ORIGINAL RESEARCH article

Front. Microbiol., 31 March 2017

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 8 - 2017 | https://doi.org/10.3389/fmicb.2017.00544

The Naturally Occurring Host Defense Peptide, LL-37, and Its Truncated Mimetics KE-18 and KR-12 Have Selected Biocidal and Antibiofilm Activities Against Candida albicans, Staphylococcus aureus, and Escherichia coli In vitro

  • 1. Centre for Experimental Medicine, School of Medicine, Dentistry and Biomedical Sciences, Queen’s University Belfast Belfast, UK

  • 2. Centre for Public Health, School of Medicine, Dentistry and Biomedical Sciences, Queen’s University Belfast Belfast, UK

Abstract

Amongst the recognized classes of naturally occurring antimicrobials, human host defense peptides are an important group with an advantage (given their source) that they should be readily translatable to medicinal products. It is also plausible that truncated versions will display some of the biological activities of the parent peptide, with the benefit that they are less costly to synthesize using solid-phase chemistry. The host defense peptide, LL-37, and two truncated mimetics, KE-18 and KR-12, were tested for their inhibitory effects and antibiofilm properties against Candida albicans, Staphylococcus aureus, and Escherichia coli, microorganisms commonly implicated in biofilm-related infections such as ventilator-associated pneumonia (VAP). Using in silico prediction tools, the truncated peptides KE-18 and KR-12 were selected for minimum inhibitory concentration (MIC) and antibiofilm testing on the basis of their favorable cationicity, hydrophobic ratio, and amphipathicity compared with the parent peptide. Two methods were analyzed for determining peptide efficacy against biofilms; a crystal violet assay and an XTT [2,3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazolium-5-carboxanilide] assay. The biocidal activities (measured by MIC) and antibiofilm activities (measured by a crystal violet assay) appeared to be independent. LL-37 had no biocidal action against C. albicans (MIC > 250 μg/ml) but significant effects in both biofilm-prevention and biofilm-inhibition assays. KE-18 and KR-12 yielded superior MIC values against all three microorganisms. Only KE-18 had a significant effect in the biofilm-prevention assay, which persisted even at sub-MICs. Neither of the truncated peptides were active in the biofilm-inhibition assay. KE-18 was shown to bind lipopolysaccharide as effectively as LL-37 and to bind lipoteichoic acid more effectively. None of the peptides showed hemolytic activity against human erythrocytes at the concentrations tested. KE-18 should be considered for further development as a natural peptide-derived therapeutic for prevention of multi-species biofilm-related infections such as VAP.

Introduction

The continual challenge to provide new approaches to combat antimicrobial resistance has prompted a resurgence of interest in non-conventional treatments for infection (). Novel therapeutic strategies are particularly relevant for medical device–related infections, such as ventilator-associated pneumonia (VAP) because of the potential for coating/treating devices (such as endotracheal tubes) with antimicrobials to prevent biofilm formation before insertion in vivo. Interventions of this type could, therefore, preclude pathogenic microorganisms becoming established in endotracheal tube biofilms, which are known to develop rapidly after intubation (). The species diversity associated with VAP (; ; ) and the restricted potential for their eradication using conventional antibiotic treatments further emphasizes the need to investigate alternative therapeutic approaches for biofilm-prevention.

Antimicrobial peptides (AMPs) are naturally occurring antimicrobial agents, found in both the animal and plant kingdoms, with non-specific, immediate activities against a broad spectrum of microorganisms (Sang and Blecha, 2008). Several AMPs have been shown to have better antibiofilm activities than conventional antibiotics, owing to their rapid and broad-spectrum biocidal mechanisms, which appear to be effective against cells with low metabolic activities (). In addition, AMPs have also been shown to possess non-biocidal antibiofilm activities. For example, covalent immobilization of the AMP nisin onto a carbon-based surface was found to prevent the initial attachment of Staphylococcus aureus at concentrations below its minimal inhibitory concentration (MIC) (Qi et al., 2011). The 37-amino acid human cathelicidin, LL-37, has also been shown to have biofilm-prevention activities that are independent of its biocidal effects (Overhage et al., 2008).

In terms of generating novel peptides, both combinatorial () and rationally designed () approaches have been used successfully to produce novel peptide libraries for biological screening. However, much remains to be learned about the exact nature of the structure-sequence-activity relationships that govern antimicrobial bioactivity, and thus, it continues to be challenging to design and generate functional AMPs de novo. Optimization of selected natural peptides, including peptide fragments and altered sequences based on natural AMPs, has facilitated discovery of novel short AMPs and improved their activity, providing excellent leads for therapeutic intervention. In view of this, our research group and others have used truncation of naturally occurring AMPs from human (), animal (), plant (Remuzgo et al., 2014), and bacterial (Zhou et al., 2015) sources as templates for the design of novel antimicrobials. Truncation of natural AMPs not only takes advantage of their evolutionary bioactivity but also advances them toward peptide therapeutics, which should ideally be short and compositionally simple, in order to minimize solid-phase synthesis costs.

Evidence from structure–activity relationship studies has demonstrated the importance of key characteristics such as peptide hydrophobicity and cationicity, but there are few comprehensive rules for natural peptide truncation, since the amino-terminal, mid-region, and carboxy-terminal sections of individual peptides may have variable structural features and resulting biological activities. Thus, it is important to utilize in silico prediction packages to guide peptide truncation in order to facilitate retention/enhancement of bioactivity with lower production costs. Several research groups have shown that the antibacterial activity of LL-37 resides in its mid-region (; Nell et al., 2006; ) and thus truncation of this peptide could have particularly important cost benefits, given the expense of synthesizing a 37-mer peptide for therapeutic use. Stabilized LL-37 (D-enantiomer) as well as truncated mimetics of LL-37 have previously been shown to have antibiofilm activity against Pseudomonas aeruginosa (; Nagant et al., 2012), but there is no information on the bioactivity and biofilm-prevention/inhibitory properties of LL-37 and truncated mimetics against other lung pathogens.

In the current work, we studied the bioactivity and biofilm-prevention/inhibitory properties of LL-37, and two truncated peptides, KE-18, and KR-12 against Candida albicans, Staphylococcus aureus, and Escherichia coli. All three microorganisms have recently been implicated in VAP (), and C. albicans is of particular interest because fungal–bacterial interactions have the potential to modulate antibiotic efficacy (, ), which could compromise conventional antibiotic treatment of multi-species infections.

In this study, truncation of LL-37 was shown to yield superior MIC values for KE-18 and KR-12 against all three microorganisms tested, but only KE-18 proved efficacious in the biofilm-prevention assay, and neither of the truncated peptides were active in the biofilm-inhibition assay. Furthermore, truncation was shown to retain or improve indirect antimicrobial activities such as lipopolysaccharide (LPS)- and lipoteichoic acid (LTA)-binding efficacy. Truncated mimetics of LL-37, and in particular KE-18, should thus be considered for prevention of multi-species biofilm-related infections such as VAP.

Materials and Methods

Microorganism Strains

Escherichia coli ATCC 25922 (LGC Standards, Middlesex, UK) and S. aureus NCTC 6571 (Public Health England, Salisbury, UK) were maintained on Colombia blood agar plates (Fannin, Galway, Ireland), and C. albicans NCTC 3179 was maintained on Sabouraud agar plates, prepared in-house using Sabouraud dextrose liquid media (Oxoid, Thermo Fisher, Hampshire, UK) and agarose (Helena Biosciences Europe, Tyne and Wear, UK).

Peptides

LL-37 was supplied by Innovagen (Lund, Sweden). The truncated peptides KE-18 and KR-12 were custom synthesized by EZBiolab (Carmel, IN, USA) (Table 1).

Table 1

PeptideSequenceChargeMolecular massHydrophobic ratio
LL-37[LL-37, 37 aa]+64493.3335%
KE-18KEFKRIVQRIKDFLRNLV+42302.8044%
KR-12KRIVQRIKDFLR+41571.9341%

Amino acid sequences, overall net charge, and hydrophobic ratios of LL-37, KE-18, and KR-12 [charge and hydrophobic ratios were determined using the “calculation and prediction” feature of the Antimicrobial Peptide Database (http://aps.unmc.edu/AP/main.php)].

Radial-diffusion Assay for MIC Determination

A double-layer radial-diffusion assay was performed as previously described (McLean et al., 2013) to determine the MICs of LL-37, KE-18 and KR-12 against C. albicans, S. aureus, and E. coli. The underlay gel (10 ml) consisted of 1% (w/v) agarose containing approximately 4 × 105 yeast cells or 5 × 106 bacterial cells. Wells (2.5 mm in diameter) were punched in the agar, and 3 μl of peptide (0–250 μg/ml) was added prior to the addition of a nutrient-rich agarose over-layer (McLean et al., 2013). The plates were incubated for 18 h at 37°C and stained with a dilute solution of Coomassie brilliant blue R-250 as previously described (; McLean et al., 2013). The antimicrobial activities were expressed as MICs, determined as the x intercept obtained from the relationship between radial-diffusion units versus log10 peptide concentration (). The mean MICs were calculated from three replicate experiments.

Inoculum Preparation for Biofilms

An overnight culture of C. albicans was grown in yeast extract peptone dextrose (YPD) broth (US Biological Life Sciences, Marblehead, MA, USA). Following centrifugation and washing in phosphate-buffered saline (PBS), the pellet was re-suspended in Roswell Park Memorial Institute (RPMI) 1640 medium (Cellgro Mediatech Inc., Manassas, VA, USA) and diluted to an optical density of 0.05 (600 nm; ∼1.0 × 106 cells/ml) (Pierce et al., 2008). Inoculum preparations for S. aureus and E. coli were grown and diluted in brain-heart infusion (BHI) broth (Oxoid, Thermo Fisher, Hampshire, UK) to an optical density of 0.02 (600 nm; ∼5.0 × 106 cells/ml) (Wang et al., 2007; Müsken et al., 2010).

Biofilm-Prevention Assay

A biofilm-prevention assay was used to evaluate the ability of the peptides LL-37, KE-18, and KR-12 to prevent or reduce biofilm formation. Peptides were added to the inoculum preparations before addition to the wells of sterile, flat-bottomed, 96-well, microtiter plates (Nunc®, Sigma–Aldrich, Ayrshire, UK). Peptides were tested in the biofilm-prevention assay at either ×2 or at ×0.5 their MIC against the planktonic microorganism (Table 2). The only exception was LL-37, which was ineffective against C. albicans in the radial-diffusion assay, and thus, a concentration of twice the MIC of LL-37 against S. aureus was selected (i.e., 38.6 μg/ml; Table 2). Plates were then incubated at 37°C for 24 h to allow biofilm formation. Wells were washed three times with 200 μl PBS to facilitate removal of planktonic cells before quantification by the crystal violet assay or 2,3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazolium-5-carboxanilide (XTT) assay.

Table 2

MicroorganismMIC (μg/ml)

LL-37KE-18KR-12
C. albicans, NCTC 3179>25084 (±1)5 (±2)
S. aureus, NCTC 657119.3 (±5)7.2 (±0.6)8.4 (±6.3)
E. coli, ATCC 259229.8 (±5.4)2.1 (±1)2.1 (±0.7)

Minimum inhibitory concentration (MIC) values of LL-37, KE-18, and KR-12 against Candida albicans, Staphylococcus aureus, and Escherichia coli.

MIC values are the mean values (±SD) calculated from three individual radial-diffusion assays.

Biofilm-inhibition Assay

A biofilm-inhibition assay was used to evaluate the ability of LL-37, KE-18, and KR-12 to disrupt or inhibit the maturation of early biofilms. An overnight culture of microorganisms was prepared and diluted as described above. An initial biofilm was allowed to form for 4 hours, which has previously been shown to be sufficient for microbial attachment to plastic surfaces (; Pierce et al., 2008). Wells were then washed three times with 200 μl PBS to facilitate removal of planktonic cells before addition of peptides (at ×2 their MIC against each species except for LL-37 against C. albicans, as outlined above) in broth (100 μl). Plates were then incubated for further 24 h to allow biofilm maturation. Wells were washed, as outlined above, prior to biofilm quantification by the crystal violet assay or XTT assay.

Crystal Violet Assay

The crystal violet assay was used to quantify the total biomass of biofilms, including cells and the extracellular matrix (). After the final washing step to remove planktonic cells, the biofilm was fixed with methanol and stained with crystal violet (Clin-Tech Ltd, Guildford, UK). Crystal violet dye that had bound to biofilms was released by adding 160 μl of 33% acetic acid to each well, and optical density was measured at 570 nm using a microtiter plate reader (GENios, Tecan, Männedorf, Switzerland).

XTT Assay

XTT was used to measure the metabolic activity of cells within the biofilm. It was prepared as a saturated solution of 0.5 g/L in sterile RPMI, filter sterilized and stored at -70°C protected from light. 10 mM Menadione (Sigma-Aldrich, Ayrshire, UK) stock solution was prepared in 100% acetone and stored at -70°C. Menadione stock solution was added to XTT solution to make a XTT/menadione working solution containing 1 μM menadione; 100 μl XTT/menadione working solution was then added to prewashed biofilm well and negative control wells. Plates were incubated at 37°C for 2 h in the dark. A total of 80 μl of supernatant was then removed from each well for measurement of optical density at 490 nm (Pierce et al., 2008) using a microtiter plate reader (GENios, Tecan, Männedorf, Switzerland).

Confocal Imaging of Biofilms

Biofilms for confocal imaging were grown on transparent ThinCert inserts (0.4 μm diameter) placed in six-well plates (Greiner Bio-One, Frickenhausen, Germany). KE-18 (×2 MIC) was added to the S. aureus inoculum preparations (1 ml in BHI, prepared as above) before addition to the ThinCert inserts. A further 1 ml BHI was also added to the bottom of wells during biofilm formation on the insert at 37°C for 24 h. The insert was washed three times with PBS to facilitate removal of planktonic cells and then stained with the LIVE/DEAD®BacLight BacterialTM Viability Kit, (Invitrogen, Carlsbad, CA, USA) according to the manufacturer’s instructions. The insert was then viewed by confocal laser scanning microscopy (LEICA-SP5 confocal with Leica Application Suite Advanced Fluorescence software) at ×100 magnification.

LPS- and LTA-binding Assays

Escherichia coli LPS (Sigma–Aldrich, Ayrshire, UK) and S. aureus LTA (InvivoGen, San Diego, CA, USA) were biotinylated with biotin (long arm) hydrazide (Vector Laboratories, Peterborough, UK) using the biotin-labeling method outlined for glycoproteins as described by the manufacturer.

Peptide binding to biotinylated LPS was determined as previously described (McLean et al., 2013). Briefly, Greiner high-binding 96-well plates were coated with 100 μl of LL-37, KE-18, or KR-12 (6.25 μg/ml) in Voller’s buffer (26 mM Na2CO3, 23 mM NaHCO3, pH 9.6) overnight at 37°C. Plates were washed three times with Dulbecco’s PBS containing 0.05% Tween-20 (PBST) and blocked in PBST containing 1% (w/v) BSA for 1 h at room temperature. After washing three times with PBST, 100 μl of 1 ng/μl biotinylated E. coli LPS in PBS was added to each well and incubated at room temperature for 3 h with gentle agitation. Following three washes with PBST, detection of bound biotinylated LPS was achieved by adding 100 μl of streptavidin–horseradish peroxidase (BioLegend, London, UK), diluted 1:2000 in PBST for 30 min at room temperature. Following washing steps as above, peroxidase activity was detected with 2,2′-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) (ABTS; Invitrogen, Carlsbad, CA, USA; 100 μl/well) at 405 nm using a microtiter plate reader (GENios, Tecan, Männedorf, Switzerland).

Peptide binding to biotinylated LTA was determined as outlined above except that biotinylated LTA (1 ng/μl) was used in place of biotinylated LPS.

Hemolytic Assay

The hemolytic assay was employed to determine potential peptide cytotoxicty against human erythrocytes (collected with ethical permission). Briefly, LL-37, KE-18, and KR-12 (0–175 μg/ml; 100 μl in PBS) were tested for their ability to release hemoglobin from an 8% suspension of fresh human erythrocytes (100 μl). One percent Triton X-100 (100 μl; Sigma–Aldrich) and 100 μl PBS were used as positive and negative controls, respectively. Samples and controls were incubated at 37°C for 1 h and then centrifuged for 5 min before reading the absorbance of the supernatant at 450 nm in a microtiter plate reader (Tecan GENios). Peptides were analyzed in triplicate in three independent assays. The % hemolysis was calculated using the equation:

Statistical Analysis

Results for the antibiofilm properties of LL-37, KE-18, and KR-12 against C. albicans, S. aureus, and E. coli represent an average of three independent experiments and were subject to analysis by one-way ANOVA followed by Tukey’s post hoc correction for multiple comparisons. Results for the LPS- and LTA-binding efficacies of LL-37, KE-18, and KR-12 represent an average of three independent experiments and were also analyzed by one-way ANOVA followed by Tukey’s post hoc correction for multiple comparisons.

Results

Using in silico prediction software, truncation of LL-37 was shown to improve the hydrophobic ratio but decrease the charge of both KE-18 and KR-12 (Table 1). Helical wheel projection of LL-37, KE-18, and KR-12 showed that the truncated peptides displayed superior amphipathic helixes compared with the parent peptide (Figure 1). Truncation of LL-37 to KE-18 and KR-12 improved antimicrobial activity against C. albicans, S. aureus, and E. coli, as determined by radial-diffusion assays (Table 2).

FIGURE 1

Quantification of biofilm biomass with the crystal violet assay (Figure 2) showed that LL-37 had significant efficacy in preventing biofilm formation by C. albicans, S. aureus, and E. coli and was also effective against early biofilms of C. albicans and E. coli but was unable to inhibit early biofilms of S. aureus (Figure 2). KE-18 showed significant activity against C. albicans and S. aureus in the biofilm-prevention assay but not in any of the biofilm-inhibition assays (Figure 2). KR-12 showed no antibiofilm properties against C. albicans, S. aureus, or E. coli in either biofilm-prevention or -inhibition assays (Figure 2). When the efficacy of the AMP family was investigated using the XTT metabolic assay (Figure 3), the results showed considerable differences to those reported with the crystal violet assay, with LL-37 and KE-18 preventing biofilm formation against C. albicans only (Figure 3).

FIGURE 2

FIGURE 3

Given the activity of LL-37 and KE-18 in biofilm-prevention, both peptides were also tested to determine their antibiofilm activities at sub-MICs (Figure 4). LL-37 and the truncated peptide KE-18 were shown to be efficacious against C. albicans and S. aureus biofilms at sub-MIC (Figure 4), but neither peptide displayed sub-MIC antibiofilm activity against E. coli. Confocal imaging of KE-18-treated biofilms (Figure 5) showed that KE-18 appeared to prevent attachment of S. aureus [as shown by a decrease in green staining (live)] following treatment rather than by direct killing [no increase in red staining (dead) with KE-18 treatment]. Both KE-18 and KR-12 were shown to retain the LPS-binding activity of LL-37 (Figure 6). Furthermore, KE-18 displayed significantly enhanced LTA-binding activity, while KR-12 retained the weak LTA-binding activity of the parent peptide (Figure 7). All peptides showed minimal activity in the hemolytic assay against human erythrocytes, even at the highest concentration of 175 μg/ml tested (Table 3).

FIGURE 4

FIGURE 5

FIGURE 6

FIGURE 7

Table 3

Peptide/positive controlConcentrationAverage % hemolysis
LL-37175 μg/ml4.47 (±0.35)
KE-18175 μg/ml1.17 (±0.18)
KR-12175 μg/ml0.45 (±0.10)
Triton X-1001% (v/v)100

Hemolytic activities of LL-37, KE-18, and KR-12 against human erythrocytes.

% hemolysis is the mean value (±SD) calculated from three individual hemolytic assays.

Discussion

In the current study, we focused on truncation of the naturally occurring AMP, LL-37, to KE-18 and KR-12 and showed that KE-18 retained planktonic and antibiofilm efficacy against the VAP-associated microorganisms C. albicans, S. aureus, and E. coli. The antimicrobial activity of the majority of AMPs is believed to depend on a combination of interdependent structural parameters including cationicity, hydrophobicity, and amphipathicity (Yeaman and Yount, 2003). In the current work, the reduction in cationicity compared with LL-37 may have been offset by a slightly higher hydrophobic ratio for KE-18 and KR-12. Additionally, it is recognized that amphipathicity (separation of charged groups from hydrophobic residues on the peptide) promotes interaction with negatively charged microbial membranes and subsequent penetration into the hydrophobic lipid bilayer (). The peptide amphipathicity of KE-18 and KR-12, visualized by helical wheel projection, revealed that the truncated peptides displayed superior amphipathic helixes to LL-37, which may have contributed to their enhanced antimicrobial activity, as determined by radial-diffusion assay.

In previous studies, LL-37 was found to possess unique antibiofilm activities [against P. aeruginosa (Overhage et al., 2008), Staphylococcus epidermidis (), and Francisella novicida ()]. However, only one study has previously focused on the antibiofilm activities of LL-37-derived peptides generated by truncation of both the N- and C-terminals (against Acinetobacter baumannii; ). Our observations on the in vitro efficacy of LL-37, KE-18, and KR-12 against C. albicans, S. aureus, and E. coli biofilms provide further support for the concept that the antibiofilm activities of AMPs are generally independent of their antimicrobial activities against planktonic cells (Overhage et al., 2008).

Several databases have been established to collate AMP sequences. The novel antibiofilm properties of LL-37, KE-18, and KR-12 reported here will be added to a recently established database specifically for biofilm-active AMPs (BaAMPs; ). Further investigation, however, will be required to determine which features of the LL-37 parent molecule specifically contribute to its antibiofilm activities. In particular, it will be of interest to determine whether the amphipathic helix portion of the parent molecule, needed for interaction with bacterial membranes (Wang et al., 2012), is necessary for antibiofilm activity. Interestingly, both KE-18 and KR-12 are devoid of the first six amino acids of LL-37, which have previously been shown to contribute to the cytotoxicity of the parent peptide (Nagant et al., 2012). In the current study, peptide hemolytic activity against human erythrocytes was tested up to a concentration of 175 μg/ml [so as to exceed the X2 MIC value for KE-18 against C. albicans (168 μg/ml)]. There was minimal hemolysis (<5%) of human erythrocytes even at the top concentration, and many of the peptides were active at much lower concentrations (<50 μg/ml), which could enhance their therapeutic potential.

The formation of biofilms on endotracheal tubes is considered a reservoir for respiratory pathogens in VAP patients (Pneumatikos et al., 2009), and thus, the prevention of biofilm formation by LL-37 and KE-18 could potentially serve to limit respiratory infections. Indeed, it is recognized that novel antibiofilm therapeutics need not fully eradicate biofilms but rather, by serving to reduce or delay their formation, they could allow secondary immune responses a better chance of combating potential infections (Singh et al., 2002). It has been previously reported that at sub-inhibitory concentrations, some conventional antibiotics (including aminoglycosides, fluoroquinolones, and tetracycline) can actually stimulate bacterial biofilm formation on medical devices (; ). Thus, it was important to show that LL-37, KE-18, and KR-12 had no such effects on the biofilms tested. In fact, both LL-37 and KE-18 continued to exhibit significant sub-MIC antibiofilm activity against C. albicans and S. aureus.

The antibiofilm properties of novel antimicrobials have previously been reported using both the crystal violet assay (Overhage et al., 2008) and the XTT assay (Martinez and Casadevall, 2006), and indeed, the use of more than one bioassay has recently been recommended (Ramage, 2016). It is acknowledged that assays utilizing different mechanisms for biofilm assessment may produce conflicting results. Furthermore, it is recognized that antimicrobial treatments can increase metabolic activity in the absence of increased biofilm as a result of protease secretion or the pumping out antimicrobials (Zasloff, 2002). Our results for the peptide-treated wells in the XTT assay concur with increased metabolic activity rather than increased cell numbers, since on visual inspection, peptide-treated biofilms in both the crystal violet and XTT assays appeared similar.

Given that naturally occurring peptides have important roles in innate host defense (), it is important to consider potential indirect effects such as their immunomodulatory actions. We showed that KE-18 and KR-12 retained the LPS-binding activity of LL-37 and, furthermore, that truncation of LL-37 to KE-18 significantly improved its ability to bind LTA. Thus, by effectively binding both LPS and LTA, KE-18 could be particularly important in reducing TLR-2 and TLR-4 stimulation, thereby limiting host pro-inflammatory responses.

In addition to its antimicrobial activities, LL-37 has emerged as both a positive and negative modulator of tumor growth/metastasis depending on the tumor type (Wu et al., 2010). In vitro studies have shown that the anticancer activity of LL-37 resides along with its antimicrobial activity in the central amphipathic helix (). Indeed, fragments of LL-37, including a 25 amino peptide, IG-25 (corresponding to amino acids 13–37 in the parent LL-37 peptide) showed anticancer activity against human cancer cell lines in vitro (). It is tempting to speculate that KE-18 and KR-12 may also exhibit anticancer activity given that their sequences fall within the IG-25 peptide; however, further work will be required to fully investigate this potential.

Conclusion

In conclusion, we show, for the first time, the antimicrobial and antibiofilm properties of LL-37 and two truncated mimetics, KE-18 and KR-12, against the VAP-related microorganisms C. albicans, S. aureus, and E. coli. In light of the challenge of antimicrobial resistance, non-conventional treatments that may attenuate infection while conserving systemic antibiotics used for treatment, such as truncated AMPs, merit attention. In particular, KE-18 is promising in view of its favorable immunomodulatory and antibiofilm activities. Recent biofilm peptide immobilization approaches (; ) offer exciting possibilities for the prevention of biofilm infections on medical devices and provide proof of concept for immobilizing antibiofilm peptides such as KE-18.

Statements

Author contributions

YL and DM undertook all the laboratory investigations; YL, DM, GL, RM, DM, and FL analyzed the data. YL drafted the manuscript and the co-authors reviewed and edited it. FL, GL, RM, and DM obtained the funding for this work.

Funding

YL was supported by a Queen’s University Belfast International Ph.D. Scholarship and by the Health and Social Care Research and Development Office. DM was supported by a Ph.D. studentship from the Department for Education and Learning, Northern Ireland.

Acknowledgments

We thank Catherine Fulton for expert technical assistance.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  • 1

    AdairC.GormanS.ByersL.JonesD.GoldsmithC.MooreJ.et al (1999). Implications of endotracheal tube biofilm for ventilator-associated pneumonia.Int. Care Med.2510721076. 10.1007/s001340051014

  • 2

    AmerL.BishopB.van HoekM. (2010). Antimicrobial and antibiofilm activity of cathelicidins and short, synthetic peptides against Francisella.Biochem. Biophys. Res. Commun.396246251. 10.1016/j.bbrc.2010.04.073

  • 3

    AshbyM.PetkovaA.GaniJ.MikutR.HilpertK. (2016). Use of peptide libraries for identification and optimization of novel antimicrobial peptides.Curr. Top. Med. Chem.17537553. 10.2174/1568026616666160713125555

  • 4

    AzoulayE.TimsitJ.TaffletM.de LassenceA.DarmonM.ZaharJ.et al (2006). Candida colonization of the respiratory tract and subsequent Pseudomonas ventilator-associated pneumonia.Chest129110117. 10.1378/chest.129.1.110

  • 5

    CairnsS.ThomasJ.HooperS.WiseM.FrostP.WilsonM.et al (2011). Molecular analysis of microbial communities in endotracheal tube biofilms.PLoS ONE6:e14759. 10.1371/journal.pone.0014759

  • 6

    CoenyeT.PeetersE.NelisH. (2007). Biofilm formation by Propionibacterium acnes is associated with increased resistance to antimicrobial agents and increased production of putative virulence factors.Res. Microbiol.158386392. 10.1016/j.resmic.2007.02.001

  • 7

    CzaplewskiL.BaxR.ClokieM.DawsonM.FairheadH.FischettiV. A.et al (2016). Alternatives to antibiotics-a pipeline portfolio review.Lancet Infect. Dis.16239251. 10.1016/S1473-3099(15)00466-1

  • 8

    DaninP.GirouE.LegrandP.LouisB.FodilR.ChristovC.et al (2014). Description and microbiology of endotracheal tube biofilm in mechanically ventilated subjects.Res. Care602129. 10.4187/respcare.02722

  • 9

    DeanS. N.BishopB. M.van HoekM. L. (2011). Susceptibility of Pseudomonas aeruginosa biofilm to alpha-helical peptides: D-enantiomer of LL-37.Front. Microbiol.2:128. 10.3389/fmicb.2011.00128

  • 10

    Di LucaM.MaccariG.MaisettaG.BatoniG. (2015). BaAMPs: the database of biofilm-active antimicrobial peptides.Biofouling31193199. 10.1080/08927014.2015.1021340

  • 11

    DiamondG.BeckloffN.WeinbergA.KisichK. O. (2009). The roles of antimicrobial peptides in innate host defense.Curr. Pharm. Des.1523772392. 10.2174/138161209788682325

  • 12

    FengX.SambanthamoorthyK.PalysT.ParanavitanaC. (2013). The human antimicrobial peptide LL-37 and its fragments possess both antimicrobial and antibiofilm activities against multidrug-resistant Acinetobacter baumannii.Peptides49131137. 10.1016/j.peptides.2013.09.007

  • 13

    Fernandez-VidalM.JayasingheS.LadokhinA. S.WhiteS. H. (2007). Folding amphipathic helices into membranes: amphiphilicity trumps hydrophobicity.J. Mol. Biol.370459470. 10.1016/j.jmb.2007.05.016

  • 14

    GaoG.LangeD.HilpertK.KindrachukJ.ZouY.ChengJ. T.et al (2011). The biocompatibility and biofilm resistance of implant coatings based on hydrophilic polymer brushes conjugated with antimicrobial peptides.Biomaterials3238993909. 10.1016/j.biomaterials.2011.02.013

  • 15

    HarriottM. M.NoverrM. C. (2009). Candida albicans and Staphylococcus aureus form polymicrobial biofilms: effects on antimicrobial resistance.Antimicrob. Agents Chemother.5339143922. 10.1128/AAC.00657-09

  • 16

    HarriottM. M.NoverrM. C. (2010). Ability of Candida albicans mutants to induce Staphylococcus aureus vancomycin resistance during polymicrobial biofilm formation.Antimicrob. Agents Chemother.5437463755. 10.1128/AAC.00573-10

  • 17

    HeJ.YarbroughD. K.KrethJ.AndersonM. H.ShiW.EckertR. (2010). Systematic approach to optimizing specifically targeted antimicrobial peptides against Streptococcus mutans.Antimicrob. Agents Chemother.5421432151. 10.1128/AAC.01391-09

  • 18

    HellE.GiskeC.NelsonA.RömlingU.MarchiniG. (2010). Human cathelicidin peptide LL37 inhibits both attachment capability and biofilm formation of Staphylococcus epidermidis.Lett. Appl. Microbiol.50211215. 10.1111/j.1472-765X.2009.02778.x

  • 19

    HellyerT. P.MorrisA. C.McAuleyD. F.WalshT. S.AndersonN. H.SinghS.et al (2015). Diagnostic accuracy of pulmonary host inflammatory mediators in the exclusion of ventilator-acquired pneumonia.Thorax704147. 10.1136/thoraxjnl-2014-205766

  • 20

    HoffmannL. R.D’ArgenioD. A.MacCossM. J.ZhangZ.JonesR. A.MillerS. I. (2005). Aminoglycoside antibiotics induce bacterial biofilm formation.Nature43611711175. 10.1038/nature03912

  • 21

    JittikoonJ.NgamsaithongN.PimthonJ.VajraguptaO. (2015). Effect of N-terminal truncation on antibacterial activity, cytotoxicity and membrane perturbation activity of Cc-CATH3.Arch. Pharm. Res.3818391849. 10.1007/s12272-015-0600-0

  • 22

    JorgeP.LourençoA.PereiraM. (2012). New trends in peptide-based anti-biofilm strategies: a review of recent achievements and bioinformatic approaches.Biofouling2810331061. 10.1080/08927014.2012.728210

  • 23

    KanthawongS.BolscherJ. G.VeermanE. C.van MarleJ.de SoetH. J.NazmiK.et al (2012). Antimicrobial and antibiofilm activity of LL-37 and its truncated variants against Burkholderia pseudomallei.Int. J. Antimicrob. Agents393944. 10.1016/j.ijantimicag.2011.09.010

  • 24

    LehrerR. I.RosenmanM.HarwigS. S. S. L.JacksonR.EisenhauerP. (1991). Ultrasensitive assays for endogenous antimicrobial polypeptides.J. Immunol. Methods137167173. 10.1016/0022-1759(91)90021-7

  • 25

    LiX.LiY.HanH.MillerD.WangG. (2006). Solution structures of human LL-37 fragments and NMR-based identification of a minimal membrane-targeting antimicrobial and anticancer region.J. Am. Chem. Soc.12857765785. 10.1021/ja0584875

  • 26

    LiX.YanZ.XuJ. (2003). Quantitative variation of biofilms among strains in natural populations of Candida albicans.Microbiology149353362. 10.1099/mic.0.25932-0

  • 27

    LimK.ChuaR. R.BowH.TambyahP. A.HadinotoK.LeongS. S. (2015). Development of a catheter functionalized by a polydopamine peptide coating with antimicrobial and antibiofilm properties.Acta Biomater.15127138. 10.1016/j.actbio.2014.12.015

  • 28

    LinaresJ. F.GustafssonI.BaqueroF.MartinezJ. L. (2006). Antibiotics as intermicrobial signaling agents instead of weapons.Proc. Natl. Acad. Sci. U.S.A.1031948419489. 10.1073/pnas.0608949103

  • 29

    LundyF. T.NelsonJ.LockhartD.GreerB.HarriottP.MarleyJ. J. (2008). Antimicrobial activity of truncated alpha-defensin (human neutrophil peptide (HNP)-1) analogues without disulphide bridges.Mol. Immunol.45190193. 10.1016/j.molimm.2007.04.018

  • 30

    MartinezL.CasadevallA. (2006). Cryptococcus neoformans cells in biofilms are less susceptible than planktonic cells to antimicrobial molecules produced by the innate immune system.Infect. Immun.7461186123. 10.1128/IAI.00995-06

  • 31

    McLeanD. T.LundyF. T.TimsonD. J. (2013). IQ-motif peptides as novel anti-microbial agents.Biochimie95875880. 10.1016/j.biochi.2012.12.004

  • 32

    MüskenM.Di FioreS.RömlingU.HäusslerS. (2010). A 96-well-plate–based optical method for the quantitative and qualitative evaluation of Pseudomonas aeruginosa biofilm formation and its application to susceptibility testing.Nat. Protoc.514601469. 10.1038/nprot.2010.110

  • 33

    NagantC.PittsB.NazmiK.VandenbrandenM.BolscherJ. G.StewartP. S.et al (2012). Identification of peptides derived from the human antimicrobial peptide LL-37 active against biofilms formed by Pseudomonas aeruginosa using a library of truncated fragments.Antimicrob. Agents Chemother.5656985708. 10.1128/AAC.00918-12

  • 34

    NellM. J.TjabringaG. S.WafelmanA. R.VerrijkR.HiemstraP. S.DrijfhoutJ. W.et al (2006). Development of novel LL-37 derived antimicrobial peptides with LPS and LTA neutralizing and- antimicrobial activities for therapeutic application.Peptides27649660. 10.1016/j.peptides.2005.09.016

  • 35

    OverhageJ.CampisanoA.BainsM.TorfsE.RehmB.HancockR. (2008). Human host defense peptide LL-37 prevents bacterial biofilm formation.Infect. Immun.7641764182. 10.1128/IAI.00318-08

  • 36

    PierceC.UppuluriP.TristanA.WormleyF.MowatE.RamageG.et al (2008). A simple and reproducible 96-well plate-based method for the formation of fungal biofilms and its application to antifungal susceptibility testing.Nat. Protoc.314941500. 10.1038/nport.2008.141

  • 37

    PneumatikosI.DragoumanisC.BourosD. (2009). Ventilator-associated pneumonia or endotracheal tube-associated pneumonia?Anesthesiology110673680. 10.1097/ALN.0b013e31819868e0

  • 38

    QiX.PoernomoG.WangK.ChenY.Chan-ParkM.XuR.et al (2011). Covalent immobilization of nisin on multi-walled carbon nanotubes: superior antimicrobial and anti-biofilm properties.Nanoscale318741880. 10.1039/c1nr10024f

  • 39

    RamageG. (2016). Comparing apples and oranges: considerations for quantifying candida biofilms with XTT [2,3-bis(2-methoxy-4-nitro-5-sulfo-phenyl)-2H-tetrazolium-5-carboxanilide] and the need for standardized testing.J. Med. Microbiol.65259260. 10.1099/jmm.0.000237

  • 40

    RemuzgoC.OewelT. S.DaffreS.LopesT. R.DyszyF. H.SchreierS.et al (2014). Chemical synthesis, structure-activity relationship, and properties of shepherin I: a fungicidal peptide enriched in glycine-glycine-histidine motifs.Amino Acids4625732586. 10.1007/s00726-014-1811-2

  • 41

    SangY.BlechaF. (2008). Antimicrobial peptides and bacteriocins: alternatives to traditional antibiotics.Anim. Health Res. Rev.9227235. 10.1017/S1466252308001497

  • 42

    SinghP. K.ParsekM. R.GreenbergE. P.WelshM. J. (2002). A component of innate immunity prevents bacterial biofilm development.Nature417552555. 10.1038/417552a

  • 43

    WangC.LiM.DongD.WangJ.RenJ.OttoM.et al (2007). Role of ClpP in biofilm formation and virulence of Staphylococcus epidermidis.Microbes Infect.913761383. 10.1016/j.micinf.2007.06.012

  • 44

    WangG.ElliottM.CogenA. L.EzellE. L.GalloR. L.HancockR. E. W. (2012). Structure, dynamics, and antimicrobial and immune modulatory activities of human LL-23 and its single-residue variants mutated on the basis of homologous primate cathelicidins.Biochemistry51653664. 10.1021/bi2016266

  • 45

    WuW. K.WangG.CoffeltS. B.BetancourtA. M.LeeC. W.FanD.et al (2010). Emerging roles of the host defense peptide LL-37 in human cancer and its potential therapeutic applications.Int. J. Cancer12717411747. 10.1002/ijc.25489

  • 46

    YeamanM. R.YountN. Y. (2003). Mechanisms of antimicrobial peptide action and resistance.Pharmacol. Rev.552755. 10.1124/pr.55.1.2

  • 47

    ZasloffM. (2002). Antimicrobial peptides of multicellular organisms.Nature415389395. 10.1038/415389a

  • 48

    ZhouL.van HeelA. J.KuipersO. P. (2015). The length of a lantibiotic hinge region has profound influence on antimicrobial activity and host specificity.Front. Microbiol.6:11. 10.3389/fmicb.2015.00011

Summary

Keywords

antimicrobial peptide, biofilm, human, LL-37, KE-18

Citation

Luo Y, McLean DTF, Linden GJ, McAuley DF, McMullan R and Lundy FT (2017) The Naturally Occurring Host Defense Peptide, LL-37, and Its Truncated Mimetics KE-18 and KR-12 Have Selected Biocidal and Antibiofilm Activities Against Candida albicans, Staphylococcus aureus, and Escherichia coli In vitro. Front. Microbiol. 8:544. doi: 10.3389/fmicb.2017.00544

Received

07 October 2016

Accepted

15 March 2017

Published

31 March 2017

Volume

8 - 2017

Edited by

Yuji Morita, Aichi Gakuin University, Japan

Reviewed by

Osmar Nascimento Silva, Universidade Católica Dom Bosco, Brazil; Pedro Ismael Da Silva Junior, Instituto Butantan, Brazil; Leonard Girnita, Karolinska Institutet, Sweden

Updates

Copyright

*Correspondence: Fionnuala T. Lundy,

This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics