ORIGINAL RESEARCH article

Front. Microbiol., 29 July 2022

Sec. Microbe and Virus Interactions with Plants

Volume 13 - 2022 | https://doi.org/10.3389/fmicb.2022.943232

A novel of new class II bacteriocin from Bacillus velezensis HN-Q-8 and its antibacterial activity on Streptomyces scabies

  • 1. College of Plant Protection, Hebei Agricultural University, Baoding, China

  • 2. Technological Innovation Center for Biological Control of Crop Diseases and Insect Pests of Hebei Province, Baoding, China

  • 3. Experimental Training Center of Hebei Agricultural University, Baoding, China

  • 4. College of Environmental Science, Yangzhou University, Yangzhou, China

Abstract

Potato common scab is a main soil-borne disease of potato that can significantly reduce its quality. At present, it is still a challenge to control potato common scab in the field. To address this problem, the 972 family lactococcin (Lcn972) was screened from Bacillus velezensis HN-Q-8 in this study, and an Escherichia coli overexpression system was used to obtain Lcn972, which showed a significant inhibitory effect on Streptomyces scabies, with a minimum inhibitory concentration of 10.58 μg/mL. The stability test showed that Lcn972 is stable against UV radiation and high temperature. In addition, long-term storage at room temperature and 4°C had limited effects on its activity level. The antibacterial activity of Lcn972 was enhanced by Cu2+ and Ca2+, but decreased by protease K. The protein was completely inactivated by Fe2+. Cell membrane staining showed that Lcn972 damaged the cell membrane integrity of S. scabies. Scanning electron microscope (SEM) and transmission electron microscope (TEM) observations revealed that the hyphae of S. scabies treated with Lcn972 were deformed and adhered, the cell membrane was incomplete, the cytoplasm distribution was uneven, and the cell appeared hollow inside, which led to the death of S. scabies. In conclusion, we used bacteriocin for controlling potato common scab for the first time in this study, and it provides theoretical support for the further application of bacteriocin in the control of plant diseases.

Introduction

As a main soil-borne disease of potato, common scab has caused a serious deterioration in the quality of potato in recent years. Potato common scab can be caused by a variety of pathogenic Streptomyces, and S. scabies, S. acidiscabies, S. turgidiscabies, and S. ipomoeae are often found in the field (Shi et al., 2019). Among them, S. scabies is the most common pathogenic bacteria and can cause the most typical symptoms (Lin et al., 2018). At present, the effective control of common scab of potato is a huge challenge because conventional methods only reduce the abundance of pathogenic bacteria (Wanner, 2006; St-Onge et al., 2008; ; Zhang et al., 2016).

In recent years, bacteria such as Pseudomonas spp. and Bacillus spp. have been studied and used as bio-control agents for plant diseases (; ). showed that the control efficiency of Bacillus velezensis 8-4 against potato common scab reached 51.83 ± 8.53% in field experiments. Bacillus-based biological control become a focus in the prevention and control of potato common scab because of its high activity against the pathogenic bacteria, environmental friendliness, and broad antibacterial spectrum (Meng et al., 2016; Lin et al., 2018).

It is generally believed that the bio-control mechanism of Bacillus includes antibiosis, competition for nutrients and niches, for which antibiosis is an important way to exert its bio-control activity (). As a bio-control weapon, Bacillus can secrete antibacterial substances, such as lipopeptides, phenols, proteases, and short peptides. In total, 4.5–15.4% of the Bacillus genes are involved in producing anti-bacterial compounds (; Shafi et al., 2017). Among these compounds, bacteriocins have strong antibacterial activites. They are a kind of active polypeptide or precursor polypeptide, synthesized through the ribosomal pathway during bacterial metabolism, and it has a strong inhibitory effect on gram-positive bacteria (Yi et al., 2016; Garcia-Gutierrez et al., 2020). As a type of natural antibacterial substances, bacteriocins are considered promising alternatives to antibiotics and have broad application prospects in food, medicine, and agriculture because they are relatively safe to humans and animals, and they do not easily confer resistance in their targets (; Kamarajan et al., 2015; Kumariya et al., 2019).

Almost all bacteria can synthesize bacteriocins, thereby establishing a substantial basis for their development and application (Rooney et al., 2020). The molecular weight, activity and properties of different bacteriocins vary widely. They can be divided into lantibiotics and non-lantibiotics depending on whether the sequence contains the unusual amino acids lanthionine and methyllanthionine (Rizzello et al., 2014). In addition, bacteriocins can be divided into four classes based on differences in structure and properties (). Class I bacteriocins are post-translationally modified small linear peptides, usually less than 5 KD, with membrane activity. Class II bacteriocins are thermostable peptides with membrane activity and hydrophobic activity that are usually less than 10 KD. Class III bacteriocins are heat-sensitive macromolecule proteins that are usually more than 30 KD. Class IV bacteriocins are complex macromolecular bacteriocins, containing carbohydrate or lipid groups in addition to protein (Klaenhammer, 1993; Zou et al., 2018). Among them, Class I and II bacteriocins have been studied as food preservatives owing to their high activity and specificity to target strains (; Wiedemann et al., 2001).

The antibacterial mechanisms of bacteriocins such as nisin, sakacin, and pedioncin PA-1 from Escherichia coli and Lactococcus lactis have been revealed in depth. However, the antibacterial mechanisms of bacteriocins secreted by Bacillus still need further investigation (Todorov et al., 2011). The bacteriocins secreted by Bacillus are mainly Class I and II (), such as ericin S, BacBS2 and BLIS by B. velezensis and amylocyclicin, plantazolicin, and amysin by Bacillus amyloliquefaciens (Scholz et al., 2011, 2014; Kaewklom et al., 2013; Palazzini et al., 2016; ; Perumal et al., 2019; Vaca et al., 2019), which can cause cell membrane perforation, and increase the cell membrane permeability and leakage of cytoplasmic components, leading to bacterial death (Szabo and Cahill, 2002; Pandey et al., 2013; Kamarajan et al., 2015; Kumariya et al., 2015; ; O Connor et al., 2018). With the development of sequencing technology, many bacteriocins have been identified and studied, and the study of their antibacterial mechanisms is crucial for the further applications.

The antibacterial activities of bacteriocins have been broad applied in food preservation and feed additives (Mathur et al., 2018; Wang et al., 2021), whereas, the application of bacteriocins in the control of pathogenic bacteria in agriculture has only been rarely reported. Studying and utilizing bacteriocins in the control of plant diseases is of great significance to their development and application, as well as the bio-control of plant diseases. Bacillus velezensis HN-Q-8 was isolated from soil, and it has a strong antibacterial activity against S. scabies (Supplementary Figure 1). It can secrete various antagonistic substances, such as lipopeptides and proteins, and it showed strong bacteriostatic effects in both laboratory and field tests. In our study, we screened bacteriocin from B. velezensis HN-Q-8 for the treatment of potato common scab, and the results provide a material basis and theoretical support for the control of potato common scab.

Materials and methods

Screening of the bacteriocin

Gene clusters in B. velezensis HN-Q-8 (CP045711.1) were predicted by an online website tool antiSMASH1 to screen for bacteriocin-coding gene. The bacteriocin sequence was searched in Uniport2 and NCBI.3 Then phylogenetic tree of the bacteriocin sequence and its homologous gene sequences was constructed to classify the bacteriocin. The protein sequence of bacteriocin was compared with homologous bacteriocins secreted by other Bacillus.

Bacterial strains and culture conditions

The bacterial strains and the culture conditions used in this study are provided in Table 1, and the information of the bacterial strains are shown in Supplementary Table 1. All the bacterial strains were stored at −80°C in LB or water with 30% glycerol solution until use.

TABLE 1

Indicator strainsCulture mediumIncubation temperature
Bacillus pumilus G15LB37°C
Bacillus subtilis 3610LB37°C
Bacillus amyloliquefaciens Z17-2LB37°C
Bacillus atrophaeus YN-29LB37°C
Bacillus mycoides Y-7LB37°C
Bacillus licheniformis J-5LB37°C
Bacillus thuringiensis 2.19LB37°C
Bacillus cereus 2.15LB37°C
Bacillus velezensis FXLB37°C
Bacillus mojavensis C28LB37°C
Streptomyces turgidiscabies HY9Gauze’s synthetic broth medium/OMA28°C
Streptomyces stelliscabiei FN1Gauze’s synthetic broth medium/OMA28°C
Streptomyces scabies HP4Gauze’s synthetic broth medium/OMA28°C
Streptomyces europaeiscabiei MYGauze’s synthetic broth medium/OMA28°C
Pectobacterium brasiliense 412LB28°C
Pectobacterium atrosepticum B412LB28°C

Bacterial strains and culture conditions.

Production of bacteriocin

An E. coli expression system was used to obtain the recombinant bacteriocin. The bacteriocin-encoding gene was amplified from the genomic DNA of B. velezensis HN-Q-8 by PCR using the following primers pair: 5′-GGGAATTCCATATGTTGAAAAAGAAGGTTCTTGCT-3′/5′ -CCGCTCGAGTTTTGTATCCCAAAAAGCCTT-3′. The amplified fragment and the pET-30a vector were double digested using NdeI and XhoI endonucleases, and then ligated with pET-30a using T4 ligase. The bacteriocin was expressed from pET-30a in E. coli BL21 and then collected from the cell lysate supernatant (crude bacteriocin). The antibacterial activity of the cell lysate supernatant against S. scabies HP4 was tested using the agar well diffusion method (Parente et al., 1995). In total, 100 μL 1.0 × 107 CFU/mL of S. scabies HP4 spores were spread on oatmeal agar (OMA) solid medium. Then 6-mm hole was punched into the medium, and 70 μL cell lysate supernatant was added to the hole (Yi et al., 2018).

Purification and identification

The cell lysate supernatant was heated independently at 30, 40, 50, 60, 70, 80, 90, 100, and 121°C for 30 min and then centrifuged at 18,000 × g for 30 min. Then, the supernatant was filtered using a 0.22-μm filter (Jin Teng, China) and loaded on a Ni-NTA column (Solarbio, Beijing, China) (Jiang et al., 2021). Five column volumes of Buffer B (500 mM NaCl, 20 mM Tris–HCl, 10% glycerol, 80 mM imidazole, pH 8.0) were used to wash the column, and the bound bacteriocin was eluted using five column volumes of Buffer C (500 mM NaCl, 20 mM Tris–HCl, 10% glycerol, 500 mM imidazole, pH 8.0). The eluted protein was verified using 15% SDS-PAGE. Finally, eluted protein fractions were dialyzed using a dialysis bag with MW 3,500 (Solarbio, Beijing, China) in Buffer A (500 mM NaCl, 20 mM Tris–HCl, 10% glycerol, pH 8.0). Purified bacteriocin was verified by LC-MS/MS analysis (Sangon Biotech, Shanghai, China).

Antibacterial spectrum of the bacteriocin

The antibacterial spectrum of the bacteriocin was determined using Bacillus spp., Streptomyces spp., and Pectobacterium spp., which are listed in Table 1. In total, 100 μL 1.0 × 109 CFU/mL of Bacillus spp. and Pectobacterium spp. were spread on LB agar plates, independently. And 100 μL 1.0 × 107 CFU/mL of Streptomyces spp. spores were spread on OMA agar plates. The bacteriocin activity was tested using the agar well diffusion method, in which 70 μL of bacteriocin was added into 6-mm hole in the solid medium (Zhang et al., 2018).

Minimum inhibitory concentration and optimal inhibitory concentration of the bacteriocin

The bacteriocin was diluted independently 10-fold and 2-fold with Buffer A, and then, the minimum inhibitory concentration (MIC) and optimal inhibitory concentration were determined using the agar well diffusion method. In total, 106 CFU of S. scabies HP4 spores were spread on OMA solid medium, and 6-mm holes were punched into the agar. The holes were filled with 70 μL Lcn972. After the plates were incubated at 28°C for 7 days, the diameters of the inhibition zones were measured. MIC was defined as the minimum concentration of bacteriocin that formed a zone of inhibition on OMA solid medium (). The optimal inhibitory concentration was defined as the concentration at which the zone of inhibition no longer increased significantly with increasing concentrations of bacteriocin on OMA agar plates.

Stability of the bacteriocin

To evaluate the stability of bacteriocin, we tested the effects of salt concentration, pH, UV, proteases, and metal ions on the activity of bacteriocin, as follows:

To determine the effects of salinity, 7, 11, 15, 19, 23, 27, and 31% (m/V) NaCl solutions were prepared and mixed with bacteriocin (3% NaCl in Buffer A) in equal volumes to prepare final concentrations of 5, 7, 9, 11, 13, 15, and 17% NaCl solution environments, respectively. Then the antibacterial activities of bacteriocins in different NaCl solutions against S. scabies HP4 were determined to clarify the effect of NaCl concentration on the activity of bacteriocin. Bacteriocin added sterile water was used as positive control (CK), and the same concentrations of NaCl were used as negative controls.

The pH of bacteriocin was adjusted to 3, 4, 5, 6, 7, 8, 9, 10, and 11 using 5 mol/L HCl and NaOH solutions. The samples were then incubated at 37°C for 30 min, and then, the pH was adjusted back to eight. The stability of bacteriocin in acid and base conditions was then determined.

To reveal the sensitivity of bacteriocin to various proteases, trypsin, pepsin, proteinase K, alkaline protease, papain, and chymotrypsin were selected. The proteases were each mixed to a final concentration of 2 mg/mL with bacteriocin. The samples were incubated at 37°C for 30 min and then at 100°C for 10 min to inactivate the protease. Bacteriocin without protease was used as a control.

In total, 1 moL/L FeSO4, CaCl2, MgSO4, ZnSO4, MnSO4, CuSO4, and KCl were prepared and independently added to bacteriocin (producing a final concentration of 10 mmol/L) to reveal the sensitivity of bacteriocin to metal ions.

Additionally, to evaluate the sensitivity of bacteriocin to storage, the bacteriocin was stored at 4°C and room temperature for 16 days. The untreated bacteriocin was used as a control.

After the above treatments, the residual activities of all the samples were determined using the agar well diffusion method with S. scabies HP4 as the indicator strain.

Cell membrane integrity

Streptomyces scabies HP4 was cultured in Gauze’s synthetic broth medium for 5 days at 28°C, centrifuged at 18,000 × g for 10 min to collect mycelium. The collected mycelium was suspended in 1 × phosphate buffer saline (PBS), added bacteriocin with a final concentration of 2 × MIC, incubated at 28°C for 3 h, then the mycelium was washed and resuspended in 1 × PBS. Then DiSC3-(5) was added into the mycelium to a final concentration of 30 μmol/L and incubated for 5 min until maximum absorption. The fluorescence intensity was observed under the excitation wavelength of 651 nm and the emission wavelength of 675 nm using a laser confocal microscope (Olympus, Tokyo, Japan). The mycelium added Buffer A as negative control, and kanamycin and Triton X-100 as positive controls.

Scanning electron microscope and transmission electron microscope

Scanning electron microscope (SEM) and transmission electron microscope (TEM) were performed to monitor the morphological and structural changes of S. scabies HP4 cells after being treated with 9 × MIC of bacteriocin on OMA solid medium. For the SEM analysis, S. scabies HP4 was sampled at the edge of the inhibition zone, in the inhibition zone and in the non-inhibition zone on OMA solid medium. Each sample was fixed in 2.5% glutaraldehyde for 4 h, then dehydrated in ethanol and tert-butanol, respectively, and finally, the samples were freeze-dried and sputter-coated with gold. Photomicrographs of cells were observed using a ThermoFisher Prisma E Scanning Electron Microscope (ThermoFisher, MA, United States). For the TEM, the samples were fixed in 2.5% glutaraldehyde and 1% osmic acid and then dehydrated in ethanol. Afterward, the samples were permeated in resin and cut into sections. They were stained with 2% uranyl acetate and lead citrate. The sections were observed using a Hitachi H-7650 Transmission Electron Microscope (Hitachi, Tokyo, Japan).

Effect of Streptomyces scabies HP4 on the expression of the bacteriocin

In total, 15 mL supernatant of S. scabies HP4 (cultured in Gauze’s synthetic broth medium) was added to 100 mL culture solution of B. velezensis HN-Q-8 and incubated at 37°C for 24 h. The relative expression of the bacteriocin was determined at 6 and 24 h using the following primer pair: 5′-CAGTCAGTCGAACGATGTCAA-3′/5′-TCGAAGCCATGATACCAAGT-3′.

Statistical analysis

The data from experiments were calculated by measuring three independent replicates using IBM SPSS Statistics 19.0. A one-way analysis of variance was used to analyze the significance levels of the differences between the means. In all the analysis, a P-value of 0.05 was considered significant.

Results

Obtaining of the bacteriocin

Prokaryotic expression of the bacteriocin

By analyzing the gene clusters of B. velezensis HN-Q-8 (Supplementary Figure 2A), a RiPP-like encoding sequence in Region 6 was found (Supplementary Figures 2B,C). The details of RiPP-like encoding sequence were analyzed (Supplementary Figure 2D), and a sequence homolog of 972 family Lactococcin (Lcn972) was identified (LKKKVLASIVLGIGLLGGQAAFASQSNDVNHGEVNLDESR DLMSAMKLDKSTPGGGTWYHGFEKGRVHSNYNHKKKT HKSSAAAGARFYETQWNTKDEGYTYASVYETLFGNKAFW DTK) (Figure 1A). The sequence of Lcn972 in B. velezensis HN-Q-8 was obviously mutated compared with the bacteriocins’ sequences of 972 family members secreted by other Bacillus (Figure 1B).

FIGURE 1

Lcn972 was cloned, double-enzyme digested (Figure 2A) and ligated into pET-30a to construct pET-30a-Lcn972. pET-30a-Lcn972 was transformed into E. coli DH5α competent cells, and then, the plasmid was extracted and verified by double-enzyme digestion (Figure 2B). Sequencing was performed to detect whether the sequence was mutated, and then, pET-30a-Lcn972 was transformed into E. coli DE3 BL21 competent cells. The overexpressed protein band was observed on SDS-PAGE after inducible expression (Figure 2C).

FIGURE 2

Determination of the activity of Lcn972 against Streptomyces scabies

Total protein containing Lcn972 (crude bacteriocin Lcn972) of the E. coli BL21 was extracted, and the antibacterial activity against S. scabies HP4 was determined (Supplementary Figure 3). The total protein containing Lcn972 had a strong bacteriostatic activity on S. scabies HP4, whereas the protein without Lcn972 showed no bacteriostatic effect on S. scabies HP4.

Purification of Lcn972

The purification was first carried out by heating, as shown in Figure 2D. As the temperature increased from 30 to 90°C, the amount of the Lcn972 decreased, while the content of the Lcn972 increased when temperatures greater than 100°C. After 121°C heating for 30 min, Lcn972 alone could be seen on the SDS-PAGE. The antibacterial activity of Lcn972 treated at different temperatures against S. scabies HP4 increased at temperatures less than 50°C, and then decreased and finally increased again. The activity of Lcn972 was fully retained after heating to 121°C (Figure 2F). Then, Lcn972 was purified using nickel column affinity chromatography, as shown in Figure 2E, the purity and concentration of Lcn972 were great enough to determine the antibacterial activity.

Antibacterial spectrum of Lcn972

To reveal the effect of Lcn972 on soil bio-control bacteria and pathogenic bacteria, the antibacterial activities against Bacillus spp., Streptomyces spp., and Pectobacterium spp. were determined. As shown in Table 2 and Supplementary Figure 4, Lcn972 showed significantly antibacterial activities against gram-positive Bacillus spp. and Streptomyces spp., but no activity against Pectobacterium spp.

TABLE 2

Indicator strainsInhibition zone diameterInhibitory effect
Bacillus pumilus G159.08 ± 0.14+
Bacillus subtilis 361015.08 ± 1.42++
Bacillus amyloliquefaciens Z17-211.67 ± 1.26++
Bacillus atrophaeus YN-2912.25 ± 0.35++
Bacillus mycoides Y-78.58 ± 0.80+
Bacillus licheniformis J-512.25 ± 0.43++
Bacillus thuringiensis 2.198.17 ± 0.29+
Bacillus cereus 2.154.67 ± 0.14+
Bacillus velezensis FX14.50 ± 0.90++
Bacillus mojavensis C2815.00 ± 0.50++
Streptomyces turgidiscabies HY918.92 ± 0.80++
Streptomyces stelliscabiei FN119.92 ± 0.95++
Streptomyces europaeiscabiei MY22.00 ± 1.00+++
Pectobacterium brasiliense
Pectobacterium atrosepticum

Antibacterial activity of Lcn972 against bacteria.

Values are presented as the means ± standard deviations (n = 3). “+” indicates antibacterial activity and “−” indicates no antibacterial activity.

Minimum inhibitory concentration and optimal inhibitory concentration of Lcn972

The MIC and optimal inhibitory concentration of Lcn972 against S. scabies HP4 were determined by serial dilution. The MIC was 10.58 μg/mL (Figure 2G), and the optimal inhibitory concentration was 95.22 μg/mL (9 × MIC) (Figure 2H).

Sensitivity of Lcn972

Effects of NaCl concentration on the antibacterial activity of Lcn972

To reveal the effects of salt concentration on the activity of Lcn972, Lcn972 was treated with different concentrations of NaCl. The results are as shown in Figure 3A. As the NaCl concentration increased, the antibacterial activity of Lcn972 against S. scabies HP4 increased first, then decreased and finally increased again. Lcn972 showed its strongest antibacterial activity at a 7% NaCl concentration, with an increase of 12.50% compared with the control. This indicated that 7% NaCl was the optimal concentration for Lcn972 to exert its activity. Although the activity of Lcn972 increased when the NaCl concentration was 17%, there was an inhibitory effect of the high NaCl concentration on S. scabies HP4 (Supplementary Figure 5).

FIGURE 3

Effect of pH on the antibacterial activity of Lcn972

The antibacterial activity of Lcn972 on S. scabies HP4 after being treated at different pH levels was determined. The results are shown in Figure 3B. Lcn972 was stable in both strong acid and strong basic conditions, and the antibacterial activity of Lcn972 did not change significantly.

Sensitivity of Lcn972 to UV light

Lcn972 still maintained a strong antibacterial activity after UV irradiation (Figure 3C). As the UV irradiation time increased, the antibacterial activity of Lcn972 against S. scabies HP4 decreased slightly. Compared with the control, the antibacterial activity still maintained a 96.71% level after UV irradiation for 3 h, which indicated that Lcn972 is not a UV-sensitive bacteriocin.

Sensitivity of Lcn972 to proteases

To clarify the sensitivity of Lcn972 to proteases, Lcn972 was treated with six different proteases independently, and then, the antibacterial activity against S. scabies HP4 was determined. As shown in Figure 3D, the activity of Lcn972 treated with proteinase K was significantly reduced, decreasing by 12.56% compared with the control. In addition, the antibacterial activity decreased by 7.43 and 6.91% after treatment with papain and alkaline protease, respectively. The other proteases had limited effects on the antibacterial activity of Lcn972.

Sensitivity of Lcn972 to metal ions

Metal ions have a significant effect on protein activity (Figure 3E). In our study, Lcn972 was completely inactivated by Fe2+. In addition, Zn2+ and K+ significantly reduced the bacteriostatic activity of Lcn972, to 73.86 and 94.60%, respectively. However, the antibacterial activity of Lcn972 was significantly enhanced by Ca2+ and Cu2+, and the relative antibacterial activities increased to 113.54 and 127.79%, respectively. Other metal ions had no significant effects on the activity of Lcn972.

Effect of storage on the activity of Lcn972

To clarify the effect of storage on the antibacterial activity of Lcn972 against S. scabies HP4, Lcn972 was stored at room temperature and 4°C and its activity was examined. As shown in Figure 4, the antibacterial activity against S. scabies HP4 was not notably reduced after storage at room temperature and 4°C for 16 days. Compared with the control, the antibacterial activity of Lcn972 against S. scabies HP4 storage at room temperature and 4°C decreased to 95.55 and 94.70%, respectively. This indicated that Lcn972 was stable after purification and can handle long-term storage.

FIGURE 4

Antibacterial mechanism of Lcn972

To clarify the anti-bacterial mechanism of Lcn972 on S. scabies, the effect of Lcn972 on the integrity of the cell membrane was detected. The cell membrane of S. scabies HP4 was stained with DiSC3-(5), and the fluorescence of S. scabies were enhanced compared with the control after treatment with Lcn972 (Figure 5). This indicated that Lcn972 reduced the integrity of the cell membrane of S. scabies HP4.

FIGURE 5

To further reveal the effects of Lcn972 on the cell structure of S. scabies, SEM and TEM were used to observed S. scabies HP4 treated with Lcn972. As shown in Figure 6, the hyphae of S. scabies HP4 were deformed, bent and shrunken. Additionally, the hyphae were adhered and seriously sunken. The growth of S. scabies was inhibited after being treated with Lcn972. The hyphae of the control were straight, with less curl and depression. The TEM revealed that the cell structure of S. scabies not treated with Lcn972 was compact, the cytoplasm was evenly distributed, and the membrane structure was complete (Figure 7A). Significant changes were found in the interiors of cells treated with Lcn972. The cytoplasmic distribution of S. scabies HP4 was uneven, the cell membrane was incomplete, and the cell structure was severely damaged (Figure 7B). This indicated that Lcn972 damaged both the cell interior and cell membrane of S. scabies HP4 cells.

FIGURE 6

FIGURE 7

Effect of Streptomyces scabies on the expression of Lcn972

The supernatant of S. scabies HP4 was added to LB broth to culture B. velezensis HN-Q-8. Then, the relative expression level of Lcn972 from B. velezensis HN-Q-8 was determined in the logarithmic growth phase (6 h) and stationary phase (24 h). As shown in Figure 8, the expression of Lcn972 was significantly up-regulated at 24 h, which indicated that S. scabies stimulated B. velezensis to secrete more bacteriocin.

FIGURE 8

Discussion

Bacteriocins are considered as one of the best candidates to replace antibiotics (Tang et al., 2022), and they have been widely used in food preservation (). In recent years, there have been many studies of bacteriocins in food and medicine (; ; Gharsallaoui et al., 2013), but few applications to control plant pathogenic microbes. In our study, a 972 family lactococcin was found in B. velezensis HN-Q-8 and overexpressed in an E. coli expression system. Lcn972 was purified, and the antibacterial activity was tested. It showed a strong antibacterial activity against S. scabies. In addition, the stability of Lcn972 was tested, and the antibacterial mechanism of Lcn972 was initially revealed. In this study, bacteriocin was applied in the treatment of potato common scab for the first time, providing a new manner for the prevention and treatment of potato common scab.

The stability levels of bacteriocins determine whether they can fully exert theirs bacteriostatic activities and have wide applications. Lcn972 was stable at high temperatures (Figures 2D,F), and it maintained a strong activity after heating for 30 min at 121°C, which was similar to the study by Qiao et al. (2020). Generally, Class II bacteriocins have strong thermal stability (), and Lcn972 is a Class II bacteriocin secreted by B. velezensis. Thus, it conforms to the characteristics of Class II bacteriocins. In addition, bacteriocins are highly sensitive to proteases, which can reduce the activity of bacteriocins or even completely inactivate them (Gao et al., 2010; Hammami et al., 2012; Lee and Chang, 2018; Qin et al., 2019). We determined the effects of six proteases on the activity of Lcn972 (Figure 3D). The activity of Lcn972 was significantly reduced after treatments with proteinase K, papain and alkaline protease, which was similar to previous reports. However, Lcn972 was insensitive to pepsin in our study, which may be a result of the non-acidic experimental environmental conditions (Stanforth et al., 2022).

Metal ions usually have effects on protein activity (; Kluska et al., 2018; Grazioso et al., 2020); therefore, we determined the effects of different metal ions on the activity of Lcn972 (Figure 3E). Fe2+ completely inhibited the antibacterial activity of Lcn972, whereas Cu2+ and Ca2+ significantly enhanced the antibacterial activity of Lcn972. Metal ions can change the conformational of a protein, which can reduce its activity, or they can act as cofactors to stabilize or even enhance protein activity (; Kutyshenko et al., 2019). For example, Ansari found that Cu2+ causes the inactivation of bacteriocin (), whereas Yao found that metal ions, such as Mn2+, Mg2+, and Ca2+, significantly enhance protein activity (Yao et al., 2019). In our study, Cu2+ and Ca2+ may act as cofactors of Lcn972, whereas, Fe2+ may destroy the active center of Lcn972.

Additionally, the stability during the storage period is also an important factor in determining whether Lcn972 can be applied to the control of plant diseases. Lcn972 in our study was stable both at room temperature and 4°C (Figure 4), which may be related to our purification method. In this study, heating at 121°C was used for purification. At this temperature most proteins do not maintain their activity; therefore, there was almost no active protein remaining to degrade Lcn972.

The antibacterial mechanisms of bacteriocins differ owing to their unique structures. To date, the antibacterial mechanisms reported for bacteriocins mainly involve cell membrane perforation and the cytoplasmic leakage of the target strains, resulting in the disappearance of the proton-driven potential, thereby causing the death of the target strains (Kumariya et al., 2015; Soltani et al., 2020). Although most bacteriocins cause cell membrane perforation, their targets differ. For example, the most well-studied Class I bacteriocin nisin targets lipid II on the cell membrane (Webber et al., 2021), whereas, the targets of Class II bacteriocins are proteins related to cell membrane formation, including mannose permease, ABC transporter and undecylenyl pyrophosphate phosphatase (Suganthi and Mohanasrinivasan, 2014; ; Soltani et al., 2020). In addition, Class II bacteriocins also affect RNA transcription and translation (Wang et al., 2019). In our study, Lcn972 not only damaged the cell membrane of S. scabies HP4, it also caused the deformation and adhesion of the hyphae, as well as damaging the cell structure of S. scabies HP4. This indicated that the antibacterial mechanism of Lcn972 damaged the membrane structure of S. scabies HP4, resulting in the destruction of the cell structure, thereby causing its death (Figures 6, 7). However, the target of Lcn972 needs to be further explored.

Bacillus can sense the presence of bacteria or fungi, resulting in the increased production of antibacterial substances to enhance its chance to survival (Stubbendieck and Straight, 2017). Stefanie et al. found that fungi competition enhances the production of fengycin and surfactin by B. subtilis (). Similarly, we found the expression of Lcn972 in B. velezensis HN-Q-8 was up-regulated in the presence of S. scabies HP4 (Figure 8B), which indicated that B. velezensis HN-Q-8 sensed S. scabies HP4 and consequently produce more Lcn972.

In conclusion, a 972 family bacteriocin Lcn972, from B. velezensis HN-Q-8 was studied, and it showed a strong antibacterial activity against S. scabies HP4 and insensitive to high temperature and UV. Additionally, Lcn972 can be stored at room temperature for a long time. Lcn972 disrupted the cell structure of S. scabies, resulting in cell death. Furthermore, the expression of Lcn972 in B. velezensis HN-Q-8 was upregulated when it sensed S. scabies. In the future, research will focus on searching for the target of Lcn972 and on applying Lcn972 in the control of potato common scab.

Statements

Data availability statement

The original contributions presented in this study are included in the article/Supplementary material, further inquiries can be directed to the corresponding authors.

Author contributions

JZu and ZY contributed to the conception of the study. JZa, XB, and BW performed the experiment. JZu, JW, and ZZ contributed significantly to analysis and manuscript preparation. JZa performed the data analyses and wrote the manuscript. DZ and LZ helped to perform the analysis with constructive discussions. All authors read and approved the final manuscript.

Funding

This work was funded by Hebei Key Research and Development Program (21326515D), China Agriculture Research System of MOF and MARA (CARS-09-P18), Modern Agro-Industry Technology Research System in Hebei Province, China (HBCT2018080205), and Hebei Key Research and Development Program (21326320D).

Acknowledgments

We thank Haoqiang Shi and Donghao Jiang for their help in this research. At the same time, we also thank Lijia Zheng for his technical assistance.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2022.943232/full#supplementary-material

Supplementary Figure 1

Antibacterial activity of Bacillus velezensis HN-Q-8 against Streptomyces scabies HP4.

Supplementary Figure 2

(A) Gene clusters of B. velezensis HN-Q-8. (B) Locus structure of Regin 6. (C) Domains of the RiPP-like on Regin 6. (D) Sequence of Lcn972 on RiPP-like.

Supplementary Figure 3

Antibacterial activity of Lcn972 on Streptomyces scabies HP4.

Supplementary Figure 4

Inhibitory effects of Lcn972 on bacteria.

Supplementary Figure 5

Streptomyces scabies treated by different concentrations of NaCl.

References

  • 1

    AbriouelH.FranzC. M. A. P.OmarN. B.GálvezA. (2011). Diversity and applications of Bacillus bacteriocins.Fems Microbiol. Rev.35201232. 10.1111/j.1574-6976.2010.00244.x

  • 2

    AnsariA.ZohraR. R.TararO. M.QaderS. A. U.AmanA. (2018). Screening, purification and characterization of thermostable, protease resistant bacteriocin active against methicillin resistant Staphylococcus aureus (MRSA).BMC Microbiol.18:192. 10.1186/s12866-018-1337-y

  • 3

    Arevalos-SánchezM.RegaladoC.MartinS. E.Domínguez-DomínguezJ.García-AlmendárezB. E. (2012). Effect of neutral electrolyzed water and nisin on Listeria monocytogenes biofilms, and on listeriolysin O activity.Food Control24116122. 10.1016/j.foodcont.2011.09.012

  • 4

    BalthazarC.NovinscakA.CantinG.JolyD. L.FilionM. (2022). Biocontrol activity of Bacillus spp. and Pseudomonas spp. against Botrytis cinerea and other cannabis fungal pathogens.Phytopathology112549560. 10.1094/PHYTO-03-21-0128-R

  • 5

    BarbosaJ.CaetanoT.MendoS. (2015). Class I and Class II Lanthipeptides Produced by Bacillus spp.J. Nat. Prod.7828502866. 10.1021/np500424y

  • 6

    BarondeauD. P.GetzoffE. D. (2004). Structural insights into protein-metal ion partnerships.Curr. Opin. Struct. Biol.14765774. 10.1016/j.sbi.2004.10.012

  • 7

    BousleimanJ.PinskyA.KiS.SuA.MorozovaI.KalachikovS.et al (2017). Function of metallothionein-3 in neuronal cells: do metal ions alter expression levels of MT3?Int. J. Mol. Sci.18:1133. 10.3390/ijms18061133

  • 8

    ButkhotN.SoodsawaengP.VuthiphandchaiV.NimratS. (2019). Characterisation and biosafety evaluation of a novel bacteriocin produced by Bacillus velezensis BUU004.Int. Food Res. J.2616171625.

  • 9

    CeuppensS.De ConinckD.BottledoornN.Van NieuwerburghF.UyttendaeleM. (2017). Microbial community profiling of fresh basil and pitfalls in taxonomic assignment of enterobacterial pathogenic species based upon 16S rRNA amplicon sequencing. Int. J. Food Microbiol.257, 148156. 10.1016/j.ijfoodmicro.2017.06.016

  • 10

    ChandrakasanG.Rodriguez-HernandezA. I.DelR. L. M.Palma-RodríguezH. M.Chavarría-HernándezN. (2019). Bacteriocin encapsulation for food and pharmaceutical applications: advances in the past 20 years.Biotechnol. Lett.41453469. 10.1007/s10529-018-02635-5

  • 11

    ChenX.KoumoutsiA.ScholzR.BorrissR. (2009). More than Anticipated – Production of antibiotics and other secondary metabolites by Bacillus amyloliquefaciens FZB42.J. Mol. Microbiol. Biotech.161424. 10.1159/000142891

  • 12

    ChenX.LiJ.SunH.LiS.ChenT.LiuG.et al (2017). High-level heterologous production and functional secretion by recombinant Pichia pastoris of the shortest proline-rich antibacterial honeybee peptide Apidaecin.Sci. Rep.7:14543. 10.1038/s41598-017-15149-3

  • 13

    ChowdhuryS. P.HartmannA.GaoX.BorrissR. (2015). Biocontrol mechanism by root-associated Bacillus amyloliquefaciens FZB42 - a review.Front. Microbiol.6:780. 10.3389/fmicb.2015.00780

  • 14

    CotterP. D.RossR. P.HillC. (2013). Bacteriocins - a viable alternative to antibiotics?Nat. Rev. Microbiol.1195105. 10.1038/nrmicro2937

  • 15

    CuiL.YangC.WeiL.LiT.ChenX. (2020). Isolation and identification of an endophytic bacteria Bacillus velezensis 8-4 exhibiting biocontrol activity against potato scab.Biol. Control141:104156. 10.1016/j.biocontrol.2019.104156

  • 16

    de ArauzL. J.JozalaA. F.MazzolaP. G.Vessoni PennaT. C. (2009). Nisin biotechnological production and application: a review.Trends Food Sci. Technol.20146154. 10.1016/j.tifs.2009.01.056

  • 17

    DeesM. W.WannerL. A. (2012). In search of better management of potato common scab.Potato Res.55249268. 10.1007/s11540-012-9206-9

  • 18

    DeFilippiS.GroulxE.MegallaM.MohamedR.AvisT. J. (2018). Fungal competitors affect production of antimicrobial lipopeptides in Bacillus subtilis strain B9-5.J. Chem. Ecol.44374383. 10.1007/s10886-018-0938-0

  • 19

    Delves-BroughtonJ.BlackburnP.EvansR. J.HugenholtzJ. (1996). Applications of the bacteriocin, nisin.Antonie van Leeuwenhoek69193202. 10.1007/BF00399424

  • 20

    DimkićI.JanakievT.PetrovićM.DegrassiG.FiraD. (2022). Plant-associated Bacillus and Pseudomonas antimicrobial activities in plant disease suppression via biological control mechanisms - A review.Physiol. Mol. Plant Pathol.117:101754. 10.1016/j.pmpp.2021.101754

  • 21

    EkbladB.KyriakouP. K.OppegårdC.Nissen-MeyerJ.KaznessisY. N.KristiansenP. E. (2016). Structure–function analysis of the two-peptide bacteriocin Plantaricin EF.Biochemistry5551065116. 10.1021/acs.biochem.6b00588

  • 22

    EnnaharS.SashiharaT.SonomotoK.IshizakiA. (2000). Class IIa bacteriocins: biosynthesis, structure and activity.Fems Microbiol. Rev.2485106. 10.1111/j.1574-6976.2000.tb00534.x

  • 23

    GaoY.JiaS.GaoQ.TanZ. (2010). A novel bacteriocin with a broad inhibitory spectrum produced by Lactobacillus sake C2, isolated from traditional Chinese fermented cabbage.Food Control217681. 10.1016/j.foodcont.2009.04.003

  • 24

    Garcia-GutierrezE.O’ConnorP. M.ColquhounI. J.ViorN. M.RodríguezJ. M.MayerM. J.et al (2020). Production of multiple bacteriocins, including the novel bacteriocin gassericin M, by Lactobacillus gasseri LM19, a strain isolated from human milk.Appl. Microbiol. Biotechnol.10438693884. 10.1007/s00253-020-10493-3

  • 25

    GharsallaouiA.OulahalN.JolyC.DegraeveP. (2013). Nisin as a food preservative: part 1: Physicochemical properties, antimicrobial activity, and main uses.Crit. Rev. Food Sci.5612621274. 10.1080/10408398.2013.763765

  • 26

    GraziosoR.García-ViñualesS.RussoL.D’AbroscaG.EspositoS.ZaccaroL.et al (2020). Substitution of the native Zn(II) with Cd(II), Co(II) and Ni(II) changes the downhill unfolding mechanism of Ros87 to a completely different scenario.Int. J. Mol. Sci.21:8285. 10.3390/ijms21218285

  • 27

    HammamiI.JaouadiB.BachaA. B.RebaiA.BejarS.NesmeX.et al (2012). Bacillus subtilis bacteriocin Bac 14B with a broad inhibitory spectrum: purification, amino acid sequence analysis, and physicochemical characterization.Biotechnol. Bioproc. Eng.174149. 10.1007/s12257-010-0401-8

  • 28

    JiangD.ZhangL.DongK.GongY.OgerP. (2021). Biochemical characterization and mutational studies of a novel 3-methlyadenine DNA glycosylase II from the hyperthermophilic Thermococcus gammatolerans.DNA Repair97:103030. 10.1016/j.dnarep.2020.103030

  • 29

    KaewklomS.LumlertS.KraikulW.AunpadR. (2013). Control of Listeria monocytogenes on sliced bologna sausage using a novel bacteriocin, amysin, produced by Bacillus amyloliquefaciens isolated from Thai shrimp paste (Kapi).Food Control32552557. 10.1016/j.foodcont.2013.01.012

  • 30

    KamarajanP.HayamiT.MatteB.LiuY.DanciuT.RamamoorthyA.et al (2015). Nisin ZP, a bacteriocin and food preservative, inhibits head and neck cancer tumorigenesis and prolongs survival.PLoS One10:e131008. 10.1371/journal.pone.0131008

  • 31

    KlaenhammerT. R. (1993). Genetics of bacteriocins produced by lactic acid bacteria.Fems Microbiol. Rev.123985. 10.1016/0168-6445(93)90057-G

  • 32

    KluskaK.AdamczykJ.KrȩżelA. (2018). Metal binding properties, stability and reactivity of zinc fingers. Coordin. Chen. Rev.367, 1864. 10.1016/j.ccr.2018.04.009

  • 33

    KumariyaR.GarsaA. K.RajputY. S.SoodS. K.AkhtarN.PatelS. (2019). Bacteriocins: classification, synthesis, mechanism of action and resistance development in food spoilage causing bacteria.Microbiol. Pathog.128171177. 10.1016/j.micpath.2019.01.002

  • 34

    KumariyaR.SoodS. K.RajputY. S.GarsaA. K. (2015). Gradual pediocin PA-1 resistance in Enterococcus faecalis confers cross-protection to diverse pore-forming cationic antimicrobial peptides displaying changes in cell wall and mannose PTS expression.Ann. Microbiol.65721732. 10.1007/s13213-014-0912-1

  • 35

    KutyshenkoV. P.MikoulinskaiaG. V.ChernyshovS. V.YegorovA. Y.ProkhorovD. A.UverskyV. N. (2019). Effect of C-terminal His-tag and purification routine on the activity and structure of the metalloenzyme, l-alanyl-d-glutamate peptidase of the bacteriophage T5. Int. J. Biol. Macromol.124, 810818. 10.1016/j.ijbiomac.2018.11.219

  • 36

    LeeS. G.ChangH. C. (2018). Purification and characterization of mejucin, a new bacteriocin produced by Bacillus subtilis SN7.LWT87815. 10.1016/j.lwt.2017.08.044

  • 37

    LinC.TsaiC. H.ChenP. Y.WuC. Y.ChangY. L.YangY. L.et al (2018). Biological control of potato common scab by Bacillus amyloliquefaciens Ba01.PLoS One13:e196520. 10.1371/journal.pone.0196520

  • 38

    MathurH.FieldD.ReaM. C.CotterP. D.HillC.RossR. P. (2018). Fighting biofilms with lantibiotics and other groups of bacteriocins.NPJ Biofilms Microbiomes4:9. 10.1038/s41522-018-0053-6

  • 39

    MengQ.JiangH.HaoJ. J. (2016). Effects of Bacillus velezensis strain BAC03 in promoting plant growth.Biol. Control981826. 10.1016/j.biocontrol.2016.03.010

  • 40

    O ConnorP. M.O SheaE. F.CotterP. D.HillC.Paul RossR. (2018). The potency of the broad spectrum bacteriocin, bactofencin A, against staphylococci is highly dependent on primary structure, N-terminal charge and disulphide formation.Sci. Rep.8:11833. 10.1038/s41598-018-30271-6

  • 41

    PalazziniJ. M.DunlapC. A.BowmanM. J.ChulzeS. N. (2016). Bacillus velezensis RC 218 as a biocontrol agent to reduce Fusarium head blight and deoxynivalenol accumulation: genome sequencing and secondary metabolite cluster profiles.Microbiol. Res.1923036. 10.1016/j.micres.2016.06.002

  • 42

    PandeyN.MalikR. K.KaushikJ. K.SingrohaG. (2013). Gassericin A: a circular bacteriocin produced by Lactic acid bacteria Lactobacillus gasseri.World J. Microbiol. Biotechnol.2919771987. 10.1007/s11274-013-1368-3

  • 43

    ParenteE.BrienzaC.MolesM.RicciardiA. (1995). A comparison of methods for the measurement of bacteriocin activity.J. Microbiol. Methods2295108. 10.1016/0167-7012(94)00068-I

  • 44

    PerumalV.YaoZ.KimJ. A.KimH. J.KimJ. H. (2019). Purification and characterization of a bacteriocin, BacBS2, produced by Bacillus velezensis BS2 isolated from Meongge Jeotgal.J. Microbiol. Biotechnol.2910331042. 10.4014/jmb.1903.03065

  • 45

    QiaoZ.SunH.ZhouQ.YiL.WangX.ShanY.et al (2020). Characterization and antibacterial action mode of bacteriocin BMP32r and its application as antimicrobial agent for the therapy of multidrug-resistant bacterial infection.Int. J. Biol. Macromol.164845854. 10.1016/j.ijbiomac.2020.07.192

  • 46

    QinY.WangY.HeY.ZhangY.SheQ.ChaiY.et al (2019). Characterization of Subtilin L-Q11, a novel class I bacteriocin synthesized by Bacillus subtilis L-Q11 isolated from orchard soil.Front. Microbiol.10:484. 10.3389/fmicb.2019.00484

  • 47

    RizzelloC. G.FilanninoP.Di CagnoR.CalassoM.GobbettiM. (2014). Quorum-sensing regulation of constitutive plantaricin by Lactobacillus plantarum strains under a model system for vegetables and fruits.Appl. Environ. Microbiol.80777787. 10.1128/AEM.03224-13

  • 48

    RooneyW. M.GrinterR. W.CorreiaA.ParkhillJ.WalkerD. C.MilnerJ. J. (2020). Engineering bacteriocin-mediated resistance against the plant pathogen Pseudomonas syringae.Plant Biotechnol. J.1812961306. 10.1111/pbi.13294

  • 49

    ScholzR.MolohonK. J.NachtigallJ.VaterJ.MarkleyA. L.SüssmuthR. D.et al (2011). Plantazolicin, a novel microcin B17/streptolysin S-Like natural product from Bacillus amyloliquefaciens FZB42.J. Bacteriol.193215224. 10.1128/JB.00784-10

  • 50

    ScholzR.VaterJ.BudiharjoA.WangZ.HeY.DietelK.et al (2014). Amylocyclicin, a novel circular bacteriocin produced by Bacillus amyloliquefaciens FZB42.J. Bacteriol.19618421852. 10.1128/JB.01474-14

  • 51

    ShafiJ.TianH.JiM. (2017). Bacillus species as versatile weapons for plant pathogens: a review.Biotechnol. Biotechol.31446459. 10.1080/13102818.2017.1286950

  • 52

    ShiW.LiM.WeiG.TianR.LiC.WangB.et al (2019). The occurrence of potato common scab correlates with the community composition and function of the geocaulosphere soil microbiome.Microbiome7:14. 10.1186/s40168-019-0629-2

  • 53

    SoltaniS.HammamiR.CotterP. D.RebuffatS.SaidL. B.GaudreauH.et al (2020). Bacteriocins as a new generation of antimicrobials: toxicity aspects and regulations.Fems Microbiol. Rev.45:fuaa039. 10.1093/femsre/fuaa039

  • 54

    StanforthK. J.WilcoxM. D.ChaterP. I.BrownleeI. A.ZakhourM. I.BaneckiK. M. R. M.et al (2022). Pepsin properties, structure, and its accurate measurement: a narrative review.Ann. Esophagus5:31. 10.21037/aoe-20-95

  • 55

    St-OngeR.GoyerC.CoffinR.FilionM. (2008). Genetic diversity of Streptomyces spp. causing common scab of potato in eastern Canada.Syst. Appl. Microbiol.31474484. 10.1016/j.syapm.2008.09.002

  • 56

    StubbendieckR. M.StraightP. D. (2017). Linearmycins activate a two-component signaling system involved in bacterial competition and biofilm morphology.J. Bacteriol.199e117e186. 10.1128/JB.00186-17

  • 57

    SuganthiV.MohanasrinivasanV. (2014). Optimization studies for enhanced bacteriocin production by Pediococcus pentosaceus KC692718 using response surface methodology. J. Food. Sci. Technol.52, 37733782. 10.1007/s13197-014-1440-5

  • 58

    SzaboE. A.CahillM. E. (2002). Nisin and ALTATM 2341 inhibit the growth of Listeria monocytogenes on smoked salmon packaged under vacuum or 100% CO2.Lett. Appl. Microbiol.28373377. 10.1046/j.1365-2672.1999.00547.x

  • 59

    TangH. W.PhapugrangkulP.FauziH. M.TanJ. S. (2022). Lactic acid bacteria bacteriocin, an antimicrobial peptide effective against multidrug resistance: a comprehensive review.Int. J. Pept. Res. Ther.28114. 10.1007/s10989-021-10317-6

  • 60

    TodorovS. D.FurtadoD. N.SaadS. M. I.Gombossy De Melo FrancoB. D. (2011). Bacteriocin production and resistance to drugs are advantageous features for Lactobacillus acidophilus La-14, a potential probiotic strain.New Microbiol.34:357.

  • 61

    VacaJ.OrtizA.SansineneaE. (2019). Bacillus sp. bacteriocins: natural weapons against bacterial enemies.Int. Food Res. J.2616171625. 10.2174/0929867328666210527093041

  • 62

    WangT.FuJ.XiaoX.LuZ.WangF.JinM.et al (2021). CBP22, a novel bacteriocin isolated from Clostridium butyricum ZJU-F1, protects against LPS-induced intestinal injury through maintaining the tight junction complex.Mediators Inflamm.2021:8032125. 10.1155/2021/8032125

  • 63

    WangY.QinY.ZhangY.WuR.LiP. (2019). Antibacterial mechanism of plantaricin LPL-1, a novel class IIa bacteriocin against Listeria monocytogenes.Food Control978793. 10.1016/j.foodcont.2018.10.025

  • 64

    WannerL. A. (2006). A survey of genetic variation in streptomyces isolates causing potato common scab in the United States.Phytopathology9613631371. 10.1094/PHYTO-96-1363

  • 65

    WebberJ. L.Namivandi-ZangenehR.DrozdekS.WilkK. A.BoyerC.WongE. H. H.et al (2021). Incorporation and antimicrobial activity of nisin Z within carrageenan/chitosan multilayers.Sci. Rep.11:1690. 10.1038/s41598-020-79702-3

  • 66

    WiedemannI.BreukinkE.van KraaijC.KuipersO. P.BierbaumG.de KruijffB.et al (2001). Specific binding of nsin to the peptidoglycan precursor lipid II combines pore formation and inhibition of cell wall biosynthesis for potent antibiotic activity.J. Biol. Chem.27617721779. 10.1074/jbc.M006770200

  • 67

    YaoZ.KimJ. A.KimJ. H. (2019). Characterization of a fibrinolytic enzyme secreted by Bacillus velezensis BS2 isolated from sea squirt jeotgal.J. Microbiol. Biotechnol.29347356. 10.4014/jmb.1810.10053

  • 68

    YiL.DangY.WuJ.ZhangL.LiuX.LiuB.et al (2016). Purification and characterization of a novel bacteriocin produced by Lactobacillus crustorum MN047 isolated from koumiss from Xinjiang. China.J. Dairy Sci.9970027015. 10.3168/jds.2016-11166

  • 69

    YiL.LuoL.X. (2018). Efficient exploitation of multiple novel bacteriocins by combination of complete genome and peptidome.Front. Microbiol.9:1567. 10.3389/fmicb.2018.01567

  • 70

    ZhangJ.YangY.YangH.BuY.YiH.ZhangL.et al (2018). Purification and partial characterization of bacteriocin Lac-B23, a novel bacteriocin production by Lactobacillus plantarum J23, isolated from chinese traditional Fermented milk.Front. Microbiol.9:2165. 10.3389/fmicb.2018.02165

  • 71

    ZhangY.BignellD. R.ZuoR.FanQ.Huguet-TapiaJ. C.DingY.et al (2016). Promiscuous pathogenicity islands and phylogeny of pathogenic Streptomyces spp.Mol. Plant Microbe Interact.29640650. 10.1094/MPMI-04-16-0068-R

  • 72

    ZouJ.JiangH.ChengH.FangJ.HuangG. (2018). Strategies for screening, purification and characterization of bacteriocins.Int. J. Biol. Macromol.117781789. 10.1016/j.ijbiomac.2018.05.233

Summary

Keywords

potato, potato common scab, Streptomyces scabies, Lcn972, Bacillus

Citation

Zhao J, Zhou Z, Bai X, Zhang D, Zhang L, Wang J, Wu B, Zhu J and Yang Z (2022) A novel of new class II bacteriocin from Bacillus velezensis HN-Q-8 and its antibacterial activity on Streptomyces scabies. Front. Microbiol. 13:943232. doi: 10.3389/fmicb.2022.943232

Received

13 May 2022

Accepted

28 June 2022

Published

29 July 2022

Volume

13 - 2022

Edited by

Md. Motaher Hossain, Bangabandhu Sheikh Mujibur Rahman Agricultural University, Bangladesh

Reviewed by

Hoang Duc Nguyen, Ho Chi Minh City University of Science, Vietnam; Qi-Lin Zhang, Kunming University of Science and Technology, China; Muhammad Fazle Rabbee, Yeungnam University, South Korea

Updates

Copyright

*Correspondence: Jiehua Zhu, Zhihui Yang,

This article was submitted to Microbe and Virus Interactions with Plants, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics