Your new experience awaits. Try the new design now and help us make it even better

ORIGINAL RESEARCH article

Front. Microbiol., 24 October 2025

Sec. Infectious Agents and Disease

Volume 16 - 2025 | https://doi.org/10.3389/fmicb.2025.1669022

This article is part of the Research TopicMechanisms and Innovations in Combating Intracellular InfectionsView all 8 articles

RapTB: a lung-derived hemoglobin fragment with activity against Mycobacterium tuberculosis

  • 1Ulm University Medical Center, Ulm, Germany
  • 2Institut of Medical Microbiology and Hygiene, Medical Facility, Ulm University, Ulm, Germany
  • 3Institute of Biophysics, Ulm University, Ulm, Germany
  • 4University of Ulm, Ulm, Germany
  • 5Central Facility for Electron Microscopy, Ulm University, Ulm, Germany
  • 6Core Unit Mass Spectrometry and Proteomics, Ulm, Germany
  • 7Core Facility of Functional Peptidomics, Ulm University, Ulm, Germany
  • 8Laboratory of Neuropathology, Department of Imaging and Pathology, Leuven Brain Institute, KU- Leuven, Leuven, Belgium
  • 9Institut of Molecular Virology, Ulm University, Ulm, Germany

Tuberculosis (TB) remains difficult to treat due to the need for prolonged multidrug therapy and the global rise of drug-resistant Mycobacterium tuberculosis (Mtb) strains. Endogenous antimicrobial peptides (AMPs) have emerged as promising candidates for host-directed therapies. Given the pulmonary nature of TB, we hypothesized that human lung tissue contains peptides with intrinsic antimycobacterial activity. We screened a peptide library derived from human lung tissue and identified a 39-amino-acid C-terminal fragment of β-hemoglobin (HBB(112–147)), referred to as RapTB, with potent activity against Mtb. Recombinant RapTB exhibited dose-dependent inhibition of extracellular Mtb, reaching ~60% activity at 50 μM. Electron microscopy revealed mycobacterial cell wall disruption as a likely mechanism. RapTB was non-toxic to primary human macrophages and efficiently internalized by Mtb-infected cells. However, it did not co-localize with intracellular bacilli and failed to limit intracellular replication. HBB-derived fragments such as RapTB have previously been identified in human tissues and are known to exhibit broad-spectrum antimicrobial activity. Our findings extend this functional class to include antimycobacterial activity and suggest a potential role for RapTB in the early, extracellular phase of host defense against TB.

1 Introduction

More than 125 years after its discovery by Robert Koch, Mtb remains one of the most devastating pathogens worldwide, causing over 10 million new infections and 1.5 million deaths annually (World Health Organization, 2023). Despite the availability of effective antibiotics, the standard treatment requires a prolonged combination therapy of at least 6 months with two to four drugs. This regimen is often associated with severe side effects and poor patient compliance. The alarming rise of multidrug-resistant and extensively drug-resistant strains further hampers therapeutic success (Khawbung et al., 2021). Given these challenges, there is an urgent need for novel, safe, and effective therapeutic strategies that can complement or enhance current anti-tuberculosis regimens. Antimicrobial peptides (AMPs) have emerged as promising candidates in this context. AMPs are short, mostly cationic peptides that typically act by disrupting microbial membranes, thereby exhibiting broad-spectrum activity against bacteria, fungi, and viruses (Yeaman and Yount, 2003). They are evolutionarily conserved components of innate immunity and have been isolated from diverse sources including bacteria, plants, invertebrates, and mammals.

In humans, a rich diversity of bioactive peptides—collectively termed the peptidome—can be found in tissues and body fluids. The peptidome encompasses not only classical proteolytic fragments of larger precursor proteins but also peptides derived from short open reading frames, non-canonical translation events, alternative splice variants, and small secreted proteins. Despite its complexity and biological relevance, the human peptidome remains largely unexplored as a reservoir of endogenous antimicrobial compounds. Endogenous AMPs offer several advantages over conventional antibiotics. As naturally occurring host molecules, they are less likely to induce adverse side effects or trigger immune reactions. Their mechanism of action, typically based on electrostatic interactions with bacterial membranes, makes the development of resistance less likely. Furthermore, their relatively small size facilitates large-scale chemical synthesis at reasonable cost (Hancock and Sahl, 2006; Yeaman and Yount, 2003). To systematically explore the human peptidome for novel AMPs, we previously established a platform to generate peptide libraries from various human tissues and fluids and to screen these libraries for antimicrobial activity (Münch et al., 2014; Bosso et al., 2018). Using this approach, we previously identified the antimycobacterial peptides Angie1 and Lys-H1 from serum (Noschka et al., 2021; Maier et al., 2024) and NapFab from bronchoalveolar lavage fluid (Beitzinger et al., 2021). Since tuberculosis is primarily a pulmonary disease, and more than 95% of infected individuals are able to contain the pathogen without ever developing active disease (Migliori et al., 2021), we hypothesized that the human lung harbors innate defense molecules capable of controlling Mtb infection. To test this, we generated a peptide library from healthy human lung tissue, screened it for activity against virulent Mtb and functionally characterized the most potent bioactive molecule (HBB(112–147, RapTB).

2 Materials and methods

2.1 Generation of a peptide library from human lung tissues

A sample of 6,500 g of lung from deceased patients was subjected to homogenization. Peptide/protein extraction was performed by acidifying the sample with acetic acid to pH 3, followed by centrifugation at 16000 rpm for 15 min, and filtration (20, 8, 5, 3, 1.2, 0.45 μm) of the supernatant. Further, the filtered lung extract was subjected to ultrafiltration (cut off: 30 kDa), yielding a sample enriched in peptides and small proteins. The chromatographic fractionation of the ultrafiltrate sample was performed by using a reversed-phase (PS/DVB) HPLC column Sepax Poly RP300 (Sepax Technologies, Newark DE, USA 260,300–30,025) of dimensions 5 × 25 cm (10 μm), at a flow rate of 100 ml/min with the gradient program (min/%B): 5/5,30/50,50/100,55/5, being A, 0.1% TFA (Merck, 1,082,621,000) in ultrapure water, and B,0.1% TFA in acetonitrile (J. T. Baker, JT9012-3). Fifty-five reversed-phase chromatographic fractions of 100 ml were collected to constitute the lung peptide bank, from which 1 ml-aliquots (1%) were lyophilized and used for antimicrobial activity testing. For further purification of the active fractions, a Luna reversed phase C18 HPLC column (Phenomenex, USA) of dimensions 2.1 × 25 cm (5 μm) was used at a flow rate of 12.5 ml/min, with the gradient program (min/%B): 0/5, 5/5, 27/25, 47/50, 68/100, 75/5. Next, an Aeris TM widepore XB-C18 reversed-phase HPLC column (Phenomenex, USA) of dimensions 4.6 × 25 cm (3.6 μm) was used at a flow rate of 0.8 ml/min, with the gradient program (min/%B):0/5, 5/20, 50/45. The solvents used for both separations were A, 0.1% Trifluoroacetic acid (TFA) (Merck,1,082,621,000) in ultrapure water, and B, 0.1% TFA in acetonitrile (J. T. Baker, JT9012-3).

2.2 Evaluation of peptide fractions for activity against Mtb

To assess mycobacterial viability, we measured the incorporation of the radioactively labeled 5.6-3H-uracil (ART-0282, Biotrend, Cologne, Germany) into bacterial RNA (Noschka et al., 2021). Sonicated Mycobacteria (2 × 106) were incubated with the peptides in Middlebrook 7H9 broth in a 96-well plate. Each condition was performed in triplicate, with rifampin (2 μg/ml, for Mtb) used as controls. After 72 h 3H-uracil (0.3 μCi/well) was added, and the cultures were incubated for an additional 18 h. Following incubation, the mycobacteria were inactivated by treatment with 4% paraformaldehyde (PFA, Sigma-Aldrich) for 30 min. The samples were then transferred onto glass fiber filters (Printed Filtermat A, PerkinElmer) using a Filtermat Harvester (Inotech). The filters were dried in a microwave at 240 W for 5 min and sealed with a layer of solid scintillant wax (MeltiLex, PerkinElmer) at 75 °C. Radioactivity was measured using a β-counter (Sense Beta, Hidex). Antimicrobial activity was calculated by dividing the counts per minute (cpm) of the treated sample by the cpm of the untreated sample and multiplying by 100.

2.3 Mass spectrometry identification of active molecules

Identification of active peptides in active fractions was performed on a nano LC-Orbitrap Elite Hybrid mass spectrometry system (Thermo Fisher Scientific, Bremen, Germany). The samples were reduced with 5 mM Dithiothreitol (DTT) for 20 min at RT, carbamidomethylated with 50 mM iodoacetamide for 20 min at 37 °C and quenched with 10 mM DTT. A 15 μl-aliquot was analyzed as previously described (Rodríguez-Alfonso et al., 2022). Database searches were performed using PEAKsXPro (PEAKs studio 10.6) (Zhang et al., 2012). For peptide identification, MS/MS spectra were correlated with the UniProt human reference proteome (19). Carbamidomethylated cysteine was considered as a fixed modification along with oxidation (M) and deamidation (NQ) as variable modifications. False discovery rates were set on the peptide level to 1%.

2.4 Peptide origin and synthesis

RapTB was extracted and purified from human lung lysate. The peptide RapTB (VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH) was synthesized by PSL Heidelberg (Heidelberg, Germany) using Fmoc chemistry (Noschka et al., 2021). The peptides were purified to >95% purity using reverse-phase HPLC. To ensure valid comparisons between experiments, all concentrations were expressed in molarity.

2.5 Source and culture of mycobacteria

Mycobacterial strains used in this study are listed in Table 1. Mycobacteria were cultured, stored, and amplified as previously described (Noschka et al., 2021). Representative vials were thawed, and the viable colony-forming units (CFU) were enumerated on Middlebrook 7H11 agar plates (BD Biosciences). Live-dead staining (BacLight, Invitrogen) of bacterial suspensions using fluorochrome substrates indicated that the bacterial viability was greater than 90%. Before use, aliquots were sonicated in a water bath for 10 min at 40 kHz and 110 W at room temperature to disrupt small bacterial aggregates. Mycobacterial cultures were grown on Middlebrook 7H11 agar plates, with 2 × 106 sonicated mycobacteria spread on the plates in logarithmic dilutions (1:10, 1:100, and 1:1000). The plates were then incubated for 14 days at 37 °C. Following incubation, the colonies were counted to determine CFU.

Table 1
www.frontiersin.org

Table 1. Mycobacterial strains.

2.6 Generation of macrophages and infection with Mtb

Human peripheral blood mononuclear cells (PBMCs) were isolated from buffy coats of anonymous donors (Institute of Transfusion Medicine, Ulm University) using density gradient centrifugation (Ficoll-Paque Plus, GE Healthcare). Monocytes were then selected based on their ability to adhere to plastic and were thoroughly washed. To generate monocyte-derived macrophages, the cells were cultured in M-SFM supplemented with granulocyte–macrophage colony-stimulating factor (GM-CSF, 10 ng/ml, Miltenyi) for 6 days as previously outlined (Noschka et al., 2021). After this, macrophages were detached using 1 mM Ethylene diamine tetraacetic acid (EDTA) (Sigma-Aldrich) and subsequently infected in 6-well plates with single-cell suspensions of Mtb at a multiplicity of infection (MOI) of 5. After a 2-h incubation, the cells were thoroughly washed to remove extracellular bacteria and harvested using 1 mM EDTA (Sigma-Aldrich).

2.7 Scanning Electron microscopy

Initially, 5 × 106 Mtb were seeded into a 24-well plate containing Middlebrook 7H9 broth and incubated with 50 μM RapTB for 72 h. Following incubation, the bacteria were harvested, transferred to screw-cap tubes, and centrifuged at 10,000 rpm for 10 min. The supernatant was discarded, and the bacterial pellet was resuspended and fixed in 100 μl of 4% paraformaldehyde (PFA) for 20 min. Subsequently, chemical fixation was performed using 2.5% glutaraldehyde (prepared in phosphate-buffered saline (PBS) with 1% sucrose) for 1 h. The bacteria were then post-fixed with 2% osmium tetroxide (OsO₄) in PBS for 1 h at room temperature. Dehydration was carried out through a graded series of propanol concentrations (30, 50, 70, 90, and 100%), with each step lasting 5 min (Walther et al., 2010). Samples were then subjected to critical point drying using carbon dioxide as the transitional medium (Critical Point Dryer CPD 030, Bal-Tec, Liechtenstein). The dried samples were rotary coated in a BAF 300 freeze-etching device (Bal-Tec) using electron beam evaporation with a 3 nm platinum–carbon layer applied at a 45° angle. Imaging was performed using a Hitachi S-5200 in-lens field-emission scanning electron microscope (Hitachi High-Tech, Tokyo, Japan) at an accelerating voltage of 10 kV, using the secondary electron signal.

2.8 Assessment of macrophage viability

For in vitro analysis, 1 × 105 macrophages were seeded in a 96-well plate and incubated with RapTB for 24 h. Subsequently, 10% PrestoBlue reagent (Thermo Fisher, Waltham, MA, USA) was added to each well and incubated for 20 min. The conversion of the non-fluorescent, resazurin-based substrate to fluorescent resorufin by mitochondrial enzymes of metabolically active cells was used to assess cytotoxicity, as previously described (Noschka et al., 2021).

2.9 Uptake of RapTB by macrophages-confocal microscopy

Mtb-infected macrophages were seeded onto 8-chamber slides (Thermo Fisher Scientific) with a final volume of 100 μl which is equivalent to 100,000 macrophages. Following cell fixation with paraformaldehyde (PFA, Sigma; final concentration 4%), non-specific binding sites were blocked using a blocking buffer for 1 h at room temperature. This step also permeabilized the cell wall for intracellular staining. Permeabilization was followed by incubation with primary antibodies against RapTB (1:250) or MHC class II (1:300) for 1 h. Cells were then incubated with secondary antibodies: Cy2-conjugated donkey anti-rabbit (1:200), for another hr. at room temperature. Nuclei were counterstained with 1 μg/ml DAPI for 10 min, and slides were mounted using Aquatex (Merck, Darmstadt, Germany). Images were acquired using a Zeiss LSM 710 inverted laser scanning confocal microscope (Zeiss, Oberkochen, Germany) and analyzed with ImageJ software (version 1.53c). All antibodies used are listed in Table 2.

Table 2
www.frontiersin.org

Table 2. Antibodies.

2.10 Single molecule localization microscopy and colocalization analysis of RapTB with Mtb

Primary human macrophages were seeded in 35 mm ibidi-dishes with glass bottom (Ibidi GmbH, 81,158), infected with GFP-positive Mtb (Table 1) at an MOI of 10 and incubated with 500 nM RapTB. The cells were fixed with 4% paraformaldehyde solution (15,714, Electron Microscopy Sciences, Hatfield, USA) before being incubated with blocking buffer (1% bovine serum albumin (BSA) and 0.1% Triton X-100 in PBS) for 2 h. Anti-Hemoglobin subunit beta antibody [EPR20614] (Abcam, Cambridge, UK, ab214049) at a dilution of 1:200 in blocking buffer was added overnight at 4 °C. After three washing steps with blocking buffer the secondary antibody Goat anti-Rabbit IgG (H + L) Cross-Adsorbed Secondary Antibody, Alexa Fluor 647 (Thermo Fisher, Waltham, MA, USA) was diluted 1:200 in blocking buffer and added for 1 h at room temperature, followed by another three washing steps. Prior to imaging, the buffer is replaced with degassed dSTORM imaging buffer at pH 7.4 containing 100 mM β-Mercaptoethylamine (30070), 0.02 mg/ml catalase (C30), 0.5 mg/ml glucose oxidase (49180) and 200 mM D-(+)-glucose (G7528) in PBS (all Sigma Aldrich). dSTORM imaging was performed on a custom-built microscope optimized for single molecule localization microscopy first described here (Schoen et al., 2016). The Alexa Fluor 647 fluorophores attached to RapTB were excited with a 638 nm Omicron LuxX 638–300, 200 mW laser (Omicron Laserage Laserprodukte GmbH, Germany), the GFP expressed by Mtb were excited with a 488 nm iBEAM-SMART-488-S, 60 W laser (TOPTICA Photonics AG, Germany) and photoactivation was done with a 405 nm iBEAM-SMART-405-S, 120 mW laser (TOPTICA Photonics AG, Germany). Imaging was performed in HILO mode to optimize single molecule SNR. The 638 nm channel was imaged onto an iXon 897 Ultra EMCCD camera and the 488 nm channel was imaged onto an iXon 897 EMCCD camera (both Andor Technology, Oxford Instruments, Belfast, UK) with an image pixel size of 133 nm and an exposure time of 40 ms. Before starting the dSTORM measurement the sample was excited by the 638 nm laser at maximum laser power to drive a majority of fluorophores into the transient dark state. The dSTORM raw data consists of 10.000 frames. Post processing was performed using the SMAP SMLM platform (Ries, 2020). The localizations were filtered for localization precision between 10 and 50 nm and a PSF width of 110-200 nm. Drift correction was performed based on sub-reconstruction cross-correlation. Localization density quantification was done by comparing the number of RapTB molecules per area inside the diffraction-limited regions of the Mtb to the RapTB density in the cytosol of the respective cells in the absence of Mtb. dSTORM imaging was performed on macrophages from three different donors.

2.11 Quantification of intracellular mycobacterial growth: mycobacterial growth inhibition assay (MGIA)

Macrophages were infected with Mtb (MOI 5, 2 h) and extracellular bacilli were removed by extensive washing. The cells were then harvested and seeded into a 24-well plate at a density of 1 × 105 cells in 300 μl M-SFM. Infected macrophages were treated as specified, and after 72 h., cells were lysed by adding 200 μl of water. The resulting lysates were transferred to mycobacteria growth indicator tubes (MGIT, BD Biosciences, Franklin Lakes, USA) and supplemented with 800 μl of a supplement containing oleic acid, albumin, dextrose and catalase (Ölsäure-Albumin-Dextrose-Katalase (OADC), BD Biosciences). The tubes were incubated in a Bactec MGIT 320 system (BD Biosciences), which detects oxygen consumption and provides the exact time (in minutes) from the start of culture to the detection of bacterial activity (time to positivity). The number of viable bacilli was determined by comparing the time to positivity in the sample to a standard curve generated from the growth of tenfold serially diluted mycobacterial suspensions (103 to107 bacilli, in duplicate).

2.12 Statistical analysis

All statistical analyses described in the figure legends were conducted using GraphPad Prism v10 (GraphPad Software). Significance was determined using non-parametric tests for paired samples, including the Wilcoxon rank-sum test and paired t-test. A p-value of less than 0.05 was considered statistically significant.

3 Results

To identify antimicrobial peptides from lung lysate, 60 fractions were screened for antimetabolic activity against Mtb (Figure 1). Fraction 42 exhibited activity exceeding 30%. Repeated sub-fractionation led to the identification of sub-subfraction 40, which showed antimetabolic activity of over 90%. Mass spectrometry analysis of subfraction 40 revealed a signal at 7798.09 Da (deconvoluted spectrum), which turned into a signal at 3957.07 Da after carbamidomethylation, indicating the presence of a dimer formed by one intermolecular disulfide bridge (Figure 2). The MS/MS sequencing of the carbamidomethylated sample revealed the presence of HBB 112–147, VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH (Supplementary Figure 1). This C-terminal peptide has previously been detected in human placenta and menstrual blood and showed antimicrobial activity, extracellular bacteria and viruses (Liepke et al., 2003; Mak et al., 2004; Mak et al., 2007; Groß et al., 2020).

Figure 1
Diagram illustrating the identification of active antibacterial fractions from a lung lysate library. Panel A shows the process of obtaining 60 fractions, identifying active subfraction 42, and further isolating active sub-subfraction 40. Panel B is a bar chart displaying the antimycobacterial activity percentages of sub-subfractions, highlighting sub-subfraction 40 with the highest activity.

Figure 1. Activity of fractions obtained from human lung against extracellular Mtb. (A) To identify active peptides, lung lysate was repeatedly fractionated and assessed for activity against Mtb. (B) A total of sixty individual fractions from a lung lysate library were tested for antimicrobial activity against extracellular M. tuberculosis. Fractions exhibiting more than 30% inhibitory activity were further subfractionated using high-performance liquid chromatography (HPLC). Only fractions 32 to 40 are shown in the figure. Fractions were incubated with bacteria for 96 h; during the final 24 h, 3H-uracil was added to monitor bacterial RNA synthesis. Uptake of 3H-uracil was quantified by scintillation counting with a β-counter. Antimicrobial activity was determined by comparing radioactivity levels to those of an untreated control. Experiments were performed in triplicates. Mass spectrometric analysis of subfraction 40 identified a peptide corresponding to amino acids 112–147, a fragment of hemoglobin B.

Figure 2
Mass spectrometry graphs show relative abundance versus mass in Daltons. Graph A displays a peak at 3957.07 Da for RapTB. Graph B shows a peak at 7796.09 Da for RapTB-dimer. Both graphs have 100% relative abundance at the peak.

Figure 2. Identification of RapTB as the active component in subfraction 40. Analysis of subfraction 40 by mass spectrometry (nanoLC-Orbitrap Elite system). (A) Deconvoluted mass spectrum of the unmodified sample. (B) Deconvoluted mass spectrum of the sample after carbamidomethylation.

To validate the antitubercular activity of RapTB, the synthetic peptide was tested against extracellular Mtb in an antimetabolic assay. RapTB exhibited a maximum of 53% inhibition at 50 μM (Figure 3A). Higher concentrations did not further enhance activity. To investigate structural effects on the pathogen, Mtb was incubated with RapTB (50 μM) and analyzed by transmission electron microscopy. Compared to untreated bacilli, which appeared as intact rods, RapTB-treated Mtb displayed profound morphological alterations, including vesicle formation, membrane swelling, and loss of membrane integrity (Figure 3B), suggesting membrane disruption as a likely mode of action.

Figure 3
Chart A displays a bar graph showing the effect of increasing concentrations of RapTB on antimetabolic activity, with significance levels indicated. Images B consist of four electron microscope images. Panel A shows individual *Mtb* cells, while panels B, C, and D present clustered *Mtb* treated with RapTB. Each image has a scale bar of 2 micrometers.

Figure 3. Effect of RapTB against extracellular Mtb. (A) 2 × 106 extracellular Mtb were incubated with increasing concentrations of RapTB for 3 days, followed by an additional 16-h incubation with 3H-uracil. Radioactive uptake was measured by scintillation counting. Antibacterial activity was calculated by comparing the counts per minute (cpm) of treated samples to those of the untreated control. All conditions were tested in triplicate. The graph shows a representative result of n = 6 independent experiments. (B) Extracellular Mtb was either treated with RapTB or left untreated for 3 days before being processed for scanning electron microscopy. Representative images depict untreated (A) and RapTB-treated Mtb (B–D). Imaging was performed using a Hitachi S-5200 scanning electron microscope at magnifications ranging from 40,000 × to 50,000×. Mycobacteria from three independent experiments were analyzed. Representative images are shown.

Since Mtb primarily resides in macrophages, the cytotoxicity of RapTB was assessed against primary human macrophages after 24 h of exposure. At 50 μM, RapTB showed minimal cytotoxicity (13%). At lower concentrations (0.0005–5 μM), cell viability remained above 79% (Figure 4), indicating that RapTB is well tolerated by host cells.

Figure 4
Bar graph showing cell viability percentages at different RapTB concentrations: 0, 0.05, 0.5, 5, 50 micromolar, and heat-treated control. High viability is consistent across concentrations, except significantly reduced in heat-treated. Statistical significance indicated by asterisks.

Figure 4. Effect of RapTB on the viability of human macrophages. 0.1 × 106 macrophages were incubated with RapTB for 24 h. Cell viability was assessed using the PrestoBlue assay. Bar graphs represent the mean viability (%) ± SEM from six independent experiments.

To determine whether RapTB could reach intracellular Mtb, we investigated its uptake by macrophages using confocal laser scanning microscopy. Since a RapTB -specific antibody was required for detection in confocal microscopy and RapTB is a fragment of hemoglobin ß, a panel of commercially available anti-hemoglobin ß antibodies were tested for cross-reactivity, one of which recognized RapTB (Supplementary Figure 2). After 24 h, RapTB localized predominantly to vesicular structures near the nucleus (Figure 5). However, not all macrophages internalized the peptide, and no direct colocalization with intracellular bacilli was observed or it could not be detected at the sensitivity level of the microscope.

Figure 5
Four panels labeled A to D show fluorescence microscopy images. Panel A displays blue DAPI-stained nuclei. Panel B shows green RapTB signals. Panel C highlights red MHC-II staining. Panel D is a fusion of all markers, displaying blue, green, and red signals. Each panel includes a 30 micrometer scale bar.

Figure 5. Uptake of RapTB by human macrophages. Confocal microscopy, Immunofluorescence staining of RapTB in macrophages using an anti-HBB antibody and a Cy2-labelled secondary antibody. (A) Shows nuclear staining with DAPI, (B) shows RapTB staining, and (C) depicts MHC class II staining, a specific marker of macrophages. (D) Displays the merged overlay of all three channels. Original magnification ×63. Cells from three independent donors were analyzed. A representative image is shown.

To investigate the RapTB localization on a molecular level in particular with respect to the intra-cellular Mtb, we used single molecule localization using dSTORM (Figure 6), resulting in super-resolution optical microscopy images. In the dSTORM-reconstructions of the macrophages treated with RapTB (0.5 μM), individual RapTB molecules could be localized throughout the cytosol of macrophages. The molecular density of RapTB inside the diffraction-limited region covered by the Mtb normalized by the cytosolic molecular density yields a value of 0.92 ± 0.07 when averaged over all donors (n = 3) and reconstructions (n = 12). This demonstrates that RapTB does not preferentially colocalize with Mtb intracellularly. The fact that RapTB is underrepresented in the areas occupied by Mtb indicates, that Mtb reside in compartments with low peptide uptake.

Figure 6
Fluorescence microscopy images show cells with GFP-tagged Mtb (green fluorescence) and RapTB presence (magenta). Two panels with GFP-Mtb exposed at different conditions demonstrate contrasting localization and distribution patterns. Scale bars indicate five micrometers.

Figure 6. Uptake and localization of RapTB in Mtb-infected macrophages. Single molecule localization reconstruction (dSTORM) of RapTB in Mtb-infected primary human macrophages overlaid with the diffraction-limited images of Mtb expressing GFP (green). Cells from three independent donors were analyzed. Representative images are shown.

To assess the antimycobacterial of RapTB, infected macrophages were treated with RapTB (50 μM) for 4 days, followed by lysis and quantification of viable bacteria by determining the number of colony forming units on agar plates. No reduction in intracellular Mtb was observed (Figure 7A). This result was corroborated using the mycobacterial growth inhibition assay (MGIA) as an independent objective approach (Figure 7B). Together, these findings demonstrate that while RapTB is highly active against extracellular Mtb, it lacks efficacy against intracellular bacilli, likely due to inefficient colocalization with the pathogen inside host cells.

Figure 7
Two graphs labeled A and B compare RapTB and Diluent treatments. A shows CFU counts in thousands, indicating no significant difference (ns) between groups. B depicts intracellular activity percentage, also showing no significant difference (ns) between RapTB and Diluent.

Figure 7. (A) Effect of RapTB on the viability of intracellular Mtb. Macrophages were infected with Mtb at a multiplicity of infection (MOI) of 5 and treated with RapTB for 4 days following the same protocol used for metabolic activity assays. Subsequently, the cells were lysed, and the released bacteria were plated onto 7H11 Middlebrook agar. After 14 days of incubation, colony-forming units (CFUs) were enumerated. The bar graph represents the Mycobacterial viability rates from five independent experiments (n = 5). (B) Effect of RapTB on the viability of intracellular Mtb. (MGIA). Macrophages were infected with Mtb and subsequently treated with RapTB. After 4 days, cells were lysed using distilled water and transferred to MGIT tubes. Time to positivity (TTP) was measured using the BACTEC system. The number of viable bacilli was estimated by comparing the TTP values to a standard curve generated with defined quantities of extracellular Mtb. As a positive control, the antimicrobial peptides Gran1 (1 μM) and NapFab/ DMSN (5 μM) were used (data not shown). The graph presents mean values ± SEM from three independent experiments using macrophages from different donors (n = 3).

4 Discussion

Here, we report the identification and characterization of HBB(112–147), a 39-amino-acid C-terminal fragment of β-hemoglobin, now termed RapTB. RapTB exhibited potent antimycobacterial activity against extracellular Mtb, likely via disruption of the bacterial cell wall. Although RapTB was efficiently internalized by human macrophages, it did not co-localize with intracellular bacilli and failed to inhibit intracellular Mtb.

RapTB belongs to a family of endogenous antimicrobial peptides, known as hemocidins, which are generated by proteolytic cleavage of hemoglobin. We and others described this and related fragments in placenta and menstrual blood and demonstrated broad-spectrum antimicrobial activity against Gram-positive and Gram-negative bacteria, fungi, and HSV-2 (Liepke et al., 2003; Mak et al., 2004; Mak et al., 2007; Groß et al., 2020). These peptides were shown to be active under acidic conditions, with their efficacy modulated by ionic strength and divalent cations such as Mg2+ and Ca2+, and to act synergistically with other endogenous AMPs including HBD-1, LL-37, and HNP-1 (Mak et al., 2007). In those studies, HBB(112–147) was identified through independent biochemical approaches and shown to be processed by physiological proteases such as Napsin A and Cathepsin D (Liepke et al., 2003; Beitzinger et al., 2021). However, antimycobacterial activity had not been previously reported. Our current study extends the known functional profile of this peptide by demonstrating that RapTB exhibits potent activity against Mycobacterium tuberculosis, the causative agent of tuberculosis. This new activity was discovered through the screening of a human lung-derived peptide library, emphasizing the potential role of hemoglobin-derived AMPs in pulmonary host defense. The identification of RapTB in lung tissue- the primary site of Mtb infection- highlights its likely physiological relevance and introduces a new layer of function to this well-characterized peptide. While RapTB effectively killed extracellular Mtb, it failed to co-localize with intracellular bacilli and showed no activity in infected macrophages. This emphasizes the importance of cellular trafficking and intracellular access for antimicrobial function, especially in the context of intracellular pathogens such as Mtb.

The systematic screening of peptide libraries derived from human tissues has proven to be an effective strategy for identifying endogenous AMPs. Using this approach, we previously discovered angiogenin from hemofiltrate, which showed both extracellular and intracellular anti-Mtb activity (Noschka et al., 2021). In contrast to angiogenin, RapTB lacks intracellular activity but is highly effective against extracellular Mtb. Nevertheless, RapTB could contribute to protection against tuberculosis during the early stages of infection when the pathogens logarithmically replicate in the alveolar space before adaptive immunity is initiated (Ryndak and Laal, 2019). RapTB shares important biochemical features with angiogenin (122 aa) including its cationic charge that promotes interaction with negatively charged mycobacterial membranes (Hancock and Sahl, 2006). With a length of 36 amino acids, RapTB is structurally intermediate yet functionally distinct. Interestingly, RapTB is generated by proteolytic cleavage of hemoglobin by Napsin A (Beitzinger et al., 2021), indicating potential crosstalk between host proteases and AMP production.

Our findings also support a broader concept: the proteolytic processing of abundant precursor proteins such as hemoglobin can generate multiple antimicrobial peptides with complementary or synergistic activity. Proteases like Napsin A and Cathepsin D, which are active in lung and placenta, cleave hemoglobin into bioactive fragments including RapTB and related hemocidins (Liepke et al., 2003; Beitzinger et al., 2021; The UniProt Consortium et al., 2023; Walther et al., 2010). These peptides have been shown to act synergistically with other AMPs such as HBD-1 and LL-37 (Mak et al., 2007), suggesting that localized proteolysis may shape a combinatorial AMP response. This mechanism may enhance antimicrobial efficacy, broaden pathogen coverage, and reduce the likelihood of resistance development.

The presence of hemocidins in lung tissue may reflect erythrocyte leakage due to mechanical disruption or inflammation. This is particularly relevant in tuberculosis, where capillary erosion and hemoptysis are common features (Wang et al., 2024). Such events could release hemoglobin into the lung parenchyma, allowing local proteases to generate bioactive peptides that contribute to the innate immune response.

Despite its lack of intracellular activity in its native form, RapTB may still contribute to host defense by limiting early extracellular Mtb replication. Since one of the primary goals of TB therapy is to control this initial bacterial expansion, AMPs like RapTB may serve as valuable adjuncts, especially in cases of multidrug-resistant tuberculosis. In addition to direct antimicrobial activity, hemoglobin-derived peptides have been shown to enhance cytokine release and macrophage activation, suggesting potential immunomodulatory functions as well (Roth et al., 1994). Furthermore, as RapTB is efficiently internalized by macrophages, it could potentially complement the activity of conventional antimycobacterial drugs. For instance, antimycobacterial agents may alter phagosomal integrity or cytosolic trafficking, thereby enabling RapTB to access intracellular Mtb and act synergistically.

To overcome the current limitations in intracellular activity, several strategies may be pursued. One approach is to improve intracellular delivery using nanocarrier systems. Dendritic mesoporous silica nanoparticles (DMSNs) have shown promise for enhancing peptide uptake, providing sustained release, and maintaining low cytotoxicity (Xu et al., 2019; Croissant et al., 2018; Amin et al., 2021; Du and Qiao, 2015). Similarly, liposomal encapsulation can improve intracellular delivery and efficacy of AMPs (Alzahrani et al., 2022). Targeted delivery via conjugation to toxins like C3bot from Clostridium botulinum, which selectively enters monocyte-derived cells, offer the possibility to optimize targeting to infected macrophages (Fellermann et al., 2022). Nanodiamonds are an emerging platform for AMP delivery, enabling enhanced intracellular accumulation, real-time imaging, and co-delivery of multiple therapeutic agents (Chow et al., 2011; Chen et al., 2009; Wu and Weil, 2022). Another strategy to improve RapTB function involves chemical modification of the peptide backbone. Substitution of L-amino acids with D-enantiomers can increase serum stability and reduce immunogenicity, as shown in VEGF and other peptides (Kreil, 1997; Garton et al., 2018; Uppalapati et al., 2016). Such modifications could prolong the half-life of RapTB and protect it from proteolytic degradation.

In summary, we identified RapTB as a hemoglobin-derived AMP with potent activity against extracellular Mtb. Our findings extend the known antimicrobial spectrum of hemocidins and support a role for protease-generated AMPs in pulmonary host defense. Ongoing studies aim to optimize the stability and intracellular trafficking of RapTB using rational peptide design and advanced delivery systems, with the goal of evaluating its potential for adjunctive therapy in severe or drug-resistant tuberculosis.

Data availability statement

The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.

Ethics statement

The studies involving humans were approved by For AMP identification, lung lysate samples from five anonymized donors were obtained from the “Brain Bank Ulm.” The study was approved by the Ethics Committee of Ulm University on October 5, 2012 (Approval No. 274/12; project: generation of peptide libraries from human tissues and organs). Written informed consent was obtained from all donors. For immune cell isolation, fully anonymized leftover whole blood samples were provided by the German Red Cross Ulm. According to §15, no additional ethics approval was required for these samples. No animal studies are presented in this manuscript. The studies were conducted in accordance with the local legislation and institutional requirements. The participants provided their written informed consent to participate in this study.

Author contributions

LK: Conceptualization, Methodology, Visualization, Data curation, Investigation, Writing – review & editing, Formal analysis, Writing – original draft. RN: Writing – review & editing, Data curation. TV: Data curation, Methodology, Writing – review & editing. JMo: Writing – review & editing. MG: Data curation, Writing – review & editing, Formal analysis. JMi: Writing – review & editing, Funding acquisition, Conceptualization. PW: Data curation, Validation, Writing – review & editing, Supervision, Methodology. AR: Software, Writing – review & editing, Visualization, Validation, Methodology, Formal analysis, Data curation. NP: Writing – review & editing, Methodology, Data curation. CR: Writing – review & editing. SW: Writing – review & editing, Data curation, Methodology. LS: Validation, Supervision, Writing – review & editing, Funding acquisition. DRT: Conceptualization, Writing – review & editing. JMü: Funding acquisition, Writing – review & editing, Validation, Conceptualization, Supervision. SS: Funding acquisition, Supervision, Writing – review & editing, Conceptualization, Project administration, Writing – original draft, Methodology, Resources, Validation.

Funding

The author(s) declare that financial support was received for the research and/or publication of this article. This research was funded by the German Research Foundation (CRC 1279 Exploiting the Human Peptidome for Novel Antimicrobial and Anticancer Agents and DFG STE925/4 − 1) and the European Union (TBVAC-Horizon).

Acknowledgments

We thank Marc Zumwinkel, Maabur Sow and Yinke Wu for fruitful discussions and advice. We appreciate the valuable technical support from Vincent Romahn, Markus Zähnle and Carolin Weiss.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

The author(s) declared that they were an editorial board member of Frontiers, at the time of submission. This had no impact on the peer review process and the final decision.

Generative AI statement

The author(s) declare that Gen AI was used in the creation of this manuscript. The language of this manuscript was edited with the assistance of ChatGPT (model: GPT-4o, version: July 2025), a generative AI developed by OpenAI (https://openai.com).

Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2025.1669022/full#supplementary-material

SUPPLEMENTARY FIGURE 1 | Detection of HBB 112–147. Fragmentation spectrum showing the presence of HBB 112–147, VCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH.

SUPPLEMENTARY FIGURE 2 | Detection of RapTB with hemoglobin-ß antibody. After Immunofluorescence staining of RapTB using an anti-HBB antibody and a Cy2-labelled secondary antibody, fluorescent emission is measured. The figure shows a titration of RapTB: 50 μM (A), 5 μM (B), 0.5 μM (C) und 0.05 μM (D).

References

Alzahrani, N. M. , Booq, R. Y. , Aldossary, A. M. , Bakr, A. A. , Almughem, F. A. , and Alfahad, A. J. (2022). Liposome-encapsulated tobramycin and IDR-1018 peptide mediated biofilm disruption and enhanced antimicrobial activity against Pseudomonas aeruginosa. Pharmaceutics 14:960. doi: 10.3390/pharmaceutics14050960

PubMed Abstract | Crossref Full Text | Google Scholar

Amin, M. U. , Ali, S. , Ali, M. Y. , Tariq, I. , Nasrullah, U. , and Pinnapreddy, S. R. (2021). Enhanced efficacy and drug delivery with lipid coated mesoporous silica nanoparticles in cancer therapy. Eur. J. Pharm. Biopharm. Off. J. Arbeitsgemeinschaft Pharm. Verfahrenstechnik EV. 165, 31–40. doi: 10.1016/j.ejpb.2021.04.020

Crossref Full Text | Google Scholar

Beitzinger, B. , Gerbl, F. , Vomhof, T. , Schmid, R. , Noschka, R. , and Rodriguez, A. (2021). Delivery by dendritic mesoporous silica nanoparticles enhances the antimicrobial activity of a napsin-derived peptide against intracellular Mycobacterium tuberculosis. Adv. Healthc. Mater. 10:e2100453. doi: 10.1002/adhm.202100453

PubMed Abstract | Crossref Full Text | Google Scholar

Bosso, M. , Ständker, L. , Kirchhoff, F. , and Münch, J. (2018). Exploiting the human peptidome for novel antimicrobial and anticancer agents. Bioorg. Med. Chem. 26, 2719–2726. doi: 10.1016/j.bmc.2017.10.038

PubMed Abstract | Crossref Full Text | Google Scholar

Chen, M. , Pierstorff, E. D. , Lam, R. , Li, S. Y. , Huang, H. , and Osawa, E. (2009). Nanodiamond-mediated delivery of water-insoluble therapeutics. ACS Nano 3, 2016–2022. doi: 10.1021/nn900480m

PubMed Abstract | Crossref Full Text | Google Scholar

Chow, E. K. , Zhang, X. Q. , Chen, M. , Lam, R. , Robinson, E. , and Huang, H. (2011). Nanodiamond therapeutic delivery agents mediate enhanced Chemoresistant tumor treatment. Sci. Transl. Med. 3:713. doi: 10.1126/scitranslmed.3001713

Crossref Full Text | Google Scholar

Croissant, J. G. , Fatieiev, Y. , Almalik, A. , and Khashab, N. M. (2018). Mesoporous silica and Organosilica nanoparticles: physical chemistry, biosafety, delivery strategies, and biomedical applications. Adv. Healthc. Mater. 7:831. doi: 10.1002/adhm.201700831

PubMed Abstract | Crossref Full Text | Google Scholar

Du, X. , and Qiao, S. Z. (2015). Dendritic silica particles with center-radial pore channels: promising platforms for catalysis and biomedical applications. Small 11, 392–413. doi: 10.1002/smll.201401201

PubMed Abstract | Crossref Full Text | Google Scholar

Fellermann, M. , Stemmer, M. , Noschka, R. , Wondany, F. , Fischer, S. , and Michaelis, J. (2022). Clostridium botulinum C3 toxin for selective delivery of cargo into dendritic cells and macrophages. Toxins 14:711. doi: 10.3390/toxins14100711

Crossref Full Text | Google Scholar

Garton, M. , Nim, S. , Stone, T. A. , Wang, K. E. , Deber, C. M. , and Kim, P. M. (2018). Method to generate highly stable D-amino acid analogs of bioactive helical peptides using a mirror image of the entire PDB. Proc. Natl. Acad. Sci. 115, 1505–1510. doi: 10.1073/pnas.1711837115

PubMed Abstract | Crossref Full Text | Google Scholar

Groß, R. , Bauer, R. , Krüger, F. , Rücker-Braun, E. , Olari, L. R. , and Ständker, L. (2020). A placenta derived C-terminal fragment of β-hemoglobin with combined antibacterial and antiviral activity. Front. Microbiol. 11:508. doi: 10.3389/fmicb.2020.00508

Crossref Full Text | Google Scholar

Hancock, R. E. W. , and Sahl, H. G. (2006). Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nat. Biotechnol. 24, 1551–1557. doi: 10.1038/nbt1267

PubMed Abstract | Crossref Full Text | Google Scholar

Khawbung, J. L. , Nath, D. , and Chakraborty, S. (2021). Drug resistant tuberculosis: a review. Comp. Immunol. Microbiol. Infect. Dis. 74:101574. doi: 10.1016/j.cimid.2020.101574

PubMed Abstract | Crossref Full Text | Google Scholar

Kreil, G. (1997). D-amino acids in animal peptides. Annu. Rev. Biochem. 66, 337–345. doi: 10.1146/annurev.biochem.66.1.337

PubMed Abstract | Crossref Full Text | Google Scholar

Liepke, C. , Baxmann, S. , Heine, C. , Breithaupt, N. , Ständker, L. , and Forssmann, W. G. (2003). Human hemoglobin-derived peptides exhibit antimicrobial activity: a class of host defense peptides. J. Chromatogr. B Anal. Technol. Biomed. Life Sci. 791, 345–356. doi: 10.1016/S1570-0232(03)00245-9

PubMed Abstract | Crossref Full Text | Google Scholar

Maier, F. I. , Klinger, D. , Grieshober, M. , Noschka, R. , Rodriguez, A. , and Wiese, S. (2024). Lysozyme: an endogenous antimicrobial protein with potent activity against extracellular, but not intracellular Mycobacterium tuberculosis. Med. Microbiol. Immunol. (Berl). 213:9. doi: 10.1007/s00430-024-00793-0

Crossref Full Text | Google Scholar

Mak, P. , Siwek, M. , Pohl, J. , and Dubin, A. (2007). Menstrual hemocidin HbB115-146 is an acidophilic antibacterial peptide potentiating the activity of human defensins, cathelicidin and lysozyme. Am. J. Reprod. Immunol. 57, 81–91. doi: 10.1111/j.1600-0897.2006.00456.x

Crossref Full Text | Google Scholar

Mak, P. , Wójcik, K. , Wicherek, L. , Suder, P. , and Dubin, A. (2004). Antibacterial hemoglobin peptides in human menstrual blood. Peptides 25, 1839–1847. doi: 10.1016/j.peptides.2004.06.015

PubMed Abstract | Crossref Full Text | Google Scholar

Migliori, G. B. , Ong, C. W. M. , Petrone, L. , D’Ambrosio, L. , Centis, R. , and Goletti, D. (2021). The definition of tuberculosis infection based on the spectrum of tuberculosis disease. Breathe Sheff Engl. 17:210079. doi: 10.1183/20734735.0079-2021

PubMed Abstract | Crossref Full Text | Google Scholar

Münch, J. , Ständker, L. , Forssmann, W. G. , and Kirchhoff, F. (2014). Discovery of modulators of HIV-1 infection from the human peptidome. Nat. Rev. Microbiol. 12, 715–722. doi: 10.1038/nrmicro3312

PubMed Abstract | Crossref Full Text | Google Scholar

Noschka, R. , Gerbl, F. , Löffler, F. , Kubis, J. , Rodríguez, A. A. , and Mayer, D. (2021). Unbiased identification of Angiogenin as an endogenous antimicrobial protein with activity against virulent Mycobacterium tuberculosis. Front. Microbiol. 11:618278. doi: 10.3389/fmicb.2020.618278

PubMed Abstract | Crossref Full Text | Google Scholar

Noschka, R. , Wondany, F. , Kizilsavas, G. , Weil, T. , Weidinger, G. , and Walther, P. (2021). Gran1: a Granulysin-derived peptide with potent activity against intracellular Mycobacterium tuberculosis. Int. J. Mol. Sci. 22:8392. doi: 10.3390/ijms22168392

PubMed Abstract | Crossref Full Text | Google Scholar

Ries, J. (2020). SMAP: a modular super-resolution microscopy analysis platform for SMLM data. Nat. Methods 17, 870–872. doi: 10.1038/s41592-020-0938-1

PubMed Abstract | Crossref Full Text | Google Scholar

Rodríguez-Alfonso, A. , Heck, A. , Ruiz-Blanco, Y. B. , Gilg, A. , Ständker, L. , and Kuan, S. L. (2022). Advanced EPI-X4 derivatives covalently bind human serum albumin resulting in prolonged plasma stability. Int. J. Mol. Sci. 23:15029. doi: 10.3390/ijms232315029

PubMed Abstract | Crossref Full Text | Google Scholar

Roth, R. I. , Kaca, W. , and Levin, J. (1994). Hemoglobin: a newly recognized binding protein for bacterial endotoxins (LPS). Prog. Clin. Biol. Res. 388, 161–172

PubMed Abstract | Google Scholar

Ryndak, M. B. , and Laal, S. (2019). Mycobacterium tuberculosis primary infection and dissemination: a critical role for alveolar epithelial cells. Front. Cell. Infect. Microbiol. 9:299. doi: 10.3389/fcimb.2019.00299

PubMed Abstract | Crossref Full Text | Google Scholar

Schoen, M. , Reichel, J. M. , Demestre, M. , Putz, S. , Deshpande, D. , and Proepper, C. (2016). Super-resolution microscopy reveals presynaptic localization of the ALS/FTD related protein FUS in hippocampal neurons. Front. Cell. Neurosci. 9:496. doi: 10.3389/fncel.2015.00496

PubMed Abstract | Crossref Full Text | Google Scholar

The UniProt ConsortiumBateman, A. , Martin, M. J. , Orchard, S. , Magrane, M. , and Ahmad, S. (2023). Uniprot: the universal protein knowledgebase in 2023. Nucleic Acids Res. 51, D523–D531. doi: 10.1093/nar/gkac1052

Crossref Full Text | Google Scholar

Uppalapati, M. , Lee, D. J. , Mandal, K. , Li, H. , Miranda, L. P. , and Lowitz, J. (2016). A potent d -protein antagonist of VEGF-A is nonimmunogenic, metabolically stable, and longer-circulating in vivo. ACS Chem. Biol. 11, 1058–1065. doi: 10.1021/acschembio.5b01006

PubMed Abstract | Crossref Full Text | Google Scholar

Walther, P. , Wang, L. , Liessem, S. , and Frascaroli, G. (2010). Viral infection of cells in culture--approaches for electron microscopy. Methods Cell Biol. 96, 603–618. doi: 10.1016/S0091-679X(10)96025-1

PubMed Abstract | Crossref Full Text | Google Scholar

Wang, L. L. , Lu, H. W. , Li, L. L. , Jiang, S. , and Xu, J. F. (2024). Destroyed lung contributes to the recurrence of hemoptysis after bronchial artery embolization in patients with post-tuberculosis bronchiectasis. J. Infect. Public Health 17:102446. doi: 10.1016/j.jiph.2024.05.003

PubMed Abstract | Crossref Full Text | Google Scholar

World Health Organization (2023). Global Tuberculosis Report 2023.

Google Scholar

Wu, Y. , and Weil, T. (2022). Recent developments of Nanodiamond quantum sensors for biological applications. Adv. Sci. Weinh Baden-Wurtt Ger. 9:e2200059. doi: 10.1002/advs.202200059

Crossref Full Text | Google Scholar

Xu, C. , Lei, C. , and Yu, C. (2019). Mesoporous silica nanoparticles for protein protection and delivery. Front. Chem. 7:290. doi: 10.3389/fchem.2019.00290

PubMed Abstract | Crossref Full Text | Google Scholar

Yeaman, M. R. , and Yount, N. Y. (2003). Mechanisms of antimicrobial peptide action and resistance. Pharmacol. Rev. 55, 27–55. doi: 10.1124/pr.55.1.2

PubMed Abstract | Crossref Full Text | Google Scholar

Zhang, J. , Xin, L. , Shan, B. , Chen, W. , Xie, M. , and Yuen, D. (2012). PEAKS DB: De novo sequencing assisted database search for sensitive and accurate peptide identification. Mol. Cell. Proteomics 11:M111.010587. doi: 10.1074/mcp.M111.010587

PubMed Abstract | Crossref Full Text | Google Scholar

Glossary

AMP - Antimicrobial peptide

BSA - Bovine serum albumin

CFU - Colony forming units

CPM - Counts per minute

DAPI - Diamidin-phenylindol

DMSN - Dendritic mesoporous silica nanoparticles

DTT - Dithiothreitol

EDTA - Ethylene diamine tetraacetic acid

GFP - Green Fluorescent Protein

GM-CSF - Granulocyte-macrophage colony-stimulating factor

HBB - Hemoglobin subunit ß

HRS - Hours

HSV-2 - Herpes simplex virus type 2

MGIA - Mycobacterial growth inhibition assay

MOI - Multiplicity of infection

Mtb - Mycobacterium tuberculosis

OADC - Ölsäure-Albumin-Dextrose-Katalase

OsO₄ - Osmium tetroxide

PBMC - Peripheral blood mononuclear cell

PBS - Phosphate buffered saline

PFA - Paraformaldehyde

TB - Tuberculosis

TFA - Trifluoroacetic acid

VEGF - Vascular endothelial growth factor

Keywords: tuberculosis, antimicrobial peptides, human, lung, endogenous peptide

Citation: Klevesath L, Noschka R, Vomhof T, Mohnani J, Grieshober M, Michaelis J, Walther P, Rodriguez A, Preising N, Read C, Wiese S, Ständker L, Thal DR, Münch J and Stenger S (2025) RapTB: a lung-derived hemoglobin fragment with activity against Mycobacterium tuberculosis. Front. Microbiol. 16:1669022. doi: 10.3389/fmicb.2025.1669022

Received: 18 July 2025; Accepted: 03 October 2025;
Published: 24 October 2025.

Edited by:

Shuyi Ma, Seattle Children's Research Institute, United States

Reviewed by:

Krishnamohan Atmakuri, Translational Health Science and Technology Institute (THSTI), India
Niti Singh, Translational Health Science and Technology Institute (THSTI), India

Copyright © 2025 Klevesath, Noschka, Vomhof, Mohnani, Grieshober, Michaelis, Walther, Rodriguez, Preising, Read, Wiese, Ständker, Thal, Münch and Stenger. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

*Correspondence: Steffen Stenger, U3RlZmZlbi5zdGVuZ2VyQHVuaWtsaW5pay11bG0uZGU=

Disclaimer: All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.