari C, Brankatschk B, Vattulainen I, Strauss M, et al. Cryo-EM structure of the complete and ligand-saturated insulin receptor ectodomain. J Cell Biol. (2020) 219. doi: 10.1083/jcb.201907210

PubMed Abstract | Crossref Full Text | Google Scholar

16. Uchikawa E, Choi E, Shang G, Yu H, and Bai XC. Activation mechanism of the insulin receptor revealed by cryo-EM structure of the fully liganded receptor-ligand complex. Elife. (2019) 8. doi: 10.7554/eLife.48630

PubMed Abstract | Crossref Full Text | Google Scholar

17. Nielsen J, Brandt J, Boesen T, Hummelshoj T, Slaaby R, Schluckebier G, et al. Structural investigations of full-length insulin receptor dynamics and signalling. J Mol Biol. (2022) 434:167458. doi: 10.1016/j.jmb.2022.167458

PubMed Abstract | Crossref Full Text | Google Scholar

18. De Meyts P. Insulin and its receptor: structure, function and evolution. BioEssays: News Rev molecular Cell Dev Biol. (2004) 26:1351–62. doi: 10.1002/bies.20151

PubMed Abstract | Crossref Full Text | Google Scholar

19. Hubbard SR, Wei L, Ellis L, and Hendrickson WA. Crystal structure of the tyrosine kinase domain of the human insulin receptor. Nature. (1994) 372:746–54. doi: 10.1093/emboj/16.18.5572

PubMed Abstract | Crossref Full Text | Google Scholar

20. Hubbard SR. Crystal structure of the activated insulin receptor tyrosine kinase in complex with peptide substrate and ATP analog. EMBO J. (1997) 16:5572–81. doi: 10.1093/emboj/16.18.5572

PubMed Abstract | Crossref Full Text | Google Scholar

21. Favelyukis S, Till JH, Hubbard SR, and Miller WT. Structure and autoregulation of the insulin-like growth factor 1 receptor kinase. Nat Struct Biol. (2001) 8:1058–63. doi: 10.1038/nsb721

PubMed Abstract | Crossref Full Text | Google Scholar

22. Pautsch A, Zoephel A, Ahorn H, Spevak W, Hauptmann R, and Nar H. Crystal structure of bisphosphorylated IGF-1 receptor kinase: insight into domain movements upon kinase activation. Structure. (2001) 9:955–65. doi: 10.1016/s0969-2126(01)00655-4

PubMed Abstract | Crossref Full Text | Google Scholar

23. Munshi S, Kornienko M, Hall DL, Reid JC, Waxman L, Stirdivant SM, et al. Crystal structure of the Apo, unactivated insulin-like growth factor-1 receptor kinase. Implication inhibitor specificity. J Biol Chem. (2002) 277:38797–802. doi: 10.1074/jbc.M205580200

PubMed Abstract | Crossref Full Text | Google Scholar

24. Cabail MZ, Li S, Lemmon E, Bowen ME, Hubbard SR, and Miller WT. The insulin and IGF1 receptor kinase domains are functional dimers in the activated state. Nat Commun. (2015) 6:6406. doi: 10.1038/ncomms7406

PubMed Abstract | Crossref Full Text | Google Scholar

25. Krishnan H, Ahmed S, Hubbard SR, and Miller WT. Biochemical characterization of the Drosophila insulin receptor kinase and longevity-associated mutants. FASEB J. (2024) 38:e23355. doi: 10.1096/fj.202301948R

PubMed Abstract | Crossref Full Text | Google Scholar

26. Hubbard SR and Till JH. Protein tyrosine kinase structure and function. Annu Rev Biochem. (2000) 69:373–98. doi: 10.1146/annurev.biochem.69.1.373

PubMed Abstract | Crossref Full Text | Google Scholar

27. Hubbard SR. Protein tyrosine kinases: autoregulation and small-molecule inhibition. Curr Opin Struct Biol. (2002) 12:735–41. doi: 10.1016/S0959-440X(02)00383-4

PubMed Abstract | Crossref Full Text | Google Scholar

28. Hubbard SR. The insulin receptor: both a prototypical and atypical receptor tyrosine kinase. Cold Spring Harb Perspect Biol. (2013) 5:a008946. doi: 10.1101/cshperspect.a008946

PubMed Abstract | Crossref Full Text | Google Scholar

29. Schlessinger J. Receptor tyrosine kinases: legacy of the first two decades. Cold Spring Harb Perspect Biol. (2014) 6. doi: 10.1101/cshperspect.a008912

PubMed Abstract | Crossref Full Text | Google Scholar

30. Rygiel KA and Elkins JM. Recent advances in the structural biology of tyrosine kinases. Curr Opin Struct Biol. (2023) 82:102665. doi: 10.1016/j.sbi.2023.102665

PubMed Abstract | Crossref Full Text | Google Scholar

31. Accili D, Deng Z, and Liu Q. Insulin resistance in type 2 diabetes mellitus. Nat Rev Endocrinology. (2025) 21:413–26. doi: 10.1038/s41574-025-01114-y

PubMed Abstract | Crossref Full Text | Google Scholar

32. Belfiore A, Malaguarnera R, Vella V, Lawrence MC, Sciacca L, Frasca F, et al. Insulin receptor isoforms in physiology and disease: an updated view. Endocrine Rev. (2017) 38:379–431. doi: 10.1210/er.2017-00073

PubMed Abstract | Crossref Full Text | Google Scholar

33. Khan MZ, Zugaza JL, and Torres Aleman I. The signalling landscape of insulin-like growth factor 1. J Biol Chem. (2025) 301:108047. doi: 10.1016/j.jbc.2024.108047

PubMed Abstract | Crossref Full Text | Google Scholar

34. Kohanski RA. Insulin receptor autophosphorylation. II. Determination of autophosphorylation sites by chemical sequence analysis and identification of the juxtamembrane sites. Biochemistry. (1993) 32:5773–80. doi: 10.1021/bi00073a008

PubMed Abstract | Crossref Full Text | Google Scholar

35. Cann AD, Bishop SM, Ablooglu AJ, and Kohanski RA. Partial activation of the insulin receptor kinase domain by juxtamembrane autophosphorylation. Biochemistry. (1998) 37:11289–300. doi: 10.1021/bi9809122

PubMed Abstract | Crossref Full Text | Google Scholar

36. Li S, Covino ND, Stein EG, Till JH, and Hubbard SR. Structural and biochemical evidence for an autoinhibitory role for tyrosine 984 in the juxtamembrane region of the insulin receptor. J Biol Chem. (2003) 278:26007–14. doi: 10.1074/jbc.M302425200

PubMed Abstract | Crossref Full Text | Google Scholar

37. Craddock BP, Cotter C, and Miller WT. Autoinhibition of the insulin-like growth factor I receptor by the juxtamembrane region. FEBS letters. (2007) 581:3235–40. doi: 10.1016/j.febslet.2007.06.014

PubMed Abstract | Crossref Full Text | Google Scholar

38. Wybenga-Groot LE, Baskin B, Ong SH, Tong J, Pawson T, and Sicheri F. Structural basis for autoinhibition of the Ephb2 receptor tyrosine kinase by the unphosphorylated juxtamembrane region. Cell. (2001) 106:745–57. doi: 10.1016/s0092-8674(01)00496-2

PubMed Abstract | Crossref Full Text | Google Scholar

39. Irusta PM, Luo Y, Bakht O, Lai CC, Smith SO, and DiMaio D. Definition of an inhibitory juxtamembrane WW-like domain in the platelet-derived growth factor beta receptor. J Biol Chem. (2002) 277:38627–34. doi: 10.1074/jbc.M204890200

PubMed Abstract | Crossref Full Text | Google Scholar

40. Till JH, Becerra M, Watty A, Lu Y, Ma Y, Neubert TA, et al. Crystal structure of the MuSK tyrosine kinase: insights into receptor autoregulation. Structure. (2002) 10:1187–96. doi: 10.1016/s0969-2126(02)00814-6

PubMed Abstract | Crossref Full Text | Google Scholar

41. Mol CD, Dougan DR, Schneider TR, Skene RJ, Kraus ML, Scheibe DN, et al. Structural basis for the autoinhibition and STI-571 inhibition of c-Kit tyrosine kinase. J Biol Chem. (2004) 279:31655–63. doi: 10.1074/jbc.M403319200

PubMed Abstract | Crossref Full Text | Google Scholar

42. Jura N, Endres NF, Engel K, Deindl S, Das R, Lamers MH, et al. Mechanism for activation of the EGF receptor catalytic domain by the juxtamembrane segment. Cell. (2009) 137:1293–307. doi: 10.1016/j.cell.2009.04.025

PubMed Abstract | Crossref Full Text | Google Scholar

43. Red Brewer M, Choi SH, Alvarado D, Moravcevic K, Pozzi A, Lemmon MA, et al. The juxtamembrane region of the EGF receptor functions as an activation domain. Mol Cell. (2009) 34:641–51. doi: 10.1016/j.molcel.2009.04.034

PubMed Abstract | Crossref Full Text | Google Scholar

44. Hubbard SR. The juxtamembrane region of EGFR takes centre stage. Cell. (2009) 137:1181–3. doi: 10.1016/j.cell.2009.06.008

PubMed Abstract | Crossref Full Text | Google Scholar

45. Oates J, King G, and Dixon AM. Strong oligomerization behaviour of PDGFbeta receptor transmembrane domain and its regulation by the juxtamembrane regions. Biochim Biophys Acta. (2010) 1798:605–15. doi: 10.1016/j.bbamem.2009.12.016

PubMed Abstract | Crossref Full Text | Google Scholar

46. Plaza-Menacho I, Barnouin K, Barry R, Borg A, Orme M, Chauhan R, et al. RET functions as a dual-specificity kinase that requires allosteric inputs from juxtamembrane elements. Cell Rep. (2016) 17:3319–32. doi: 10.1016/j.celrep.2016.11.061

PubMed Abstract | Crossref Full Text | Google Scholar

47. Arkhipov A, Shan Y, Das R, Endres NF, Eastwood MP, Wemmer DE, et al. Architecture and membrane interactions of the EGF receptor. Cell. (2013) 152:557–69. doi: 10.1016/j.cell.2012.12.030

PubMed Abstract | Crossref Full Text | Google Scholar

48. Sinclair JKL, Walker AS, Doerner AE, and Schepartz A. Mechanism of Allosteric Coupling into and through the Plasma Membrane by EGFR. Cell Chem Biol. (2018) 25:857–70 e7. doi: 10.1016/j.chembiol.2018.04.005

PubMed Abstract | Crossref Full Text | Google Scholar

49. Chakraborty MP, Das D, Mondal P, Kaul P, Bhattacharyya S, Kumar Das P, et al. Molecular basis of VEGFR1 autoinhibition at the plasma membrane. Nat Commun. (2024) 15:1346. doi: 10.1038/s41467-024-45499-2

PubMed Abstract | Crossref Full Text | Google Scholar

50. Estevam GO, Linossi EM, Macdonald CB, Espinoza CA, Michaud JM, Coyote-Maestas W, et al. Conserved regulatory motifs in the juxtamembrane domain and kinase N-lobe revealed through deep mutational scanning of the MET receptor tyrosine kinase domain. bioRxiv. (2024). doi: 10.7554/eLife.91619.2

Crossref Full Text | Google Scholar

51. Fernandez R, Tabarini D, Azpiazu N, Frasch M, and Schlessinger J. The Drosophila insulin receptor homolog: a gene essential for embryonic development encodes two receptor isoforms with different signalling potential. EMBO J. (1995) 14:3373–84. doi: 10.1002/j.1460-2075.1995.tb07343.x

PubMed Abstract | Crossref Full Text | Google Scholar

52. Lemmon MA, Schlessinger J, and Ferguson KM. The EGFR family: not so prototypical receptor tyrosine kinases. Cold Spring Harb Perspect Biol. (2014) 6:a020768. doi: 10.1101/cshperspect.a020768

PubMed Abstract | Crossref Full Text | Google Scholar

53. Gutmann T, Kim KH, Grzybek M, Walz T, and Coskun U. Visualization of ligand-induced transmembrane signalling in the full-length human insulin receptor. J Cell Biol. (2018) 217:1643–9. doi: 10.1083/jcb.201711047

PubMed Abstract | Crossref Full Text | Google Scholar

54. Li J, Park J, Mayer JP, Webb KJ, Uchikawa E, Wu J, et al. Synergistic activation of the insulin receptor via two distinct sites. Nat Struct Mol Biol. (2022) 29:357–68. doi: 10.1038/s41594-022-00750-6

PubMed Abstract | Crossref Full Text | Google Scholar

55. De Meyts P. Insulin/receptor binding: the last piece of the puzzle? What recent progress on the structure of the insulin/receptor complex tells us (or not) about negative cooperativity and activation. BioEssays: News Rev molecular Cell Dev Biol. (2015) 37:389–97. doi: 10.1002/bies.201400190

PubMed Abstract | Crossref Full Text | Google Scholar

56. Jumper J, Evans R, Pritzel A, Green T, Figurnov M, Ronneberger O, et al. Highly accurate protein structure prediction with AlphaFold. Nature. (2021) 596:583–9. doi: 10.1038/s41586-021-03819-2

PubMed Abstract | Crossref Full Text | Google Scholar

57. Li Q, Wong YL, and Kang C. Solution structure of the transmembrane domain of the insulin receptor in detergent micelles. Biochim Biophys Acta. (2014) 1838:1313–21. doi: 10.1016/j.bbamem.2014.01.005

PubMed Abstract | Crossref Full Text | Google Scholar

58. Munshi S, Hall DL, Kornienko M, Darke PL, and Kuo LC. Structure of apo, unactivated insulin-like growth factor-1 receptor kinase at 1.5 A resolution. Acta crystallographica Section D Biol crystallography. (2003) 59:1725–30. doi: 10.1107/s0907444903015415

PubMed Abstract | Crossref Full Text | Google Scholar

59. Krissinel E, Lebedev AA, Uski V, Ballard CB, Keegan RM, Kovalevskiy O, et al. CCP4 Cloud for structure determination and project management in macromolecular crystallography. Acta Crystallogr D Struct Biol. (2022) 78:1079–89. doi: 10.1107/S2059798322007987

PubMed Abstract | Crossref Full Text | Google Scholar

60. Emsley P, Lohkamp B, Scott WG, and Cowtan K. Features and development of coot. Acta crystallographica Section D Biol Crystallogr. (2010) 66:486–501. doi: 10.1107/S0907444910007493

PubMed Abstract | Crossref Full Text | Google Scholar

61. Endres NF, Das R, Smith AW, Arkhipov A, Kovacs E, Huang Y, et al. Conformational coupling across the plasma membrane in activation of the EGF receptor. Cell. (2013) 152:543–56. doi: 10.1016/j.cell.2012.12.032

PubMed Abstract | Crossref Full Text | Google Scholar

62. McNicholas S, Potterton E, Wilson KS, and Noble ME. Presenting your structures: the CCP4mg molecular-graphics software. Acta crystallographica Section D Biol Crystallogr. (2011) 67:386–94. doi: 10.1107/S0907444911007281

PubMed Abstract | Crossref Full Text | Google Scholar

63. Abramson J, Adler J, Dunger J, Evans R, Green T, Pritzel A, et al. Accurate structure prediction of biomolecular interactions with AlphaFold 3. Nature. (2024) 630:493–500. doi: 10.1038/s41586-024-07487-w

PubMed Abstract | Crossref Full Text | Google Scholar

64. Backer JM, Shoelson SE, Weiss MA, Hua QX, Cheatham RB, Haring E, et al. The insulin receptor juxtamembrane region contains two independent tyrosine/beta-turn internalization signals. J Cell Biol. (1992) 118:831–9. doi: 10.1083/jcb.118.4.831

PubMed Abstract | Crossref Full Text | Google Scholar

65. Lu KP, Finn G, Lee TH, and Nicholson LK. Prolyl cis-trans isomerization as a molecular timer. Nat Chem Biol. (2007) 3:619–29. doi: 10.1038/nchembio.2007.35

PubMed Abstract | Crossref Full Text | Google Scholar

66. Rognoni L, Most T, Zoldak G, and Rief M. Force-dependent isomerization kinetics of a highly conserved proline switch modulates the mechanosensing region of filamin. Proc Natl Acad Sci United States America. (2014) 111:5568–73. doi: 10.1073/pnas.1319448111

PubMed Abstract | Crossref Full Text | Google Scholar

67. Stubbs CD and Smith AD. The modification of mammalian membrane polyunsaturated fatty acid composition in relation to membrane fluidity and function. Biochim Biophys Acta. (1984) 779:89–137. doi: 10.1016/0304-4157(84)90005-4

PubMed Abstract | Crossref Full Text | Google Scholar

68. Ingolfsson HI, Melo MN, van Eerden FJ, Arnarez C, Lopez CA, Wassenaar TA, et al. Lipid organization of the plasma membrane. J Am Chem Society. (2014) 136:14554–9. doi: 10.1021/ja507832e

PubMed Abstract | Crossref Full Text | Google Scholar

69. Marquardt D, Geier B, and Pabst G. Asymmetric lipid membranes: towards more realistic model systems. Membranes (Basel). (2015) 5:180–96. doi: 10.3390/membranes5020180

PubMed Abstract | Crossref Full Text | Google Scholar

70. Casares D, Escriba PV, and Rossello CA. Membrane lipid composition: effect on membrane and organelle structure, function and compartmentalization and therapeutic avenues. Int J Mol Sci. (2019) 20. doi: 10.3390/ijms20092167

PubMed Abstract | Crossref Full Text | Google Scholar

71. Hsieh MK, Yu Y, and Klauda JB. All-atom modelling of complex cellular membranes. Langmuir: ACS J surfaces colloids. (2022) 38:3–17. doi: 10.1021/acs.langmuir.1c02084

PubMed Abstract | Crossref Full Text | Google Scholar

72. Johnson DH, Kou OH, Bouzos N, and Zeno WF. Protein-membrane interactions: sensing and generating curvature. Trends Biochem Sci. (2024) 49:401–16. doi: 10.1016/j.tibs.2024.02.005

PubMed Abstract | Crossref Full Text | Google Scholar

73. Pabst G and Keller S. Exploring membrane asymmetry and its effects on membrane proteins. Trends Biochem Sci. (2024) 49:333–45. doi: 10.1016/j.tibs.2024.01.007

PubMed Abstract | Crossref Full Text | Google Scholar

74. Pilon M. Revisiting the membrane-centric view of diabetes. Lipids Health Dis. (2016) 15:167. doi: 10.1186/s12944-016-0342-0

PubMed Abstract | Crossref Full Text | Google Scholar

75. Mitrofanova A, Mallela SK, Ducasa GM, Yoo TH, Rosenfeld-Gur E, Zelnik ID, et al. SMPDL3b modulates insulin receptor signalling in diabetic kidney disease. Nat Commun. (2019) 10:2692. doi: 10.1038/s41467-019-10584-4

PubMed Abstract | Crossref Full Text | Google Scholar

76. Ferrara PJ, Rong X, Maschek JA, Verkerke AR, Siripoksup P, Song H, et al. Lysophospholipid acylation modulates plasma membrane lipid organization and insulin sensitivity in skeletal muscle. J Clin Invest. (2021) 131. doi: 10.1172/JCI135963

PubMed Abstract | Crossref Full Text | Google Scholar

77. Kiselyov VV, Versteyhe S, Gauguin L, and De Meyts P. Harmonic oscillator model of the insulin and IGF1 receptors’ allosteric binding and activation. Mol Syst Biol. (2009) 5:243. doi: 10.1038/msb.2008.78

PubMed Abstract | Crossref Full Text | Google Scholar

78. Tatar M. Aging regulated through a stability model of insulin/insulin growth factor receptor function. Front endocrinology. (2021) 12:649880. doi: 10.3389/fendo.2021.649880

PubMed Abstract | Crossref Full Text | Google Scholar

79. Imamura T, Takata Y, Sasaoka T, Takada Y, Morioka H, Haruta T, et al. Two naturally occurring mutations in the kinase domain of insulin receptor accelerate degradation of the insulin receptor and impair the kinase activity. J Biol Chem. (1994) 269:31019–27. doi: 10.1016/S0021-9258(18)47384-X

PubMed Abstract | Crossref Full Text | Google Scholar

80. Dall’Agnese A, Platt JM, Zheng MM, Friesen M, Dall’Agnese G, Blaise AM, et al. The dynamic clustering of insulin receptor underlies its signalling and is disrupted in insulin resistance. Nat Commun. (2022) 13:7522. doi: 10.1038/s41467-022-35176-7

PubMed Abstract | Crossref Full Text | Google Scholar

81. Vecchione A, Marchese A, Henry P, Rotin D, and Morrione A. The Grb10/Nedd4 complex regulates ligand-induced ubiquitination and stability of the insulin-like growth factor I receptor. Mol Cell Biol. (2003) 23:3363–72. doi: 10.1128/MCB.23.9.3363-3372.2003

PubMed Abstract | Crossref Full Text | Google Scholar

82. Yang Y, Sun K, Liu W, Li X, Tian W, Shuai P, et al. The phosphatidylserine flippase beta-subunit Tmem30a is essential for normal insulin maturation and secretion. Mol Ther. (2021) 29:2854–72. doi: 10.1016/j.ymthe.2021.04.026

PubMed Abstract | Crossref Full Text | Google Scholar

83. Norris AC, Yazlovitskaya EM, Zhu L, Rose BS, May JC, Gibson-Corley KN, et al. Deficiency of the lipid flippase ATP10A causes diet-induced dyslipidaemia in female mice. Sci Rep. (2024) 14:343. doi: 10.1038/s41598-023-50360-5

PubMed Abstract | Crossref Full Text | Google Scholar

84. Griffith J, Black J, Faerman C, Swenson L, Wynn M, Lu F, et al. The structural basis for autoinhibition of FLT3 by the juxtamembrane domain. Mol Cell. (2004) 13:169–78. doi: 10.1016/S1097-2765(03)00505-7

PubMed Abstract | Crossref Full Text | Google Scholar

85. Sammon D, Hohenester E, and Leitinger B. Two-step release of kinase autoinhibition in discoidin domain receptor 1. Proc Natl Acad Sci United States America. (2020) 117:22051–60. doi: 10.1073/pnas.2007271117

PubMed Abstract | Crossref Full Text | Google Scholar

86. Diwanji D, Thaker T, and Jura N. More than the sum of the parts: Toward full-length receptor tyrosine kinase structures. IUBMB Life. (2019) 71:706–20. doi: 10.1002/iub.2060

PubMed Abstract | Crossref Full Text | Google Scholar

87. Kaszuba K, Grzybek M, Orlowski A, Danne R, Rog T, Simons K, et al. N-Glycosylation as determinant of epidermal growth factor receptor conformation in membranes. Proc Natl Acad Sci United States America. (2015) 112:4334–9. doi: 10.1073/pnas.1503262112

PubMed Abstract | Crossref Full Text | Google Scholar

88. Kovacs T, Zakany F, and Nagy P. It takes more than two to tango: complex, hierarchal, and membrane-modulated interactions in the regulation of receptor tyrosine kinases. Cancers (Basel). (2022) 14. doi: 10.3390/cancers14040944

PubMed Abstract | Crossref Full Text | Google Scholar

89. Herve S, Scelfo A, Bersano Marchisio G, Grison M, Vaidziulyte K, Dumont M, et al. Chromosome mis-segregation triggers cell cycle arrest through a mechanosensitive nuclear envelope checkpoint. Nat Cell Biol. (2025) 27:73–86. doi: 10.1038/s41556-024-01565-x

PubMed Abstract | Crossref Full Text | Google Scholar

90. Dance A. The secret forces that squeeze and pull life into shape. Nature. (2021) 589:186–8. doi: 10.1038/d41586-021-00018-x

PubMed Abstract | Crossref Full Text | Google Scholar

91. Zhang Y, Cohen OY, Moshe M, and Sharon E. Geometrically frustrated rose petals. Science. (2025) 388:520–4. doi: 10.1126/science.adt0672

PubMed Abstract | Crossref Full Text | Google Scholar

Keywords: insulin, insulin receptor (IR), IGF, IGF-1R, drosophila, human

Citation: Brzozowski AM, Shafi T, Moroz OV and De Meyts P (2025) The use of intuitive AF-based modelling for the understanding of activation and signalling through insulin-like receptors. Front. Endocrinol. 16:1633449. doi: 10.3389/fendo.2025.1633449

Received: 22 May 2025; Accepted: 31 July 2025;
Published: 22 August 2025.

Edited by:

Jiri Jiracek, Academy of Sciences of the Czech Republic (ASCR), Czechia

Reviewed by:

Eunhee Choi, Columbia University, United States
Stevan Hubbard, New York University, United States

Copyright © 2025 Brzozowski, Shafi, Moroz and De Meyts. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

*Correspondence: Andrzej M. Brzozowski, bWFyZWsuYnJ6b3pvd3NraUB5b3JrLmFjLnVr

Deceased

Disclaimer: All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.