Abstract
Introduction:
Respiratory syncytial virus (RSV) can cause lower respiratory tract disease in infants and elderly populations. Despite decades of research, there remains no safe and approved RSV vaccine. Previously, we showed that an RSV G glycoprotein subunit vaccine candidate with a single point mutation within the central conserved domain (CCD), i.e. S177Q, considerably improved immunogenicity.
Methods:
Here, we examine the development of nanoparticle (NP) vaccines having either an RSV G protein CCD with wild-type sequence (NPWT) or an S177Q mutation (NP-S177Q). The NP vaccine immunogens were adjuvanted with monophosphoryl lipid A (MPLA), a TLR4 agonist to improve Th1- type responses. BALB/c mice were primed with 10 μg of NP-WT vaccine, NPS177Q, or vehicle, rested, and then boosted with a high (25 μg) or low (10 μg) dose of the NP-WT or NP-S177Q homologous candidate and subsequently challenged with RSV A2.
Results:
The results showed that mice boosted with NP-S177Q developed superior immunogenicity and neutralizing antibodies compared to NP-WT boosting. IgG from either NP-S177Q or NP-WT vaccinated mice did not interfere with fractalkine (CX3CL1) binding to CX3CR1 and effectively blocked G protein CX3C-CX3CR1 binding. Both NP-WT and NP-S177Q vaccination induced similar neutralizing antibodies to RSV in challenged mice compared to vehicle control. NP-S177Q boosting improved correlates of protection including reduced BAL cell infiltration following RSV challenge. However, the NP vaccine platform will require improvement due to the poor solubility and the unexpectedly weaker Th1-type IgG2a response.
Discussion:
The results from this study support further NP-S177Q vaccine candidate development.
1 Introduction
RSV is the leading cause of lower respiratory tract disease in infants and the elderly (, ). By age 2, nearly all infants have experienced RSV infection (). RSV typically causes a mild upper respiratory tract infection, however severe respiratory disease presenting as bronchiolitis, pneumonia, and wheezing may require hospitalization (). Infants <12 months of age are at the greatest risk for hospitalization (). While preexisting conditions including preterm birth and cardiopulmonary abnormalities significantly increase susceptibility to RSV disease () previously healthy infants are also at risk for hospitalization (, ). Synagis® (palivizumab) is an antibody against the RSV F protein that helps decrease the risk of serious lung infections and is restricted for use in at-risk infants (). Its use in healthy infants is excluded thus countermeasures are currently unavailable in the United States (–). RSV infection may predispose infected infants to asthma and/or chronic wheezing later in life (). Further, RSV infection does not induce robust antibody responses as reinfections are common (). Maternal antibodies (Abs) provide protection against RSV, however, this protection wanes shortly after birth and the level of protection may vary (, ). Gaps remain in understanding the mechanisms of RSV disease, but it is understood that severe disease is linked to immunopathology (). Thus, RSV vaccines that prevent immune-mediated pathology are needed to prevent severe RSV disease ().
RSV has two major surface proteins, i.e. the F and G proteins. The F protein is indispensable for virus infection and is the antigen targeted by palivizumab and nirsevimab therapeutic antibodies (, ). While therapeutic anti-F protein antibodies (Abs) and serum anti-F protein Abs induced by RSV vaccine candidates are neutralizing and may provide some protection from disease (), these Abs are insufficient at blocking RSV disease linked to the RSV G protein (, –). The RSV G protein is a heavily glycosylated surface protein comprised of three domains, i.e. the cytoplasmic (CT), transmembrane (TM), and ectodomain (ecto) domains. Importantly, the G protein ectodomain contains a central conserved domain (CCD) and CX3C motif that are highly conserved among RSV subtypes and strains (). CX3C is the attachment motif for CX3CR1, or fractalkine receptor, that is expressed on human airway epithelial cells (hAECs) and some immune cells (–). G protein CX3C binding to CX3CR1 has been shown to induce aberrant CX3CR1+ T cell trafficking, modify host miRNA profiles, dampen antibody maturation, reduce antiviral cytokine and IFN responses, and potentiate Th2-type immune response during RSV infection (, –). Thus, the G protein affects RSV attachment and modifies host immune response to infection, and Abs that block the CX3C motif may prevent CX3C-mediated attachment and immune dysregulation (, ).
Anti-G protein Abs targeting the CCD and/or CX3C are protective, reduce Th2-type immune responses, increase antiviral IFN and T cell responses, and prevent lung pathology but the G protein itself is poorly immunogenic (–). The G protein has been implicated in vaccine-enhanced respiratory disease as early RSV vaccine trials with formalin-inactivated RSV (FI-RSV) resulted in vaccine-enhanced disease and two infant deaths following natural infection of FI-RSV vaccinees (–). Several studies have shown that G protein may prime for enhanced RSV disease (, , , ). Importantly, ablation of the CX3C motif to CX4C eliminates vaccine-enhanced disease showing that proper modifications to G protein can induce a protective response following vaccination while preventing disease (, ). Recently, we showed that the G protein with a single point mutation, i.e., S177Q, improved immunogenicity compared to wild-type G protein or CX4C G protein vaccination (). A key finding was that the S177Q mutant, similar to CX4C, did not mediate CX3CR1+ immune cell trafficking illuminating how the S177Q mutant may resist the development of enhanced disease (). Notably, unlike the CX4C mutant, the S177Q mutant was found to be structurally intact and display conformational epitopes for high-affinity anti-G Abs ().
In this study, we made and evaluated nanoparticle (NP) immunogens displaying the CCD of the RSV G protein. We hypothesized that the self-assembling NPs would improve vaccine immunogenicity by presenting multiple copies of CCD antigens in a repetitive manner that is similar to natural infection. NPs displaying wild-type CCD (NP-WT), CCD containing the S177Q mutation (NP-S177Q), or no antigen (vehicle control) were used to immunize mice, followed by RSV challenge. NP-WT and NP-S177Q vaccine candidates were adjuvanted with MPLA to induce a Th1-type response (, ). Mice were intramuscularly (i.m.) primed with 10 µg of vehicle, NP-WT, or NP-S177Q vaccines and subsequently boosted with either 10 µg (low dose) or 25 µg (high dose) of the homologous NP vaccine candidates. Subsequently, mice were intranasally (i.n.) challenged with 106 PFU RSV A2, and on day 5 post-challenge, lung viral loads and immune correlates were determined.
The results show the NP-S177Q vaccination induced greater immunogenicity compared to NP-WT or vehicle control. While both NP-WT and NP-S177Q vaccination reduced lung viral titers, NP-S177Q vaccination led to improved viral neutralization compared to NP-WT. IgG from NP-WT or NP-S177Q vaccinated mice did not interfere with FKN binding to CX3CR1, and the IgG blocked G protein binding to CX3CR1. Importantly, NP-S177Q vaccination was able to significantly reduce BAL cell infiltration following the RSV challenge compared to vehicle-vaccinated mice. This study shows that RSV G protein CCD nanoparticle vaccines have promise in the development of precision RSV vaccines, however as expected with novel vaccine development, will require optimization such as improving vaccine solubility. However, the findings of this study support improved NP platforms in developing the next generation of RSV G protein vaccines expressing the S177Q mutant.
2 Materials and methods
2.1 Cells and virus
Vero E6 (CRL-1586), A549 (CCL-185), HEp-2 (CCL-23), and HEK-293 (CRL-1573) (all from American Type Culture Collection (ATCC), Manassas, VA) were maintained in 10% fetal bovine serum (FBS)/DMEM (Hyclone, Logan, UT). CX3CR1.293 cells (>90% CX3CR1+) were maintained in selection media (10% FBS/DMEM + 1.0 µg/mL puromycin) as previously described (). RSV A2 and B1 were propagated in HEp-2 cells as described (). RSV A2 expressing green fluorescent protein (GFP) was propagated in HEp-2 cells as described ().
2.2 Nanoparticle construction
Nanoparticle (NP) vaccines were constructed using self-assembling Aquifex aeolicus lumazine synthase () fused to a next-generation SpyCatcher domain (, , ). To generate the NPs, a pET28a plasmid encoding an N-terminal 6-histidine tag, the Aquifex aeolicus lumazine synthase protein (UniProtKB entry O66529), and SpyCatcher003 () (Table 1) was transformed into T7 Express E. coli and recombinant LumazineSynthase-SpyCatcher003 was expressed overnight at 18C. Cells were lysed by ultrasonication in wash buffer (10 mM Tris-Cl pH 8.0, 10 mM imidazole, 150 mM NaCl) with 1 mM MgCl2, protease inhibitors, benzonase, and DTT. E. coli lysates were clarified by centrifugation and 0.22 um filtered. LumazineSynthase-SpyCatcher003 was purified from clarified lysates by affinity chromatography using a HisPur Nickel-NTA Resin and eluted using wash buffer with 250 mM imidazole. LumazineSynthase-SpyCatcher003 was dialyzed into PBS (pH 7.4) overnight at 4°C, resulting in empty vehicle control NPs. For negative stain imaging, LumazineSynthase-SpyCatcher003 protein was deposited onto glow-discharged, carbon-coated 400 mesh copper grids, stained with 2% (w/v) uranyl-formate, and viewed on a 200 kV FEI Glacios transmission electron microscope.
Table 1
| LS-NP (empty) | 6xHis-Lumazine Synthase Nanoparticle-SpyCatcher | MGSSHHHHHHSSGLVPRGSHMQIYEGKLTAEGLRFGIVASRFNHALVDRLVEGAIDCIVRHGGREEDITLVRVPGSWEIPVAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLSLELRKPITFGVITADTLEQAIERAGTKHGNKGWEAALSAIEMANLFKSLRSGGSGGGGMVTTLSGLSGEQGPSGDMTTEEDSATHIKFSKRDEDGRELAGATMELRDSSGKTISTWISDGHVKDFYLYPGKYTFVETAAPDGYEVATPIEFTVNEDGQVTVDGEATEGDAHT |
| CCD-WT | SpyTag-CCD-6xHis-tag | MRGVPHIVMVDAYKRYKGSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKHHHHHH |
| CCD-S177Q | >SpyTag-CCD-S177Q-6xHis-tag | MRGVPHIVMVDAYKRYKGSKPNNDFHFEVFNFVPCSICQNNPTCWAICKRIPNKKPGKKHHHHHH* |
Nanoparticles.
Nanoparticle construction of empty nanoparticle (LS-NP), CCD-WT (NP-WT), and CCD-S177Q (NP-S177Q); italicized = His-Tag, underline = lumazine synthase NP, CCD, or CCD-S117Q, capitalized normal = SpyCatcher003, bold = SpyTag003.
To generate CCD protein antigens, a synthetic gene encoding an N-terminal SpyTag003 () fused to RSV strain A2 G protein amino acids 157 to 197 (UniProtKB entry P03423) and a C-terminal 6-histidine tag was cloned into pRSFDuet-1 (Table 1). Recombinant SpyTag003-RSV G CCD WT and SpyTag003-RSV G CCD S177Q proteins were expressed in T7 Express E. coli overnight at 18C. Cells were lysed by ultrasonication in wash buffer (20 mM Tris-cl pH 8.0, 25 mM imidazole, 150 mM NaCl) with 1 mM MgCl2, protease inhibitors, and benzonase. E. coli lysates were clarified by centrifugation and 0.22 um filtered. SpyTag003-RSV G CCD WT and SpyTag003-RSV G CCD S177Q proteins were purified from clarified lysates by affinity chromatography using a HisTrap FF crude column and washed with wash buffer containing 6 M urea. Protein was eluted in wash buffer containing 500 mM imidazole. This CCD purification method has been used successfully to solve its structure bound to anti-G protein antibodies, confirming that the recombinant CCD protein adopts an antigenically-relevant conformation (, 60, 61).
To generate CCD-coated NPs, LumazineSynthase-SpyCatcher003 protein was incubated with a 4 M excess of SpyTag003-RSV G CCD WT or SpyTag003-RSV G CCD S177Q overnight at 4°C. During this incubation, a covalent isopeptide bond is formed between the SpyTag003 and the SpyCatcher003 which is verified by SDS-PAGE and a shift in the molecular weight band. Aggregation was observed the following day and was confirmed to be the NP samples by SDS-PAGE. Insoluble pellets were resuspended in PBS (pH 7.4) to make a final concentration of 1 mg/ml. Protein concentrations for all NP samples were verified by Bradford assays.
2.3 Mice
Female BALB/c mice (10-to-12-weeks old; Jackson Laboratories, Bar Harbor, ME) were housed in micro isolator cages with 12h light/dark cycle, and fed ad libitum. The mice received a priming dose of 10 µg NP-WT, NP-S177Q, or empty NPs. All vaccines were adjuvanted with 10 µg monophosphoryl Lipid A (MPLA; VacciGrade™ from S. Minnesota R595, InvivoGen, San Diego, CA), a TLR4 agonist, diluted in PBS. Similar to a related study that used using SpyCatcher multimerization of a SARS-CoV-2 spike vaccine candidate to induce a potent neutralizing antibody response at 21 days post-priming (62), vaccinated mice were boosted with either 10 µg or 25 µg of homologous vaccine or empty NPs and 10 µg MPLA diluted in PBS. Mice were i.m. vaccinated in the left and right and left quadriceps with 0.05 mL/quadriceps. Sera were collected on days 0, 14, 28, and 35 post-boosts. On day 21 post-boost, mice were i.n. anesthetized with Avertin (2, 2, 2-Tribromoethanol), and i.n. and challenged with 0.05 mL 106 PFU RSV A2 diluted in PBS. Mice were monitored daily and euthanized on day 5 pi. Sera, BAL, lungs, and spleen were collected and stored on ice during organ processing for assays described below.
2.4 Serum ELISA
Sera were evaluated for anti-RSV IgG levels as described (). Briefly, high-binding ELISA plates (Corning, Corning, NY) were coated with 5 µg/mL RSV A2 or B1 lysate overnight at 4°C. The next day, wells were washed 3x with KPL wash buffer (1x KPL in distilled water (diH2O) (SeraCare, Milford, MA) and blocked with Blotto (5% non-fat dry milk) overnight at 4°C. Blotto was removed and sera (in 3-fold dilutions starting at 1:50) was diluted in Blotto and added to wells overnight at 4°C. Wells were washed 3x with KPL wash buffer and 2° goat-anti-mouse IgG-HRP (ThermoFisher, Waltham, MA), or secondary subtype IgG1 or IgG2a antibodies (Southern Biotech, Birmingham, AL) were added. Plates were incubated overnight at 4°C, washed 3x with KPL wash buffer, and developed with 1-Step™ Ultra 3,3’,5,5’-tetramethylbenzidine (TMB; ThermoFisher) for 20 min, and stopped with Stop Solution (ThermoFisher), then read immediately using a BioTek plate reader (BioTek, Winooski, VT) at OD450.
2.5 Microneutralization assay
To determine the level of RSV antibody neutralization in the mouse sera, a microneutralization assay was used as described with minor modifications (63). Briefly, sera were pooled and heat-inactivated at 55°C for 30 min. Diluted sera in 2% FBS/DMEM (1:40) were co-incubated with 200 FFU RSV A2-GFP +/- 10% guinea pig complement (C’) (Sigma-Aldrich, St. Louis, MO) for 1 h at 37°C. Following pre-incubation, the virus/sera mixture was added to 95% confluent A549 cells for 48 h. Fluorescent focus units (FFUs) were visualized using Cellomics ArrayScan (ThermoFisher), enumerated with HTS software, and mean FFUs of replicate wells were determined. Neutralization was determined as the percent reduction in mean FFUs compared to empty NP antisera.
2.6 CX3C-CX3CR1 blocking assay
A CX3C-CX3CR1 blocking assay was performed as described (). Briefly, 500 nM RSV G ectodomain (Gecto) was incubated +/- 5/mL heparin sulfate (HS) (Sigma) to prevent non-specific binding and +/- 20 µg/mL IgG (isolated from vaccinated mice by Protein G beads (Invitrogen) for 1 h on ice. CX3CR1.293 and HEK-293 cells were harvested, and 4 x 106 cells/mL were blocked with 1 µg/mL Fc block diluted in FACS buffer (0.8% FBS/PBS) for 15 min on ice followed by incubation with 500 nM RSV Gecto +/- 5 µg/mL HS +/- 10 µg/mL IgG for 1 h on ice. Cells were washed and resuspended in 20 µg/mL anti-G protein mAb (clone 130-5F) for 45 min on ice. Cells were washed and resuspended in goat-anti-mouse Alexa488 (1:200) (ThermoFisher) for 45 min on ice and protected from light. Cells were washed 3x with FACS buffer, resuspended in FACS buffer, and analyzed by flow cytometry. To determine FKN blocking, the assay was followed similarly except cells were incubated with 2 µg/mL biotinylated-FKN (Acro Biosystems, Newark, DE) +/- 5 µg/mL HS and +/- 10 µg/mL IgG. To detect CX3CR1-bound FKN, cells were incubated with Streptavidin-PE (1:200) (ThermoFisher). Identical times and temperatures were used for both ligands. Percent inhibition was determined as the difference of CX3CR1+ binding (G or FKN +HS + vehicle IgG) – (G or FKN +HS +NP IgG or mAb control bound to) x 100 as previously described (). At least 20,000 events were collected using BD LSR II (BD Bioscience, Franklin Lakes, NJ).
2.7 Plaque assays
Lungs were harvested at day 5 pi and homogenized in 1 mL DMEM using GentleMACS tissue homogenizer (Miltenyi Biotec, Gaithersburg, MD) as described (). Homogenates were centrifuged at 500 xG at 4°C for 8 min, supernatant was 10-fold diluted in DMEM (Hyclone) and overlaid onto 90% confluent Vero E6 cells in 24-well plates. After 2h of absorption, cells were overlaid with 2% methylcellulose (Sigma Aldrich) and incubated at 37°C for 6 days. Following incubation, methylcellulose was aspirated, wells were washed with PBS, fixed with acetone: methanol (60:40, Sigma-Aldrich), and air-dried overnight. Wells were washed 3x with KPL wash buffer and blocked with blotto overnight at 4°C. The next day, Blotto was removed and a mAb cocktail against RSV F and G proteins (clones 131-2A, 131-2G) was diluted in blotto was added overnight at 4°C. Wells were washed 3x with KPL wash buffer and goat anti-mouse-AP (ThermoFisher) was added overnight at 4°C. Wells were washed 3x with KPL wash buffer and virus plaques were developed with 1-Step™ NBT/BCIP substrate solution (ThermoFisher) for 5 min, rinsed with diH2O, and enumerated using a dissection microscope.
2.8 BAL cell phenotyping
Bronchioalveolar leucocytes (BAL) were collected by i.p. anesthetizing (Avertin) mice and terminally bleeding by severing the left axillary artery. The trachea was exposed and a small incision was made. The lungs were flushed 3x with 1 mL PBS and collected in 1.5 mL snap-cap tubes and BAL was centrifuged for 10 min at 500 xG at 4°C. The supernatant (BAL fluid) was separated and stored at -80°C until cytokine/chemokine analysis. BAL cells were resuspended in FACS buffer (0.8% FBS/PBS) and enumerated using a hemocytometer and Trypan blue. Cells were washed with FACS buffer and resuspended in Fc Block for 15 min on ice followed by the addition of anti-CD3, anti-CD8, and anti-CD11b, or isotype control Abs (all from BD Bioscience) for 1h on ice (Supplementary Figure 2). Cells were washed, fixed with 2% PFA (Ted Pella, Redding, CA) for 20 min at room temperature, washed, and resuspended with FACS buffer. At least 10,000 events were collected with BD LSR II (BD).
2.9 Intracellular cytokine staining
Spleens from mice were collected at day 5 pi. Single-cell suspensions of spleen cells were made by dissociation through a 100 uM cell strainer (Corning), washed with Hanks Balanced Salt Solution (HBSS) (HyClone), and red blood cells were lysed with Gey’s solution (Sigma-Aldrich) for 5 min. Splenocytes were washed 2x with HBSS, resuspended in media containing 10% FBS + RPMI-1640, and enumerated using a hemocytometer, and 2 x 107 cells/mL were plated in a round bottom 96-well plate (Corning). Splenocytes were stimulated with 10 µg/mL RSV G (183WAICKRIPNKKPGKK197) and M2 peptides (82SYIGSINNI90) () or control (GFP, aa 200-208), phorbol 12-myristate 13-acetate (PMA)/ionomycin (Sigma), or left unstimulated and were treated with GolgiPlug (Brefeldin A) (BD) to retain cytokines and incubated at 37°C for 6h. After 6 h, cells were washed 3x with FACS buffer, blocked with 1 µg/mL Fc block (BD), and stained with anti-CD3 and anti-CD4 or isotype controls (all from BD Bioscience) for 1 h on ice. Cells were fixed with 2% PFA for 20 min at room temperature, washed with permeabilization buffer (BD Bioscience), and incubated with anti-IFNγ and anti-IL-4 or isotype controls diluted in permeabilization buffer for 1 h at 4°C (Supplementary Figure 2). Cells were washed 3X with permeabilization buffer, resuspended in FACS buffer, and analyzed with BD LSR II (BD Bioscience) with at least 10,000 events collected.
2.10 Statistics
Data were analyzed by one-way ANOVA with Dunnett’s multiple comparison test. p<0.05 was considered significant. Data are represented as mean +/- SEM. A vaccination study was performed once. Experiments were performed at least in duplicate with representative data shown.
3 Results
3.1 Nanoparticle vaccine constructs
NP immunogens were constructed using SpyTag/SpyCatcher technology (, ) (Figure 1). Briefly, a construct of lumazine synthase, which self-assembles into 60-mer spherical particles, was fused to a SpyCatcher domain. Recombinant lumazine synthase – SpyCatcher protein was purified and confirmed by negative stain electron microscopy to self-assemble into NPs (Figure 1D). To generate CCD-coated NPs, the lumazine synthase – SpyCatcher NPs were incubated with recombinant RSV G CCD protein fused to a SpyTag, allowing for the formation of the covalent isopeptide bond between the SpyCatcher and SpyTag and display of the CCD antigen on the surface of the NPs (Figure 1B). Covalent linking of the SpyTagged CCD to the lumazine synthase – SpyCatcher was verified by SDS-PAGE and a change in molecular weight of the bands (Figure 1C). We previously identified that a point mutation at site 177 (serine to glutamine) improved immunogenicity in a G glycoprotein vaccine compared to wild-type G protein adjuvanted with MPLA (). Thus, in addition to wild-type CCD antigen loaded onto NPs (NP-WT), the S177Q CCD antigen was also generated and loaded onto NPs (NP-S177Q). Notably, upon overnight incubation of CCD antigens with NPs, precipitation was observed. Pelleting of the precipitate by centrifugation and evaluation by SDS-PAGE revealed that the precipitate is the NP-WT and NP-S177Q nanoparticle samples (Figure 1C). No precipitation is observed by incubation of empty NPs or CCD alone, suggesting that the loading of the CCD, which contains many hydrophobic amino acids, promoted insolubility of the NPs. To generate samples for immunization, pellets were resuspended in PBS.
Figure 1
3.2 RSV NP vaccines induce Anti-RSV Abs
Mice received a priming dose of 10 µg NP-WT, NP-S177Q, or empty NPs adjuvanted with 10 µg MPLA. On day 21 post-prime, mice were boosted with either 10 µg or 25 µg of homologous vaccine or 10µg empty NP, all adjuvanted with 10 µg MPLA. At day 7 post-boost, the mice were bled, and anti-RSV Abs were detected by ELISA (Figure 2, Supplementary Figure 1). NP-WT and NP-S177Q vaccination induced anti-RSV Ab responses. Abs generated by NP-S177Q were significantly increased (p <0.05), and NP-WT 25µg and NP-WT 10µg Abs were increased (p = 0.28, p = 0.06, respectively) compared to empty NP vaccination. NP-S177Q vaccination induced moderately higher serum IgG titers than NP-WT (Figure 2), although the IgG responses did not statistically differ between vaccine doses. At day 21 post-boost, the NP-vaccinated mice were challenged with RSV A2, and on day 5 the serum Ab responses were determined. Similar to pre-challenge IgG titers, all vaccinated mice had greater anti-RSV A2 IgG compared to vehicle control (Figure 3A). Mice boosted with 25 µg of NP-S177Q vaccine had significantly (p<0.05) increased Ab titers compared to vehicle control, however, NP-S177Q vaccination was not statistically improved over NP-WT boosted mice. Contrary to our previous study demonstrating improved Ab recall responses (), these data show a less robust recall response as sera Ab levels were roughly 1 log3 lower in each group on days 7 post boost and 5 post-challenge. Previous constructs utilized full-length G protein as opposed to restricting antibody responses to the CCD, which may partially explain this phenomenon. It is also possible Abs were present in the lung during infection and would not be detected in sera. It is also notable that serum Ab titers against RSV B1 were markedly lower than RSV A2 (Figure 3B). This finding was similar to a previous report suggesting anti-G Abs generated against A2 G protein bind with lower affinity to RSV B compared to RSV A2, likely due to variable residues encompassing the CCD between subtypes, despite conservation of the CX3C motif (). NP-S177Q vaccination induced greater Abs compared to vehicle control. NP-WT also induced anti-B1 Abs although the titers were lower compared to NP-S177Q.
Figure 2
Figure 3
To determine if the serum Ab response were Th1- or Th2-like, ELISAs were performed to determine the specific IgG subclass (Figure 3C). It is established that IgG2a corresponds to a Th1-type response, while IgG1 corresponds to a Th2-type in response (64) and determines Fc effector function (e.g., complement-dependent cytotoxicity) (65, 66). There were no significant changes in Th2-type Ab responses between vehicle and NP-WT or NP-S177Q vaccinated mice. Further, Th1-type responses were only significantly (p<0.05) increased in the 25 µg NP-WT vaccinated mice, while there were no significant IgG2a responses in NP-S177Q vaccinated mice. These findings do not recapitulate the increased Th1-type responses which were previously observed with G protein immunogen (). Conformationally designed epitopes such as those in the NP vaccines may require adjuvants that do not denature or emulsify the antigens, and or the insolubility of NP-WT and NP-S177Q vaccines may have contributed to these differences (67).
3.3 CX3C-CX3CR1 blocking
Blocking CX3C-CX3CR1 interaction or ablating the CX3C motif is correlated with protection against RSV disease in mice and cotton rats (, , , 68). To evaluate the efficacy of G protein CX3C-CX3CR1 blocking Abs generated in response to NP-WT or NP-S177Q vaccination, serum IgG from NP-vaccinated mice was isolated and tested. Similar to the G protein vaccinated mice (), vaccination with NP-WT or NP-S177Q candidates induced significant (p<0.05) CX3C-CX3CR1 blocking Abs compared to vehicle IgG (Figure 4A), and Ab from NP-S177Q vaccination induced slightly higher blocking Abs (35%) than NP-WT vaccination (20%). As expected, mAb 131-2G which binds to a conserved epitope in the G protein blocked up to 90% G protein binding to CX3CR1. Contrary to our previous report showing that G protein induced greater CX3C-CX3CR1 blocking Abs compared to vaccination with an S177Q G protein mutant, in this study, we observed a slight improvement in G protein CX3C-CX3CR1 blocking, and in agreement with previous reports, 131-2G blocked G protein binding more effectively than polyclonal IgG from vaccinated mice. These Abs did not cross-react and block FKN binding to CX3CR1 (data not shown). This is not unexpected as there are structural differences that may preclude anti-G protein binding (69). Thus, this NP-S177Q vaccine platform induces G protein CX3C-CX3CR1 blocking Abs which have been shown to protect against RSV disease and are not implicated in modifying endogenous FKN signaling.
Figure 4
3.4 RSV neutralization
Anti-G protein Abs are neutralizing in human airway epithelial cells infected with RSV and in vivo (). The addition of complement aids the neutralization of some anti-G protein Abs including the highly potent 3D3 and 3G12 anti-G protein mAbs that can be detected in immortalized cell lines (69, 70). To determine if serum from NP-WT or NP-S177Q vaccinated mice was neutralizing, heat-inactivated sera +/- 10% guinea pig complement (C’) were co-incubated with RSV-GFP () and added to RSV-infected human A549 cells for 48 h (Figure 4B). In the absence of complement, there was no significant (p>0.05) neutralization for any vaccine groups, however, serum plus complement from NP-WT and NP-S177Q vaccinated mice significantly (p<0.05) neutralized infected A549 cells compared to empty NP vaccination. Moreover, serum from 25 µg S177Q induced significantly (p<0.05) greater neutralization compared to NP-WT at the same dose. These data suggest neutralization is complement-dependent and not CX3C:CX3CR1-mediated neutralization.
Lung viral titers showed that NP-WT and NP-S177Q vaccination reduces lung titers in vivo (Figure 5). On day 5 pi, corresponding to peak lung viral titers (71), 10 µg NP-WT or 25 µg NP-S177Q vaccination resulted in significantly (p<0.05) reduced viral titers in the lungs of RSV A2 challenged mice. 25 µg NP-WT vaccinated mice and 10 µg NP-S177Q vaccinated mice also reduced lung titers compared to empty NP vaccination (p=0.16, p=0.15, respectively). These findings are consistent with other G protein vaccines that reduce lung titers and induce anti-G protein neutralizing Abs (nAbs), however, others have reported that Abs to G protein are non-neutralizing but this was determined in the absence of complement, an effect which has caused misunderstanding (, , 72, 73). There may be mechanisms aside from nAbs that result in reduced viral titers after NP vaccination including a cytotoxic T lymphocyte (CTL) response or improved macrophage activity, however these were not examined here. Moreover, while in vivo and in vitro neutralization data suggest 25 µg NP-S177Q vaccination resulted in the greatest levels of nAbs and reduced lung titers, the lack of significant in vivo reduction for 25 µg NP-WT and 10 µg NP-S177Q does not correlate with our findings in vitro. The findings from this study show that G protein immunogens are capable of inducing nAbs that are detectable in vitro with additional complement and vaccination may reduce lung viral titers in mice.
Figure 5
3.5 Immune response to RSV challenge
Aspects of RSV disease are connected with the expression of the G protein CX3C motif (). Blocking G protein CX3C-CX3CR1 interaction with mAbs specific to this motif or the CCD domain is correlated with reduced RSV disease in vivo (, , 73). To determine if NP-WT or NP-S177Q vaccination is protective against G protein-mediated disease, vaccinated mice were challenged with RSV A2 and BAL leukocytes were evaluated (Table 2). A significant (p<0.05) reduction in BAL cell numbers (3.9 x 104 cells) in RSV-challenged mice that were vaccinated with 10 µg of NP-S177Q vaccine was evident compared to the empty NP control vaccinated mice (7.5 x 104 cells). Interestingly, no other vaccination group including mice vaccinated with 25 µg of NP-S177Q vaccine had substantially reduced BAL cells following RSV challenge. Consistent with an overall reduction in BAL cell infiltration, RSV-challenged 10 µg NP-S177Q mice vaccinated had reduced CD11b+ cell numbers (2.3 x 103) and a trend toward lower in CD8+ T cell numbers (2.0 x 103) compared to RSV-challenged empty NP vaccinated mice (5.4 x 103 and 3.3 x 103 cells, respectively). Taken together, these support lung disease protection in mice vaccinated with NP-S177Q vaccine compared to vehicle control vaccinated mice. We also examined intracellular cytokine production by splenocytes stimulated with RSV G peptide encompassing the CCD and M2 as previously described (, 68), however, there were no statistical differences detected in the production of IFNγ+ or IL-4+ by CD3+/CD4+ T cells between groups (data not shown).
Table 2
| Empty NPs | NP-WT 25µg | NP-S177Q 25µg | NP-WT 10µg | NP-S177Q 10µg | |
|---|---|---|---|---|---|
| Total BAL Cells | 7.5 x 104 (± 4.7 x 103) | 8.4 x 104 (± 12.0 x 103) | 6.6 x 104 (± 14.0 x 103) | 6.2 x 104 (± 6 x 103) | 3.9 x 104* (± 6.2 x 103) |
| CD8+ | 3.3 x 103 (± 5.5 x 102) | 3.1 x 103 (± 4.3 x 102) | 3.7 x 103 (± 8.2 x 102) | 2.5 x 103 (± 5.2 x 102) | 2.0 x 103 (± 1.0 x 102) |
| CD11b+ | 5.4 x 103 (± 6.0 x 102) | 4.7 x 103 (± 6.8 x 102) | 5.0 x 103 (± 17.0 x 102) | 2.9 x 103 (± 4.8 x 102) | 2.3 x 103 (± 2.4 x 102) |
BAL Leukocytes.
Mice received a priming dose of 10 µg NP-WT, NP-S177Q, or empty NPs, all adjuvanted with 10 µg MPLA. On day 21 post prime, mice were boosted with either 10 µg or 25 µg of homologous vaccine or 10 µg empty NP, all adjuvanted with 10 µg MPLA. On day 21 post boost, vaccinated mice were challenged with 106 PFU RSV A2, and on day 5 pi the BAL cells were collected and enumerated (total BAL cells). CD8+ T cells and CD11b+ cells were determined by flow cytometry with at least 10,000 events collected. Mean total cells ± SEM (shown in italics) are presented. *p<0.05 by one-way ANOVA with Dunnett’s multiple comparison test compared to empty NPs within the same row.
4 Discussion
RSV is a major cause of respiratory disease in the very young and old with no safe and approved vaccine available despite decades of research. The landscape of RSV vaccine research started with a failed formalin-inactivated RSV (FI-RSV) vaccine tested in the early 1960s (74). In those studies, FI-RSV vaccinated infants naturally infected with RSV infection resulted in a majority of infants requiring hospitalization where two infants died (). Further investigation revealed that the FI-RSV vaccine caused enhanced disease (75). Moreover, it was later shown that Abs generated against RSV correlate with some but incomplete protection from disease, and that reinfection with identical RSV strains could occur, and that viral loads did not consistently correlate with disease severity in hospitalized infants (76–78). Thus, a safe and effective RSV vaccine has been elusive ().
The RSV F protein has historically been the focus for RSV vaccine development as it is more conserved than G protein, and F protein is indispensable for in vitro infection (79). However, the G protein has a highly conserved CX3C chemokine mimic motif within its central conserved domain (CCD) (, 60). Abs which bind the CCD and/or CX3C motif may be protective by preventing viral attachment to host cells as well as blocking G protein CX3C-CX3CR1 responses and G protein chemokine mimicry. Importantly, Abs induced by RSV G protein, including anti-G protein mAbs, that target the CCD and/or CX3C motif will neutralize RSV A and B strains, prevent Th2-type immune biasing due to G protein, reduce many of the immune correlates of severe RSV disease (e.g., eosinophilia), improve respiratory efforts, rescue protective IFN responses, and reduce lung pathology (, , 80–85). At least two findings have stalled RSV G protein-based vaccine development, one being that the CCD region is poorly immunogenic compared to epitopes on F protein (86–88), and the G protein has been linked to the development of enhanced RSV disease (, , ).
To address these impediments, we have investigated the function and immunogenicity of various G protein mutants (, , 68). Specifically, we examined the G protein S177Q mutant as a vaccine candidate because our studies showed that the mutation S177Q increased immunogenicity and improved Th1-type responses compared to G protein (). The findings were predicted as immunogen was derived by structurally-guided vaccine development and knowing that a single point mutation in the CCD would alter the conformation of the G protein likely affecting its immunogenicity and safety profile. Structural and conformational validation showed that the CCD S177Q mutant retains high affinity when binding to mAbs and human anti-RSV reference sera and was substantially improved compared to the CX4C G protein mutant (). In this study, mice were vaccinated with NP-WT or NP-S177Q generated with SpyTag/SpyCatcher technology (, ). Recently, a pre-F ferritin NP (pre-F-NP) with modified glycans was evaluated in mice and nonhuman primates (NHPs) (89). It was shown that pre-F-NP vaccination induced greater neutralizing antibody responses compared to DS-Cav1 trimer, suggesting the NP vaccine platform may offer superior characteristics compared to protein or subunit vaccination.
In this study, the NP-WT or NP-S177Q vaccine candidates were immunogenic in a prime/boost scheme, and consistent with our previous work, the NP-S117Q candidate showed improved immunogenicity. We sought to determine if these vaccines were protective, and to this end, the NP-vaccinated mice were i.n. challenged with RSV A2 and the serum antibody and BAL cell responses were determined. The sera responses after the RSV challenge were similar to the 25 µg NP-S177Q vaccinated mice, being significantly (p<0.05) more immunogenic than vehicle control, and NP-S177Q vaccinated mice also trended towards increased IgG titers compared to NP-WT for binding to RSV A2 and B1. As the CX3C motif is conserved between RSV subtypes and strains, these data suggest that Abs induced by NP-WT or NP-S177Q vaccination may be cross-reactive (). The serum Ab isotypes were evaluated to determine if NP vaccination induced a Th1-dependent IgG2 response, or a Th2-dependent IgG1 response (64). Serum from NP-WT vaccinated mice indicated a predominantly Th1-type response, however, mice vaccinated with NP-S177Q predominantly had a Th2-type response (Figure 3C), which was inconsistent with our previous results. However, sera from both NP-WT and NP-S177Q vaccinated mice blocked G protein CX3C-CX3CR1 and did not interfere with FKN binding to CX3CR1 (Figure 4). Sera from 25 µg NP-S177Q vaccinated mice had significantly greater (p<0.05) complement-dependent neutralization activity in A549 cells compared to empty NP and 25 µg NP-WT. Thus, the Ab response to NP vaccination suggests NP-S177Q improves immunogenicity and induces greater nAbs, and that Abs that block G protein binding to CX3CR1.
Neutralizing the virus can contribute to reducing virus-mediated disease, however disease severity does not faithfully correlate with viral load or neutralizing Ab responses (77, 78, 80, 90–92). RSV disease is understood to be affected by both virus and host factors, and interventions that do not address G protein-mediated immune dysregulation may provide incomplete protection (). While we noted significant reductions in lung viral loads in vaccinated mice, modalities that neutralize viruses and block G protein mediated disease are of great interest.
BAL cell influx during RSV infection is a correlate of immune-mediated disease (93). Initial vaccination with NP-WT did not prime for enhanced respiratory disease when the mice were boosted with NP-WT or NP-S117Q vaccines likely because of the MPLA adjuvant precluding non-neutralizing Th2-type responses and/or restriction of responses to the CCD. Mice receiving the 10 µg NP-S177Q vaccination resulted in significantly (p<0.05) fewer total BAL cells where CD11b+ and CD8+ BAL cells were substantially reduced while 25 µg vaccination did not have this result. It is possible that the 10 µg vaccine dose was suboptimal in terms of the robustness of BAL cell recruitment when the vaccinated mice were challenged. However, these findings show the NP-S177Q boosting effectively induces CX3C-CX3CR1 blocking and neutralizing Abs which can provide protection against RSV challenge and disease. Our previous study () evaluated various full-length mutant G proteins in a prime/boost/boost scheme, and we discovered significant Ab responses in mice vaccinated with S177Q mutations. Here, we describe the next iteration of this platform, an NP containing CCD with or without the S177Q mutation in a prime/boost scheme. Consistent with our previous studies, the NP-S177Q vaccine improves immunogenicity, however these studies do not demonstrate superiority to our previous full-length constructs. This may be due to the vaccination scheme (i.e., one versus two boosts), antigen delivery quality and/or presentation (e.g. poor solubility of NP constructs), or other differences. It will be important in future studies to compare various NP and microparticle (MP) vaccine platforms that improve solubility and immunogenicity and protect from disease. Our ongoing studies using these improved candidates will fully elucidate immune responses to this vaccine and show robust protection from disease.
Statements
Data availability statement
The original contributions presented in the study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author.
Ethics statement
Mice studies were performed in compliance with all national and institutional guidelines and guidelines from the Human Care and Use of Laboratory Animals (American Association for Laboratory Animal Science) and performed according to a protocol approved by the University of Georgia Institutional Animal Care and Use Committee (IACUC) (A2022 04-023-Y1-A0, approval date 05/19/2022). All efforts were made to minimize animal pain and discomfort.
Author contributions
HB designed and carried out experiments, wrote and edited the manuscript. JM data acquisition. MJ provided reagents. SN provided reagents. RD and RT secured funding and guided project, wrote and edited the manuscript. All authors contributed to the article and approved the submitted version.
Funding
Funding was provided by the Georgia Research Alliance (GRA) and from NIH 1R01AI166066.
Acknowledgments
We would like to thank Les Jones (University of Georgia) for purifying RSV G protein. We thank Vitor and UCSC CryoEM Facility.
Conflict of interest
RD is an inventor on US patent filing No. 62/588,022.
The remaining authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2023.1215323/full#supplementary-material
References
1
Nguyen-Van-TamJSO'LearyMMartinETHeijnenECallendretBFleischhacklRet al. Burden of respiratory syncytial virus infection in older and high-risk adults: a systematic review and meta-analysis of the evidence from developed countries. Eur Respir Rev (2022) 31(166). doi: 10.1183/16000617.0105-2022
2
BaraldiECheccucci LisiGCostantinoCHeinrichsJHManzoniPRiccoMet al. RSV Disease in infants and young children: can we see a brighter future? Hum Vaccin Immunother (2022) 18(4):2079322. doi: 10.1080/21645515.2022.2079322
3
BorchersATChangCGershwinMEGershwinLJ. Respiratory syncytial virus–a comprehensive review. Clin Rev Allergy Immunol (2013) 45(3):331–79. doi: 10.1007/s12016-013-8368-9
4
HendersonFWCollierAMClydeWAJr.DennyFW. Respiratory-syncytial-virus infections, reinfections and immunity. a prospective, longitudinal study in young children. New Engl J Med (1979) 300(10):530–4. doi: 10.1056/NEJM197903083001004
5
HallCBWeinbergGAIwaneMKBlumkinAKEdwardsKMStaatMAet al. The burden of respiratory syncytial virus infection in young children. New Engl J Med (2009) 360(6):588–98. doi: 10.1056/NEJMoa0804877
6
ThorburnK. Pre-existing disease is associated with a significantly higher risk of death in severe respiratory syncytial virus infection. Arch Dis Child. (2009) 94(2):99–103. doi: 10.1136/adc.2008.139188
7
RhaBCurnsATLivelyJYCampbellAPEnglundJABoomJAet al. Respiratory syncytial virus-associated hospitalizations among young children: 2015-2016. Pediatrics (2020) 146(1). doi: 10.1542/peds.2019-3611
8
GaregnaniLStyrmisdottirLRoson RodriguezPEscobar LiquitayCMEstebanIFrancoJV. Palivizumab for preventing severe respiratory syncytial virus (RSV) infection in children. Cochrane Database Syst Rev (2021) 11(11):CD013757. doi: 10.1002/14651858.CD013757.pub2
9
LunaMSManzoniPPaesBBaraldiECosseyVKugelmanAet al. Expert consensus on palivizumab use for respiratory syncytial virus in developed countries. Paediatr Respir Rev (2020) 33:35–44. doi: 10.1016/j.prrv.2018.12.001
10
ChatterjeeAMavundaKKrilovLR. Current state of respiratory syncytial virus disease and management. Infect Dis Ther (2021) 10(Suppl 1):5–16. doi: 10.1007/s40121-020-00387-2
11
American Academy of Pediatrics Committee on Infectious D, American Academy of Pediatrics Bronchiolitis Guidelines C. Updated guidance for palivizumab prophylaxis among infants and young children at increased risk of hospitalization for respiratory syncytial virus infection. Pediatrics. (2014) 134(2):e620–38. doi: 10.1542/peds.2014-1665
12
Garcia-GarciaMLCalvo ReyCDel Rosal RabesT. Pediatric asthma and viral infection. Arch Bronconeumol. (2016) 52(5):269–73. doi: 10.1016/j.arbres.2015.11.008
13
LambertLSagforsAMOpenshawPJCulleyFJ. Immunity to RSV in early-life. Front Immunol (2014) 5:466. doi: 10.3389/fimmu.2014.00466
14
ReicherzFXuRYAbu-RayaBMajdoubiAMichalskiCGoldingLet al. Waning immunity against respiratory syncytial virus during the COVID-19 pandemic. J Infect Dis (2022) 226(12):2064–8. doi: 10.1093/infdis/jiac192
15
OgilvieMMVathenenASRadfordMCoddJKeyS. Maternal antibody and respiratory syncytial virus infection in infancy. J Med Virol (1981) 7(4):263–71. doi: 10.1002/jmv.1890070403
16
BergeronHCTrippRA. Immunopathology of RSV: an updated review. Viruses. (2021) 13(12). doi: 10.3390/v13122478
17
TrippRAPowerUFOpenshawPJMKauvarLM. Respiratory syncytial virus: targeting the G protein provides a new approach for an old problem. J Virol (2018) 92(3). doi: 10.1128/JVI.01302-17
18
BergeronHCTrippRA. Breakthrough therapy designation of nirsevimab for the prevention of lower respiratory tract illness caused by respiratory syncytial virus infections (RSV). Expert Opin Investig Drugs (2022) 31(1):23–9. doi: 10.1080/13543784.2022.2020248
19
GriffinMPYuanYTakasTDomachowskeJBMadhiSAManzoniPet al. Single-dose Nirsevimab for prevention of RSV in preterm infants. New Engl J Med (2020) 383(5):415–25. doi: 10.1056/NEJMoa1913556
20
MazurNIHigginsDNunesMCMeleroJALangedijkACHorsleyNet al. The respiratory syncytial virus vaccine landscape: lessons from the graveyard and promising candidates. Lancet Infect Dis (2018) 18(10):e295–311. doi: 10.1016/S1473-3099(18)30292-5
21
AndersonLJJadhaoSJPadenCRTongS. Functional features of the respiratory syncytial virus G protein. Viruses. (2021) 13(7). doi: 10.3390/v13071214
22
BergeronHCTrippRA. RSV Replication, transmission, and disease are influenced by the RSV G protein. Viruses. (2022) 14(11). doi: 10.3390/v14112396
23
KauvarLMHarcourtJLHaynesLMTrippRA. Therapeutic targeting of respiratory syncytial virus G-protein. Immunotherapy. (2010) 2(5):655–61. doi: 10.2217/imt.10.53
24
TrippRAJonesLPHaynesLMZhengHMurphyPMAndersonLJ. CX3C chemokine mimicry by respiratory syncytial virus G glycoprotein. Nat Immunol (2001) 2(8):732–8. doi: 10.1038/90675
25
GreenGJohnsonSMCostelloHBrakelKHarderOOomensAGet al. CX3CR1 is a receptor for human respiratory syncytial virus in cotton rats. J Virol (2021) 95(16):e0001021. doi: 10.1128/JVI.00010-21
26
AndersonCSChirkovaTSlaunwhiteCGQiuXWalshEEAndersonLJet al. CX3CR1 engagement by respiratory syncytial virus leads to induction of nucleolin and dysregulation of cilia-related genes. J Virol (2021) 95(11). doi: 10.1128/JVI.00095-21
27
JohnsonSMMcNallyBAIoannidisIFlanoETengMNOomensAGet al. Respiratory syncytial virus uses CX3CR1 as a receptor on primary human airway epithelial cultures. PLoS pathogens. (2015) 11(12):e1005318. doi: 10.1371/journal.ppat.1005318
28
JeongKIPiepenhagenPAKishkoMDiNapoliJMGroppoRPZhangLet al. CX3CR1 is expressed in differentiated human ciliated airway cells and Co-localizes with respiratory syncytial virus on cilia in a G protein-dependent manner. PLoS One (2015) 10(6):e0130517. doi: 10.1371/journal.pone.0130517
29
KimSJooDHLeeJBShimBSCheonISJangJEet al. Dual role of respiratory syncytial virus glycoprotein fragment as a mucosal immunogen and chemotactic adjuvant. PLoS One (2012) 7(2):e32226. doi: 10.1371/journal.pone.0032226
30
ZhivakiDLemoineSLimAMorvaAVidalainPOSchandeneLet al. Respiratory syncytial virus infects regulatory b cells in human neonates via chemokine receptor CX3CR1 and promotes lung disease severity. Immunity. (2017) 46(2):301–14. doi: 10.1016/j.immuni.2017.01.010
31
HarcourtJLKarronRATrippRA. Anti-G protein antibody responses to respiratory syncytial virus infection or vaccination are associated with inhibition of G protein CX3C-CX3CR1 binding and leukocyte chemotaxis. J Infect diseases. (2004) 190(11):1936–40. doi: 10.1086/425516
32
HaynesLMJonesLPBarskeyAAndersonLJTrippRA. Enhanced disease and pulmonary eosinophilia associated with formalin-inactivated respiratory syncytial virus vaccination are linked to G glycoprotein CX3C-CX3CR1 interaction and expression of substance p. J Virol (2003) 77(18):9831–44. doi: 10.1128/JVI.77.18.9831-9844.2003
33
BakreAAHarcourtJLHaynesLMAndersonLJTrippRA. The central conserved region (CCR) of respiratory syncytial virus (RSV) G protein modulates host miRNA expression and alters the cellular response to infection. Vaccines. (2017) 5(3). doi: 10.3390/vaccines5030016
34
LiXQFuZFAlvarezRHendersonCTrippRA. Respiratory syncytial virus (RSV) infects neuronal cells and processes that innervate the lung by a process involving RSV G protein. J Virol (2006) 80(1):537–40. doi: 10.1128/JVI.80.1.537-540.2006
35
TrippRADakhamaAJonesLPBarskeyAGelfandEWAndersonLJ. The G glycoprotein of respiratory syncytial virus depresses respiratory rates through the CX3C motif and substance p. J Virol (2003) 77(11):6580–4. doi: 10.1128/JVI.77.11.6580-6584.2003
36
PolackFPIrustaPMHoffmanSJSchiattiMPMelendiGADelgadoMFet al. The cysteine-rich region of respiratory syncytial virus attachment protein inhibits innate immunity elicited by the virus and endotoxin. Proc Natl Acad Sci U S A. (2005) 102(25):8996–9001. doi: 10.1073/pnas.0409478102
37
BergeronHCKauvarLMTrippRA. Anti-G protein antibodies targeting the RSV G protein CX3C chemokine region improve the interferon response. Ther Adv Infect Dis (2023) 10:20499361231161157. doi: 10.1177/20499361231161157
38
TrippRA. Respiratory syncytial virus (RSV) modulation at the virus-host interface affects immune outcome and disease pathogenesis. Immune network. (2013) 13(5):163–7. doi: 10.4110/in.2013.13.5.163
39
JorqueraPAAndersonLTrippRA. Understanding respiratory syncytial virus (RSV) vaccine development and aspects of disease pathogenesis. Expert Rev Vaccines (2016) 15(2):173–87. doi: 10.1586/14760584.2016.1115353
40
ChoiYMasonCSJonesLPCrabtreeJJorqueraPATrippRA. Antibodies to the central conserved region of respiratory syncytial virus (RSV) G protein block RSV G protein CX3C-CX3CR1 binding and cross-neutralize RSV a and b strains. Viral Immunol (2012) 25(3):193–203. doi: 10.1089/vim.2011.0094
41
JorqueraPAOakleyKEPowellTJPalathNBoydJGTrippRA. Layer-By-Layer nanoparticle vaccines carrying the G protein CX3C motif protect against RSV infection and disease. Vaccines. (2015) 3(4):829–49. doi: 10.3390/vaccines3040829
42
JorqueraPAChoiYOakleyKEPowellTJBoydJGPalathNet al. Nanoparticle vaccines encompassing the respiratory syncytial virus (RSV) G protein CX3C chemokine motif induce robust immunity protecting from challenge and disease. PLoS One (2013) 8(9):e74905. doi: 10.1371/journal.pone.0074905
43
ZhangWChoiYHaynesLMHarcourtJLAndersonLJJonesLPet al. Vaccination to induce antibodies blocking the CX3C-CX3CR1 interaction of respiratory syncytial virus G protein reduces pulmonary inflammation and virus replication in mice. J Virol (2010) 84(2):1148–57. doi: 10.1128/JVI.01755-09
44
FulginitiVAEllerJJSieberOFJoynerJWMinamitaniMMeiklejohnG. Respiratory virus immunization. i. a field trial of two inactivated respiratory virus vaccines; an aqueous trivalent parainfluenza virus vaccine and an alum-precipitated respiratory syncytial virus vaccine. Am J Epidemiol. (1969) 89(4):435–48. doi: 10.1093/oxfordjournals.aje.a120956
45
ChinJMagoffinRLShearerLASchiebleJHLennetteEH. Field evaluation of a respiratory syncytial virus vaccine and a trivalent parainfluenza virus vaccine in a pediatric population. Am J Epidemiol. (1969) 89(4):449–63. doi: 10.1093/oxfordjournals.aje.a120957
46
KimHWCancholaJGBrandtCDPylesGChanockRMJensenKet al. Respiratory syncytial virus disease in infants despite prior administration of antigenic inactivated vaccine. Am J Epidemiol. (1969) 89(4):422–34. doi: 10.1093/oxfordjournals.aje.a120955
47
ElliottMBPryharskiKSYuQBoutilierLACampeolNMelvilleKet al. Characterization of recombinant respiratory syncytial viruses with the region responsible for type 2 T-cell responses and pulmonary eosinophilia deleted from the attachment (G) protein. J Virol (2004) 78(16):8446–54. doi: 10.1128/JVI.78.16.8446-8454.2004
48
CastilowEMOlsonMRVargaSM. Understanding respiratory syncytial virus (RSV) vaccine-enhanced disease. Immunol Res (2007) 39(1-3):225–39. doi: 10.1007/s12026-007-0071-6
49
Boyoglu-BarnumSToddSOMengJBarnumTRChirkovaTHaynesLMet al. Mutating the CX3C motif in the G protein should make a live respiratory syncytial virus vaccine safer and more effective. J Virol (2017) 91(10). doi: 10.1128/JVI.02059-16
50
HaBChirkovaTBoukhvalovaMSSunHYWalshEEAndersonCSet al. Mutation of respiratory syncytial virus G protein's CX3C motif attenuates infection in cotton rats and primary human airway epithelial cells. Vaccines (2019) 7(3). doi: 10.3390/vaccines7030069
51
BergeronHCMurrayJNunez CastrejonAMDuBoisRMTrippRA. Respiratory syncytial virus (RSV) G protein vaccines with central conserved domain mutations induce CX3C-CX3CR1 blocking antibodies. Viruses. (2021) 13(2). doi: 10.3390/v13020352
52
Nunez CastrejonAMO'RourkeSMKauvarLMDuBoisRM. Structure-based design and antigenic validation of respiratory syncytial virus G immunogens. J Virol (2022) 96(7):e0220121. doi: 10.1128/jvi.02201-21
53
Komai-KomaMJiYCaoHLiuZMcSharryCXuD. Monophosphoryl lipid a directly regulates Th1 cytokine production in human CD4(+) T-cells through toll-like receptor 2 and 4. Immunobiology. (2021) 226(5):152132. doi: 10.1016/j.imbio.2021.152132
54
ZakeriBFiererJOCelikEChittockECSchwarz-LinekUMoyVTet al. Peptide tag forming a rapid covalent bond to a protein, through engineering a bacterial adhesin. Proc Natl Acad Sci U S A. (2012) 109(12):E690–7. doi: 10.1073/pnas.1115485109
55
MurrayJBergeronHCJonesLPReenerZBMartinDESancilioFDet al. Probenecid inhibits respiratory syncytial virus (RSV) replication. Viruses (2022) 14(5). doi: 10.3390/v14050912
56
VillenaveRBroadbentLDouglasILyonsJDCoylePVTengMNet al. Induction and antagonism of antiviral responses in respiratory syncytial virus-infected pediatric airway epithelium. J Virol (2015) 89(24):12309–18. doi: 10.1128/JVI.02119-15
57
ZhangXMeiningWFischerMBacherALadensteinR. X-Ray structure analysis and crystallographic refinement of lumazine synthase from the hyperthermophile aquifex aeolicus at 1.6 a resolution: determinants of thermostability revealed from structural comparisons. J Mol Biol (2001) 306(5):1099–114. doi: 10.1006/jmbi.2000.4435
58
KeebleAHTurkkiPStokesSKhairil AnuarINARahikainenRHytonenVPet al. Approaching infinite affinity through engineering of peptide-protein interaction. Proc Natl Acad Sci U S A. (2019) 116(52):26523–33. doi: 10.1073/pnas.1909653116
59
MalonisRJGeorgievGIHaslwanterDVanBlarganLAFallonGVergnolleOet al. A powassan virus domain III nanoparticle immunogen elicits neutralizing and protective antibodies in mice. PLoS pathogens. (2022) 18(6):e1010573. doi: 10.1371/journal.ppat.1010573
60
FedechkinSOGeorgeNLNunez CastrejonAMDillenJRKauvarLMDuBoisRM. Conformational flexibility in respiratory syncytial virus G neutralizing epitopes. J Virol (2020) 94(6). doi: 10.1128/JVI.01879-19
61
FedechkinSOGeorgeNLWolffJTKauvarLMDuBoisRM. Structures of respiratory syncytial virus G antigen bound to broadly neutralizing antibodies. Sci Immunol (2018) 3(21). doi: 10.1126/sciimmunol.aar3534
62
TanTKRijalPRahikainenRKeebleAHSchimanskiLHussainSet al. A COVID-19 vaccine candidate using SpyCatcher multimerization of the SARS-CoV-2 spike protein receptor-binding domain induces potent neutralising antibody responses. Nat Commun (2021) 12(1):542. doi: 10.1038/s41467-020-20654-7
63
ShambaughCAzshirvaniSYuLPacheJLambertSLZuoFet al. Development of a high-throughput respiratory syncytial virus fluorescent focus-based microneutralization assay. Clin Vaccine Immunol (2017) 24(12). doi: 10.1128/CVI.00225-17
64
SnapperCMPaulWE. Interferon-gamma and b cell stimulatory factor-1 reciprocally regulate ig isotype production. Sci (New York NY). (1987) 236(4804):944–7. doi: 10.1126/science.3107127
65
BruhnsP. Properties of mouse and human IgG receptors and their contribution to disease models. Blood. (2012) 119(24):5640–9. doi: 10.1182/blood-2012-01-380121
66
ValenzuelaNMSchaubS. The biology of IgG subclasses and their clinical relevance to transplantation. Transplantation. (2018) 102(1S Suppl 1):S7–S13. doi: 10.1097/TP.0000000000001816
67
MalonisRJLaiJRVergnolleO. Peptide-based vaccines: current progress and future challenges. Chem Rev (2020) 120(6):3210–29. doi: 10.1021/acs.chemrev.9b00472
68
PowellTJJacobsATangJCardenasEPalathNDanielsJet al. Microparticle RSV vaccines presenting the G protein CX3C chemokine motif in the context of TLR signaling induce protective Th1 immune responses and prevent pulmonary eosinophilia post-challenge. Vaccines (2022) 10(12). doi: 10.3390/vaccines10122078
69
JonesHGRitschelTPascualGBrakenhoffJPJKeoghEFurmanova-HollensteinPet al. Structural basis for recognition of the central conserved region of RSV G by neutralizing human antibodies. PLoS pathogens. (2018) 14(3):e1006935. doi: 10.1371/journal.ppat.1006935
70
KishkoMCatalanJSwansonKDiNapoliJWeiCJDelagraveSet al. Evaluation of the respiratory syncytial virus G-directed neutralizing antibody response in the human airway epithelial cell model. Virology. (2020) 550:21–6. doi: 10.1016/j.virol.2020.08.006
71
RuckwardtTJMalloyAMGostickEPriceDADashPMcClarenJLet al. Neonatal CD8 T-cell hierarchy is distinct from adults and is influenced by intrinsic T cell properties in respiratory syncytial virus infected mice. PLoS pathogens. (2011) 7(12):e1002377. doi: 10.1371/journal.ppat.1002377
72
JoYMKimJChangJ. Vaccine containing G protein fragment and recombinant baculovirus expressing M2 protein induces protective immunity to respiratory syncytial virus. Clin Exp Vaccine Res (2019) 8(1):43–53. doi: 10.7774/cevr.2019.8.1.43
73
CheonISShimBSParkSMChoiYJangJEJungDIet al. Development of safe and effective RSV vaccine by modified CD4 epitope in G protein core fragment (Gcf). PLoS One (2014) 9(4):e94269. doi: 10.1371/journal.pone.0094269
74
AcostaPLCaballeroMTPolackFP. Brief history and characterization of enhanced respiratory syncytial virus disease. Clin Vaccine Immunol (2015) 23(3):189–95. doi: 10.1128/CVI.00609-15
75
CollinsPLGrahamBS. Viral and host factors in human respiratory syncytial virus pathogenesis. J Virol (2008) 82(5):2040–55. doi: 10.1128/JVI.01625-07
76
HallCBWalshEELongCESchnabelKC. Immunity to and frequency of reinfection with respiratory syncytial virus. J Infect diseases. (1991) 163(4):693–8. doi: 10.1093/infdis/163.4.693
77
SouzaAPLeitaoLALuisiFSouzaRGCoutinhoSESilvaJRet al. Lack of association between viral load and severity of acute bronchiolitis in infants. J Bras Pneumol (2016) 42(4):261–5. doi: 10.1590/s1806-37562015000000241
78
UusitupaEWarisMHeikkinenT. Association of viral load with disease severity in outpatient children with respiratory syncytial virus infection. J Infect diseases. (2020) 222(2):298–304. doi: 10.1093/infdis/jiaa076
79
BiacchesiSSkiadopoulosMHYangLLamirandeEWTranKCMurphyBRet al. Recombinant human metapneumovirus lacking the small hydrophobic SH and/or attachment G glycoprotein: deletion of G yields a promising vaccine candidate. J Virol (2004) 78(23):12877–87. doi: 10.1128/JVI.78.23.12877-12887.2004
80
CaidiHMiaoCThornburgNJTrippRAAndersonLJHaynesLM. Anti-respiratory syncytial virus (RSV) G monoclonal antibodies reduce lung inflammation and viral lung titers when delivered therapeutically in a BALB/c mouse model. Antiviral Res (2018) 154:149–57. doi: 10.1016/j.antiviral.2018.04.014
81
LeeHJLeeJYParkMHKimJYChangJ. Monoclonal antibody against G glycoprotein increases respiratory syncytial virus clearance In vivo and prevents vaccine-enhanced diseases. PLoS One (2017) 12(1):e0169139. doi: 10.1371/journal.pone.0169139
82
Boyoglu-BarnumSToddSOChirkovaTBarnumTRGastonKAHaynesLMet al. An anti-G protein monoclonal antibody treats RSV disease more effectively than an anti-f monoclonal antibody in BALB/c mice. Virology. (2015) 483:117–25. doi: 10.1016/j.virol.2015.02.035
83
Boyoglu-BarnumSChirkovaTToddSOBarnumTRGastonKAJorqueraPet al. Prophylaxis with a respiratory syncytial virus (RSV) anti-G protein monoclonal antibody shifts the adaptive immune response to RSV rA2-line19F infection from Th2 to Th1 in BALB/c mice. J Virol (2014) 88(18):10569–83. doi: 10.1128/JVI.01503-14
84
Boyoglu-BarnumSGastonKAToddSOBoyogluCChirkovaTBarnumTRet al. A respiratory syncytial virus (RSV) anti-G protein F(ab')2 monoclonal antibody suppresses mucous production and breathing effort in RSV rA2-line19F-infected BALB/c mice. J Virol (2013) 87(20):10955–67. doi: 10.1128/JVI.01164-13
85
RaduGUCaidiHMiaoCTrippRAAndersonLJHaynesLM. Prophylactic treatment with a G glycoprotein monoclonal antibody reduces pulmonary inflammation in respiratory syncytial virus (RSV)-challenged naive and formalin-inactivated RSV-immunized BALB/c mice. J Virol (2010) 84(18):9632–6. doi: 10.1128/JVI.00451-10
86
HigginsDTrujilloCKeechC. Advances in RSV vaccine research and development - a global agenda. Vaccine. (2016) 34(26):2870–5. doi: 10.1016/j.vaccine.2016.03.109
87
CollariniEJLeeFEFoordOParkMSperindeGWuHet al. Potent high-affinity antibodies for treatment and prophylaxis of respiratory syncytial virus derived from b cells of infected patients. J Immunol (Baltimore Md 1950). (2009) 183(10):6338–45. doi: 10.4049/jimmunol.0901373
88
FuentesSCoyleEMGoldingHKhuranaS. Nonglycosylated G-protein vaccine protects against homologous and heterologous respiratory syncytial virus (RSV) challenge, while glycosylated G enhances RSV lung pathology and cytokine levels. J Virol (2015) 89(16):8193–205. doi: 10.1128/JVI.00133-15
89
SwansonKARainho-TomkoJNWilliamsZPLanzaLPeredelchukMKishkoMet al. A respiratory syncytial virus (RSV) f protein nanoparticle vaccine focuses antibody responses to a conserved neutralization domain. Sci Immunol (2020) 5(47). doi: 10.1126/sciimmunol.aba6466
90
Garcia-MaurinoCMoore-ClingenpeelMThomasJMertzSCohenDMRamiloOet al. Viral load dynamics and clinical disease severity in infants with respiratory syncytial virus infection. J Infect diseases. (2019) 219(8):1207–15. doi: 10.1093/infdis/jiy655
91
JafriHSWuXMakariDHenricksonKJ. Distribution of respiratory syncytial virus subtypes a and b among infants presenting to the emergency department with lower respiratory tract infection or apnea. Pediatr Infect Dis J (2013) 32(4):335–40. doi: 10.1097/INF.0b013e318282603a
92
MejiasAHallMWRamiloO. Immune monitoring of children with respiratory syncytial virus infection. Expert Rev Clin Immunol (2013) 9(5):393–5. doi: 10.1586/eci.13.20
93
WarisMETsouCErdmanDDZakiSRAndersonLJ. Respiratory synctial virus infection in BALB/c mice previously immunized with formalin-inactivated virus induces enhanced pulmonary inflammatory response with a predominant Th2-like cytokine pattern. J Virol (1996) 70(5):2852–60. doi: 10.1128/jvi.70.5.2852-2860.1996
Summary
Keywords
RSV, G protein, structure-guided vaccine, nanoparticle vaccine, neutralizing Abs
Citation
Bergeron HC, Murray J, Juarez MG, Nangle SJ, DuBois RM and Tripp RA (2023) Immunogenicity and protective efficacy of an RSV G S177Q central conserved domain nanoparticle vaccine. Front. Immunol. 14:1215323. doi: 10.3389/fimmu.2023.1215323
Received
01 May 2023
Accepted
12 June 2023
Published
29 June 2023
Volume
14 - 2023
Edited by
Sujin Lee, Emory University, United States
Reviewed by
Larry J Anderson, Emory University, United States; W. Abdullah Brooks, Johns Hopkins University, United States
Updates
Copyright
© 2023 Bergeron, Murray, Juarez, Nangle, DuBois and Tripp.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Ralph A. Tripp, ratripp@uga.edu
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.