ORIGINAL RESEARCH article

Front. Microbiol., 03 December 2025

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 16 - 2025 | https://doi.org/10.3389/fmicb.2025.1673320

Unraveling the genome-wide repertoire of the novel chromosomally encoded mcr-8.6 gene variant in Klebsiella michiganensis isolated from manure

  • 1. National Reference Laboratory of Antibiotic Resistances and Healthcare Associated Infections, Department of Infectious Diseases, National Institute of Health Dr. Ricardo Jorge, Lisbon, Portugal

  • 2. Technology and Innovation Unit, Department of Human Genetics, National Institute of Health Dr. Ricardo Jorge, Lisbon, Portugal

  • 3. Laboratory of Biology and Ecotoxicology, Department of Environmental Health, National Institute of Health Dr. Ricardo Jorge, Lisbon, Portugal

  • 4. Centre for the Studies of Animal Science, Institute of Agrarian and Agri-Food Sciences and Technologies, University of Porto, Porto, Portugal

  • 5. Associate Laboratory for Animal and Veterinary Sciences (AL4AnimalS), Lisbon, Portugal

  • 6. Faculty of Veterinary Medicine, Center for Interdisciplinary Research in Animal Health (CIISA), University of Lisbon, Lisbon, Portugal

Abstract

The increasing rates of colistin resistance worldwide poses a significant threat to public health. While the most commonly described variant is mcr-1, other variants such as mcr-8 have been detected, typically associated with Klebsiella pneumoniae. However, little is known about the prevalence of mcr-8 in other bacterial species and environmental reservoirs. This study aimed to characterize a novel mcr-8 subvariant identified in a Klebsiella michiganensis strain isolated from manure in Portugal, collected during an annual longitudinal survey at an Open Air laboratory, as well as to depict its genomic context and potential mobility mechanisms. The strain was subjected to phenotypic susceptibility testing, whole-genome sequencing and hybrid genome assembly. In silico analysis included identification of resistance genes and mobile genetic element. The new gene variant mcr-8.6 and its genetic environment were characterized. The F731 strain presented susceptibility to colistin with a MIC = 0.25 mg/L, despite carrying a novel mcr-8 subvariant, mcr-8.6, which was located within a 61.6 kb chromosomal genomic island. This variant presented 23–24 amino acid substitutions compared to previous characterized MCR-8 proteins. The genomic island also harbored multiple insertion sequences (IS110, IS66, IS3), virulence factors, and metabolic and regulatory proteins, among others. Synteny analysis revealed high sequence identity between this genomic island and both chromosomal and plasmid regions from other bacterial strains isolated from different reservoirs worldwide, indicating prior mobility. Furthermore, other antimicrobial resistance genes were detected [e.g., aph(3)-la, blaOXY–1–2], but no plasmid replicons were identified. This is the first report of a mcr-8 gene in a K. michiganensis, as well as the first occurrence in Portugal. Although F731 remains colistin-susceptible, the presence of a novel mcr-8.6 chromosomally encoded but located in a mobile genomic island underscores the risk of future horizontal gene transfer. These findings highlight the importance of further monitoring and continued surveillance in environmental and animal compartments in order to track the dissemination of antimicrobial resistance.

1 Introduction

Colistin, as a polymyxin, was moved by the World Health Organization (WHO) to the “Highest Priority Critically Important Antimicrobials for Human Medicine” since 2018 (World Health Organization, 2018). Its increasing use as one of the last-resort antimicrobials available for treating infections caused by carbapenem-resistant bacteria, simultaneously with its extensive use in veterinary medicine and animal production, have led to the emergence of colistin resistance (; ; ).

Colistin resistance, which is related to the modification of the negatively charged outer membrane lipopolysaccharides of Gram-negative bacteria, can be encoded through chromosomal mechanisms or plasmid-borne resistance genes (Snesrud et al., 2018; Zelendova et al., 2023). Particularly concerning are the plasmid-encoded mcr genes, as they allow the horizontal gene transfer (HGT) of colistin resistance among bacteria shared across humans, animals, and the environment (Liu et al., 2024).

The first plasmid-mediated colistin resistance gene, mcr-1, was detected in 2015 (Liu et al., 2016). Since then, twelve variants of this mobile gene have been detected in human (e.g., patients), animal (poultry, wild animals) and environmental samples from different sources, such as water matrices, agriculture, manure (; Manageiro et al., 2020; ; Rebelo et al., 2021; Torres et al., 2021; Teixeira et al., 2025). Indeed, the environment is considered an important reservoir of antimicrobial resistance genes (ARGs), and a potential amplifier of antibiotic resistance, where manure, as fertilizer, may contribute to the persistence of resistance genes, e.g., mcr genes, posing a potential public health risk (Lima et al., 2020; Teixeira et al., 2025). While mcr-1 gene was first detected in Enterobacterales in China, within the six months following this description, plasmids carrying mcr-1 gene were found in higher incidence in animal strains worldwide, including in the Europe (Mmatli et al., 2022).

The true prevalence of colistin resistance rates in Enterobacterales, however, remains unclear, because colistin susceptibility testing is not performed routinely in many settings and existing data are not fully representative (Prim et al., 2017). Some European countries might have implemented routine testing, particularly in reference laboratories or for multidrug-resistant isolates, however, there are yet methodological limitations and variability in surveillance practices. The last report (2014) from the European Antimicrobial Resistance Surveillance Network (EARS-Net), regarding colistin surveillance, collected antimicrobial resistance data from clinical invasive strains presented by European countries; the data showed that countries with high percentages of carbapenem resistance also reported elevated numbers of clinical strains resistant to polymyxin, indicating a further loss of effective antimicrobial treatment options. Specifically, among all carbapenem-resistant K. pneumoniae and Escherichia coli clinical strains, 29.0% and 4.4% were co-resistant to polymyxin, respectively ().

In Portugal, colistin resistance among clinical Enterobacterales isolates remains relatively low compared to some Southern European countries, as Greece and Italy, where 26.0% (2014) and 46% (2018) of K. pneumoniae were, respectively, resistant to polymyxin (Shahzad et al., 2023). The frequency of clinical invasive colistin-resistant E. coli strains, in Portugal, remained low and sporadic over the years 2015 and 2019, however, slightly decreasing in 2024; for clinical invasive K. pneumoniae strains, colistin resistance showed greater variability (personal communication, M. Caniça). Until date, mcr-1 is the most frequently detected variant in Portugal in different reservoirs (Mendes et al., 2018; Manageiro et al., 2020; Portes et al., 2022; ), mcr-9 in patients and fish farming (Manageiro et al., 2022; Silveira and Pista, 2023), and mcr-4 have also been detected but restricted to pigs (Lima et al., 2022; ).

The mcr-8 gene, like other mcr variants, alters the bacterial outer membrane, and its origin has been linked to an environmental bacteria, Kosakonia sacchari, which carries a putative chromosomal gene encoding a protein that shares 70% amino acid identity with MCR-8 (). The mcr-8 variant has been identified in several Enterobacterales species, mostly in K. pneumoniae, Klebsiella quasipneumoniae, Raoultella ornithinolytica, in every continent, although the majority of reports originate from Asia (Wang et al., 2018, 2019; ; Mo et al., 2024; Zhang et al., 2025). However, mcr-8 has not been detected in Klebsiella michiganensis, which belongs to the Klebsiella oxytoca complex (Shibu et al., 2021; Prah et al., 2022). This is alarming, as these bacteria are reported in clinical settings, carrying clinically relevant ARGs, and are responsible for bloodstream infections, nosocomial infections and severe septicaemia, especially in premature infants and immunocompromised patients (; Zheng et al., 2018; Seiffert et al., 2019; ; Li et al., 2022; Prah et al., 2022; Simoni et al., 2023; Zhang et al., 2023; Xu et al., 2024). One of the most concerning threats arises when plasmid-mediated mcr genes co-occur with other ARGs, whether plasmid-borne or chromosomal encoded, within the same bacterial pathogen (Long et al., 2019; Zhou et al., 2022).

The aim of this study was to evaluate the potential evolutionary relationship and genome-wide repertoire of a novel subvariant of the mcr-8 gene detected in K. michiganensis, isolated from manure, particularly in comparison to previously reported mcr-8 subvariants and their association with mobile genetic elements (MGEs) potentially involved in the acquisition of mcr-8.6.

2 Materials and methods

2.1 Sampling, isolation and bacteria identification

The strain F731 was isolated from manure, composed by animal feces, mostly of pigs, collected during an annual longitudinal study in December 2020 at an experimental agricultural and agri-food production station in Portugal (Open Air Laboratory), located in Santarém, Vale de Santarém, 75 km from Lisbon. Sample collection, transport and storage procedures were previously described.1,2 Then, the manure was mixed with buffered peptone water and inoculated on MacConkey agar containing 0.5 mg/L of colistin, followed by isolation on simple agar medium overnight at 35 °C.3 Species identification was performed using VITEK®2 Automated Identification System (BioMérieux, Marcy-l’Étoile, France) and MALDI-TOF (BioMérieux, Marcy-l’Étoile, France). The strain was preserved at −80 °C in Trypticase soy broth with 20 % glycerol.

2.2 Antimicrobial susceptibility testing

Antimicrobial susceptibility testing was performed using the disk diffusion method. A total of 13 antimicrobial were tested, covering the following classes: β-lactams, including amoxicillin/clavulanic acid (20+10 μg), cefotaxime (30 μg), ceftazidime (30 μg), cefepime (30 μg), piperacillin/tazobactam (36 μg), aztreonam (30 μg), ertapenem (10 μg), imipenem (10 μg), meropenem (10 μg), and cefoxitin (30 μg); aminoglycosides represented by gentamicin (10 μg); fluoroquinolones represented by ciprofloxacin (5 μg); and sulfonamides, represented by co-trimoxazol (25 μg). Resistance mechanisms were inferred through synergy testing using the following compounds: boronic acid to detect class A carbapenemases; cloxacillin alone to detect AmpC β-lactamases; cloxacillin in combination with amoxicillin/clavulanic to identify AmpC β-lactamases and ESBLs; dipicolinic acid with meropenem to detect metallo-β-lactamases; faropenem to indicate carbapenemase production; and temocillin to infer the presence of OXA-48-producing isolates (disks from Bio-Rad, Marnes-la-Coquette, France). E. coli ATCC 25922 was used as control strain and the results were interpreted according to the critical diameters defined by EUCAST v.2025 (European Committee on Antimicrobial Susceptibility Testing; EUCAST, 2025).

The minimum inhibitory concentration (MIC) for colistin was determined by the microdilution method using an in-house broth used in a 96-well microdilution plate prepared at the National Institute of Health Dr. Ricardo Jorge (INSA). EUCAST guidelines and EN/ISO 17025 standards were followed. E. coli ATCC 25922 and E. coli NCTC 13846 were used as control strains for susceptibility and resistance, respectively, to colistin. The results were interpreted based on clinical breakpoints defined by EUCAST guidelines (2025) for Enterobacterales (susceptible ≤ 2 mg/L; resistant > 2 mg/L).4

2.3 Whole-genome sequencing

Genomic DNA was extracted from a freshly grown overnight culture using the MagNA Pure 96 instrument (Roche, Manheim, Germany) and quantified with a Qubit™ 4 fluorometer (Thermo Scientific, Waltham, USA) using the Qubit dsDNA BR Assay Kit, following the manufacturer’s instructions.

2.3.1 Illumina short-read sequencing

The sequencing library was prepared using the Nextera XT Library Preparation Kit (Illumina, San Diego, USA) and sequenced on an Illumina MiSeq platform with 150 bp paired-end reads, following the manufacturer’s guidelines. Sequencing data was processed for quality control of raw reads, de novo assembly, and species confirmation using INNUca (v4.2.2).5 The INNUca pipeline encompasses read quality assessment using FastQC (v0.11.5),6 trimming with Trimmomatic (v0.38) (), and genome assembly with SPAdes (v3.14.0) (). Completeness of the genome was evaluated using BUSCO (v5.5.0) (Simão et al., 2015).

2.3.2 Nanopore long-read sequencing

The MinION library was prepared using the SQK-RBK114.24 Rapid Barcoding Kit and a MinION R10.4.1 flow cell, and then sequenced on a Mk1C device (Oxford Nanopore Technologies, Oxford, UK) for 72 h. Basecalling and barcode trimming were performed on the sequencing device, following the model Dorado (v7.6.7). Overall read quality was assessed using pycoQC (v2.5.2) (Leger and Leonardi, 2019) and Nanoplot (v1.42.0) ().

2.4 In silico analysis of genomic data

Hybrid de novo assembly was performed using Hybracter (v0.7.3) pipeline (), followed by analyses of the hybrid assembled genome. Species confirmation was performed based on Average Nucleotide identity (ANI) using FastANI (v1.33) () against Klebsiella spp. reference genomes from NCBI.7 Detection of ARGs, plasmids replicons and virulence factors were performed using abriTAMR (v1.0.14) (Sherry et al., 2023) and ABRicate (v1.0.1).8 ABRicate incorporates the following databases: NCBI, ResFinder, CARD, PlasmidFinder, VFDB (17.09.2024). Genomic islands were searched using the tool IslandViewer4 (). The genome sequence was annotated using Prokaryotic Genome Annotation Pipeline (PGAP-2023-10-03.build7061) (Tatusova et al., 2016).

For genome comparisons, BLASTn was used (). The genetic context of mcr genes was mapped and analyzed using pyGenomeViz (v0.4.4),9 and the final figure was edited for layout and labeling in Inkscape (v1.4.2).

The amino acid sequences of MCR variants were downloaded from NCBI10 and compared with the variant detected in this study using Jalview (v2.11.4.1) (Waterhouse et al., 2009). A Neighbor Joining tree (BLOSUM62) was generated and exported in Newick format and visualized on iTOL (v7) (Letunic and Bork, 2021).

2.5 Nucleotide sequence accession numbers

The new mcr-8.6 nucleotide sequence was submitted to NCBI under the accession number PV035885 and the total genome sequence of F731 was deposited on GenBank under the accession number CP182858.

3 Results

3.1 Species identification and phenotypic characterization

F731 was initially identified as K. oxytoca by the VITEK®2 Automated Identification System and MALDI-TOF. However, ANI analysis, using the single contig from the hybrid genome assembly with 92× coverage, a total length of 6,048,658 bp, and a GC content of 55.85%, confirmed the strain as K. michiganensis with 99.2% identity compared to reference Klebsiella genomes.

Regarding the antimicrobial susceptibility testing, the strain presented resistance to the antimicrobial class aminoglycoside (gentamicin), and susceptibility to all other classes tested, including β-lactams (amoxicillin/clavulanic acid, cefotaxime, ceftazidime, aztreonam, cefepime, piperacillin/tazobactam, ertapenem, meropenem, imipenem, and cefoxitin), fluoroquinolones (ciprofloxacin) and sulfonamides (co-trimoxazol). No synergy was observed between antimicrobials and the respective inhibitors referred in material and methods section (boronic acid, cloxacillin and dipicolinic acid). The MIC for colistin was 0.25 mg/L, classifying the strain as susceptible according to EUCAST breakpoints.

3.2 ARGs, virulence factors and plasmids

Strain F731 harbored multiple ARGs and virulence factors (Supplementary Tables 1, 2). The ARGs and their variants identified included blaOXY–1–2 (encoding a class A β-lactamase capable of hydrolysing penicillin and 1st generation cephalosporins); aph(3)-la (encoding for an aminoglycoside phosphotransferase); oqxA10 and oqxB9 (components of an efflux pump that mostly leads to diminished susceptibility to quinolones and chloramphenicol); and fosA9-type that confers resistance to fosfomycin. A novel subvariant of mcr-8, the mcr-8.6, was also identified, as well as eptB and arnT that are all involved with the reduction of colistin efficacy and binding. In addition, genes were detected that confer resistance to multiple classes as they are efflux pumps or regulators that influence other ARGs, such as acrA, acrB, acrD, mdtB, mdtC, mdtQ, emrD, emrR, marA, ramA, cpxA, H-NS and CRP, as well as genes that lead to modifications or losses in outer membrane components which alter bacteria permeability, including ompK37, ompA, lptD, kpnE, kpnF, kpnG, kpnH and msbA.

Genes conferring metal resistance were also detected, including arsR and arsC that confer resistance to arsenic, terD, terC and terB to tellurite, leading to the capability of surviving in toxic metal concentrations. Notably, the strain also harbored virulence factors, such as ybtA, ybtE, ybtP, ybtQ, ybtS, ybtT, ybtU, ybtX, irp1, irp2 involved in siderophore-dependent iron transport system, as well as fyuA, entA and entB for iron acquisition (; Penwell et al., 2012); mgtB related to Mg2 + transport, yagZ/ecpA involved with adhesion, and ompA which is also considered a virulence factor that can also lead to adherence, invasion and biofilm formation (Scheller et al., 2021). No plasmids were detected.

3.3 A new variant of the mcr-8 gene

Analysis with both abriTAMR and ABRicate identified the mcr-8.1 gene with values of 99.94% coverage and 95.41% identity, suggesting the presence of sequence divergence compared to the reference, likely due to mutations or other genetic variations. To further assess these differences, a maximum likelihood phylogenetic tree was constructed, that included F731 mcr-8-type along with all known mcr-8 subvariants (mcr-8.1, mcr-8.2, mcr-8.3, mcr-8.4, mcr-8.5) and one representative of all other mcr gene families (mcr-1.1, mcr-2.1, mcr-3.1, mcr-4.1, mcr-5.1, mcr-6.1, mcr-7.1, mcr-9.1, mcr-10.1, mcr-11, mcr-12) (Figure 1). F731 mcr gene consistently clustered within the mcr-8 clade, indicating this may represent a novel subvariant. This conclusion is reinforced by the branch length value of 75.2, equalling 0.752 substitutions per alignment position, separating F731 mcr-8-type from other mcr-8 subvariants, which indicates a clear genetic distance within this group.

FIGURE 1

; ; Yin et al., 2017; ; Yang et al., 2018, 2019; Wang et al., 2018, 2019, 2020; ; ; Sun et al., 2020).

Further evidence supporting the novelty of this variant was provided by the differences observed at the protein level through amino acid sequence alignment of MCR-8 subvariants (Table 1; Supplementary Table 3). The MCR-8 protein identified in F731 differed from previously described variants by 23–24 amino acids (Table 1). Additionally, it had a two amino acid insertion (Ser-566 and Lys-567), which is only present in the subvariant from CTHL.F3a and has not yet been characterized. Overall, these amino acid differences collectively allowed to identify a novel variant of the MCR-8 protein, which encodes to a new mcr-8-type gene, which was submitted to NCBI and classified as mcr-8.6.

TABLE 1

Amino acid residues at positions where F731 differs from other MCR-8 variants
Subvariant394151134141146149169216219232296301348356365391399404421444466480488500504508512513520535549553555564565566567
MCR-8.1VVAVLNGAISANVIGNTTSVRSNFKEGKQYKHSANG
MCR-8.2VVVVLNGAISSNVIGYTTSVRSKFKEGKQYKHSANG
MCR-8.3VVAVLNGAISANVIGNKTSVRSNFKEGKQYKHSANG
MCR-8.4VVAVLNGAISANVIGNTTRVRSNFKEGKQYKHSANG
MCR-8.5VVVVLNGAISSNVIGNTTSVRSNIKEGKQFKHSADG
MCR-8-type CTHL.F3aVVVMLIRTTRASIVGHTASIHRNFRVSNQYKRTAMVSK
MCR-8.6 (F731)AFVVSIRTTRASVVSHTTSVRRNFRASNKYNHSSMVSK

Amino acid variations of the MCR-8.6 subvariant compared with other previous described MCR-8 subvariants.

In red: amino acid substitutions; In blue: phosphoethanolamine transferase N-terminal domain; In green: sulfatase N-terminal domain.

3.4 Identification of a putative genomic island carrying mcr

The mcr-8.6 is located within a genomic island with a length of 61.562 Kb (Figure 2). This region contains multiple MGEs, including an integrase and an IS110 transposase flanking the mcr gene. Further along the genomic island, other MGEs are present, such as IS66, IS3, and another IS110. Adjacent to mcr-8.6, several other genes with diverse functions were detected, including ATP-binding cassette transports, transcriptional regulators, serine hydrolase domain-containing proteins, and potential virulence factors, such as fimbrial pilus enabling adhesion to surfaces and host cells.

FIGURE 2

To further characterize the genomic island, synteny analyses were performed (Figure 3). Comparison of F731 genomic island with both chromosomal (e.g., CTHL.F3a) and plasmid sequences (e.g., pKP91, ptgc-02, QDRO2) revealed homologous regions with high sequence identity (90%–100%). The chromosomal sequences of Klebsiella sp. CTHL.F3a, isolated from a cabbage in Hong Kong, displayed a high degree of homology with the genes flanking the mcr-8.6 gene in the F731 strain. However, CTHL.F3a harbors a different MCR-8-type subvariant, which differs by 16 amino acids.

FIGURE 3

Similarly, the region adjacent to mcr-8.1 subvariant (length between 16,267 and 16,801 base pairs), and present in plasmids pK91, QDRO2 and ptgc-02-mcr, is highly conserved and also found adjacent to mcr-8.6 in F731. The slightly differences observed correspond mainly to intergenic regions. This conserved region was also identified in 96 other plasmids/chromosome, according to BLASTN results (Supplementary Table 4), as well as in the chromosome of strain CTHL.F3a (Figure 3). The similarity between the genomic island in F731 and the regions referred above suggests that this island shares a common genetic backbone with other bacterial strains.

4 Discussion

In this study, we identified a novel mcr-8 subvariant (mcr-8.6) located within the chromosome of a K. michiganensis strain, recovered from manure collected in an Open Air Laboratory in Portugal. To the best of our knowledge, this is the first report of an mcr-8-positive strain in Portugal and the first identification of this gene in a K. michiganensis worldwide. Our results demonstrate that the mcr-8.6 is located within a genomic island that shares a common genetic backbone with other mcr-8-type gene harboring MGE. Additionally, the MCR-8 protein exhibits significant amino acids variations in regard to previously detected MCR-8 subvariants.

K. michiganensis, where mcr-8.6 was identified, belongs to the K. oxytoca complex, and is often misidentified, which occurred in this study, as K. michiganensis is rarely included in MALDI-TOF databases (Shibu et al., 2021; Prah et al., 2022). This is alarming, as this bacterium is an emerging nosocomial pathogen that has been reported also in clinical settings, carrying clinically relevant ARGs, such as blaKPC–3, blaVIM–1, blaSIM–1, mcr-9 (; Zheng et al., 2018; Seiffert et al., 2019; ; Li et al., 2022; Prah et al., 2022; Simoni et al., 2023; Zhang et al., 2023). Although F731 carried numerous genes that are involved with antimicrobial resistance, only a few were phenotypically relevant, resulting in a matching susceptibility profile. Among them, aph(3)-la suggests to be responsible for the phenotypic resistance to aminoglycoside. Meanwhile, the susceptible phenotypic corresponding to the blaOXY–1–2 gene was expected, as it is a chromosomally encoded β-lactamase gene that is constitutively expressed at low levels in the Klebsiella genus, which is insufficient to hydrolyse the antimicrobial effectively unless in the presence of mutations in the promotor region (Yang et al., 2022).

By contrast, the colistin MIC susceptible result was less expected (MIC = 0.25 mg/L), as the other mcr-8 gene subvariants generally confer a resistant phenotype with MICs ≥ 4

(Wang et al., 2018; ; ; Figure 1). Discrepancies between the detection of some variants of mcr genes and a susceptible phenotype to colistin have been previously reported, depending on bacterial species, serotype, and/or source of isolation (; ). To the best of our knowledge, previously described mcr-8-positive strains have consistently exhibited a colistin resistance phenotype. However, most mcr-8 genes detected so far are plasmid-borne and might exist in multiple copies per cell, which can enhance resistance phenotype (Wang et al., 2018, 2019; ; Salloum et al., 2020; Liu et al., 2022), unlike the chromosomally encoded gene in F731. In fact, Zhang et al. (2017), observed that the chromosomally encoded mcr-1 had lower expression levels than most plasmid-mediated mcr-1 levels (Zhang et al., 2017). The integration into the chromosome can lead to the downregulation of both gene expression levels and/or regulatory elements, as well as due to the broader context background of the bacterial strain that can also influence whether a resistance gene leads to an observable resistant phenotype (Suzuki et al., 2014; Zhang et al., 2017; ).

Alternatively, this discrepancy between the genotype and phenotype may result from amino acid substitutions in F731’s MCR-8 that affects its conformation. Indeed, these mutations occur in essential regions such as the phosphoethanolamine transferase N-terminal domain (amino acids 58 to 210), which includes the active site for enzymatic activity, potentially causing partial or complete inactivation of the MCR-8 enzyme. Similar effects may arise from substitutions in the sulfatase N-terminal domain (amino acids 236 to 529), also involved in enzymatic activity ().11 In some cases, a single mutation can determine antimicrobial susceptibility, as illustrated by MCR-5, where a substitution of Ser284 by Asp reduces colistin resistance (Suzuki et al., 2014; ). Even if the expression of mcr-8.6 is associated with susceptibility to colistin, in future, possible exposure to colistin selection pressure may not only lead to new adaptive mutations, but also to new genomic rearrangements, which both or individually may restore or enhance resistance functions (Lee et al., 2016).

Within the Klebsiella genus, many strains have evolved to become a significant clinical and public health threats worldwide, driven by multidrug resistance, and recently, also hypervirulence (Xu et al., 2024). Virulence-associated genes were identified in F731, particularly those linked to biofilm formation, host-cell adhesion, and nutrient uptake via siderophores, all of which have been associated with severe clinical infections (Xu et al., 2024). Additionally, mutations affecting quinolone resistance (gyrA and parC), porin function (ompK36), and efflux pump regulation (e.g., acrAB, oqxAB, ramA and rarA), some of these found in F731 (such as acrA, acrB, ompK, oqxA, oqxB, ramA), are also frequently reported among the emergence of multidrug-hypervirulent Klebsiella spp (; ). However, it is important to note that the mere presence of virulence genes does not guarantee that these will be expressed. They are only activated under certain circumstances, such as when the host is immunocompromised, allowing the bacteria to enter a pathogenic state, which is concerning, as it remains a potential threat for these patients (Xu et al., 2024).

Colistin has been extensively used in both human and veterinary medicine worldwide, especially in pig farming, where it is applied for the prevention, treatment of diseases, and as a growth promotor (Kempf et al., 2016; Rhouma et al., 2016). Since 1st January 2006, however, the use of antibiotics as growth promotors were banned for the as growth promoters has been banned in the European Union [Regulation (EC) 1831/2003]. Outside of Europe, colistin continued to be used as a growth promotor until later, such as China who only prohibited in 2017. In the European Union, colistin use was restricted to veterinary therapeutic purposes (Walsh and Wu, 2016). In 2016, the European Medicines Agency (EMA), advised to minimize colistin for animals and restrict its use to last-resort situations (), and since then, several countries, such as Denmark, Spain, the UK, Italy, and Portugal, introduced voluntary bans or significant restrictions during the following years (; ). Since January 2022, European Union regulations on veterinary medicines [Regulation (EU) 2019/6] and medicated feed [Regulation (EU) 2019/4] have banned for routine use of antimicrobials in farming, including preventive group treatments (More, 2020).12,13 Despite these restrictions, colistin resistance genes, especially plasmid-mediated mcr variants, continue to be reported worldwide, posing a challenge to clinical use of this antimicrobial as a last resort treatment. In Portugal, mcr-1 is the most prevalent variant of plasmid-mediated colistin resistance genes, being frequently detected in human, animal and environmental samples, reflecting the selective pressure induced by prior colistin use across several reservoirs (Mendes et al., 2018; Manageiro et al., 2020; ). Other variants such as mcr-4 () and mcr-9 (Manageiro et al., 2022) have also been detected. The mcr-8 gene has already been detected in Europe, specifically in Ireland, France and the Netherlands (; Zhang et al., 2025). However, our findings add new evidence to the growing list of mcr subvariants with the first report of mcr-8.6 in Portugal (Figure 4).

FIGURE 4

Chromosomal encoded resistance genes typically imply a reduced immediate risk of transmission compared to those carried on plasmids. Nonetheless, in F731, the mcr-8.6 subvariant is chromosomally located within a genomic island, which may facilitate mobilization and highlights the potential risk for HGT dissemination (Riquelme et al., 2023). Genomic islands play a significant role in bacterial adaptation and evolution, and typically consist of two key regions: (i) a “multidrug resistance region,” enriched with integrons, insertion sequences, and transposons that facilitate ARG acquisition and incorporation; and (ii) a “core region,” containing genes essential for the island’s stability and maintenance. Thus, genomic islands not only carry ARGs but also the necessary machinery for their mobilization (Morita et al., 2020; ). Indeed, the genomic island carrying mcr-8.6 in F731 harbors multiple insertion sequences, such as IS110, IS66, IS630 and IS3, as well as an integrase gene, suggesting previous mobility events. In fact, e.g., the IS110 family transposases has been described to co-occur frequently with Tn3 in bacterial resistance islands and are found integrated in plasmids, where its specific mode of action may facilitate excision, formation of a circular double-stranded DNA, and integration into the target DNA sequence (; ; Wang and Dagan, 2024).

Furthermore, the high degree of sequence identity of the regions flanking the new mcr-8.6 gene among both plasmid and chromosomal sequences highlights the potential mobility of mcr genes. However, the total sequence of the genetic island has not been identified previously in other strains. Notably, plasmids can integrate into the chromosome via site-specific recombination events involving insertion sequences, e.g., IS3, present in the F731 genomic island (Mark Osborn and Böltner, 2002). The presence of a tyrosine-type recombinase/integrase further supports that the genomic island may have originated from another MGE, as these enzymes enable excision from the chromosome in a recA-independent manner, a mechanism commonly associated with plasmids, phages and integrative elements (Mark Osborn and Böltner, 2002). However, classic plasmid housekeeping genes (e.g., rep, par, tra, mob) were not detected in F731, emphasizing that the presence of integrases and insertion sequences alone is insufficient to confirm a plasmid origin (Mark Osborn and Böltner, 2002).

K. michiganensis strain F731 was detected during an annual longitudinal study conducted at an Open Air Laboratory, that covered a crop growing cycle, involving interconnected environmental compartments along the following pathway: pig farm → manure → soil → crop/food/feed → ground/surface water → pig farm. F731 strain was isolated from manure, which highlights the critical role of manure as a potential high-risk reservoir-of resistance determinants in agricultural soils and along the food/feed chain. Importantly, the detection of mcr-8.6 in this matrix raises concerns about the potential spread of this ARG beyond the farm environment. The use of manure as fertilizer may facilitate the dissemination to bacteria in soil, water, crops and animal microbiota, and thereby, increasing the risk of transmission to human via different pathways (e.g., food and water consumption, occupational exposure, animal contact). Such environmental reservoirs can serve as a bridge between agricultural and clinical settings, contributing to the spread of resistance determinants into healthcare (Lima et al., 2020; Marutescu et al., 2022).

5 Conclusion

In this study, we characterized the antimicrobial resistance profile of a K. michiganensis strain recovered from manure in Portugal. The detection of a novel chromosomal mcr-8 subvariant, mcr-8.6, marked the first report of this gene in Portugal, and in a K. michiganensis worldwide. Although F731 remained susceptible to colistin, the occurrence of new mutations could potentially lead to the development of a resistance phenotype in the future. The mcr-8.6 gene was located within a putative genomic island adjacent to other MGEs (e.g., IS110 and IS3), indicating past HGT events and highlighting the potential of future mobilization of this ARG across different bacteria species. In addition, the high similarity of the regions flanking mcr-8.6 with both chromosomal and plasmid sequences from other bacterial strains emphasize the genetic plasticity of MGE associated with mcr genes. Collectively, these results highlight the diversity of mcr gene variants and subvariants and their association with MGEs, as observed by the genetic context of mcr-8.6.

Overall, these findings reinforce the need for continued monitoring and surveillance in environmental and animal compartments of antimicrobial resistance. Furthermore, it also calls for tracking the spread of ARGs over time, through their environmental risk assessment, to identify emerging variants and to map transmission pathways between environmental, animal and clinical reservoirs. Such efforts are essential to preserve last resort antimicrobials, including colistin.

Statements

Data availability statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in this article/Supplementary material.

Author contributions

RR: Investigation, Methodology, Validation, Writing – review & editing, Formal analysis, Writing – original draft. PT: Formal analysis, Investigation, Methodology, Validation, Writing – review & editing. CS: Methodology, Writing – review & editing. MR: Methodology, Writing – review & editing. ED: Methodology, Writing – review & editing. VM: Methodology, Writing – review & editing, Validation. MC: Methodology, Validation, Writing – review & editing, Conceptualization, Funding acquisition, Investigation, Project administration, Supervision.

Funding

The authors declare financial support was received for the research and/or publication of this article. RR, PT, and MR were granted by Agendas/Alianças mobilizadoras para a Reindustrialização (no. 5, SMARTgNOSTICS project). This work was supported by funding from the European Union’s Horizon 2020 Research and Innovation programme under grant agreement no 773830: One Health European Joint Programme (FED-AMR project), and from Agendas/Alianças mobilizadoras para a Reindustrialização (no. 5, SMARTgNOSTICS project).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Generative AI statement

The authors declare that no Generative AI was used in the creation of this manuscript.

Any alternative text (alt text) provided alongside figures in this article has been generated by Frontiers with the support of artificial intelligence and reasonable efforts have been made to ensure accuracy, including review by the authors wherever possible. If you identify any issues, please contact us.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2025.1673320/full#supplementary-material

References

  • 1

    AbuOunM.StubberfieldE. J.DuggettN. A.KirchnerM.DormerL.Nunez-GarciaJ.et al (2017). MCR-1 and MCR-2 variant genes identified in Moraxella species isolated from pigs in Great Britain from 2014 to 2015.J. Antimicrob. Chemother.7227452749. 10.1093/jac/dkx286

  • 2

    AhmedM.AbouzeedY.DawM. (2025). Global initiatives to phase-out colistin use in food-producing animals.Open Vet. J.15533540. 10.5455/OVJ.2025.v15.i2.4

  • 3

    Al-MirH.OsmanM.DrapeauA.HamzeM.MadecJ.-Y.HaenniM. (2021). WGS analysis of clonal and plasmidic epidemiology of colistin-resistance mediated by MCR genes in the poultry sector in lebanon.Front. Microbiol.12:624194. 10.3389/fmicb.2021.624194

  • 4

    AltschulS. F.GishW.MillerW.MyersE. W.LipmanD. J. (1990). Basic local alignment search tool.J. Mol. Biol.215403410. 10.1016/S0022-2836(05)80360-2

  • 5

    AmaroA.LeãoC.GuerraV.AlbuquerqueT.ClementeL. (2023). Plasmid-Mediated colistin resistance genes MCR-1 and MCR-4 in multidrug-resistant Escherichia coli strains isolated from a healthy pig in Portugal.Microb. Drug Resist.297884. 10.1089/mdr.2022.0228

  • 6

    BankevichA.NurkS.AntipovD.GurevichA. A.DvorkinM.KulikovA. S.et al (2012). SPAdes: A new genome assembly algorithm and its applications to single-cell sequencing.J. Comput. Biol.19455477. 10.1089/cmb.2012.0021

  • 7

    Bastidas-CaldesC.de WaardJ. H.SalgadoM. S.VillacísM. J.Coral-AlmeidaM.YamamotoY.et al (2022). Worldwide prevalence of MCR-mediated colistin-resistance Escherichia coli in isolates of clinical samples, healthy humans, and livestock—a systematic review and meta-analysis.Pathogens11:659. 10.3390/pathogens11060659

  • 8

    BertelliC.LairdM. R.WilliamsK. P.LauB. Y.HoadG.WinsorG. L.et al (2017). IslandViewer 4: Expanded prediction of genomic islands for larger-scale datasets.Nucleic Acids Res.45W30W35. 10.1093/nar/gkx343

  • 9

    BertelloniF.CagnoliG.TurchiB.EbaniV. V. (2022). Low level of colistin resistance and MCR genes presence in Salmonella spp.: Evaluation of isolates collected between 2000 and 2020 from animals and environment.Antibiotics11:272. 10.3390/antibiotics11020272

  • 10

    BolgerA. M.LohseM.UsadelB. (2014). Trimmomatic: A flexible trimmer for Illumina sequence data.Bioinformatics3021142120. 10.1093/bioinformatics/btu170

  • 11

    BorowiakM.FischerJ.HammerlJ. A.HendriksenR. S.SzaboI.MalornyB. (2017). Identification of a novel transposon-associated phosphoethanolamine transferase gene, MCR-5, conferring colistin resistance in d-tartrate fermenting Salmonella enterica subsp. enterica serovar Paratyphi B.J. Antimicrob. Chemother.7233173324. 10.1093/jac/dkx327

  • 12

    BourasG.HoutakG.WickR. R.MallawaarachchiV.RoachM. J.PapudeshiB.et al (2024). Hybracter: Enabling scalable, automated, complete and accurate bacterial genome assemblies.Microb. Genomics10:001244. 10.1099/mgen.0.001244

  • 13

    CahillN.HoobanB.FitzhenryK.JoyceA.O’ConnorL.MiliotisG.et al (2023). First reported detection of the mobile colistin resistance genes, MCR-8 and MCR-9, in the Irish environment.Sci. Total Environ.876:162649. 10.1016/j.scitotenv.2023.162649

  • 14

    Campos-MaduenoE. I.SigristT.FlückigerU. M.RischL.BodmerT.EndimianiA. (2021). First report of a blaVIM–1 metallo-β-lactamase-possessing Klebsiella michiganensis.J. Glob. Antimicrob. Resist.25310314. 10.1016/j.jgar.2021.03.027

  • 15

    CarattoliA.VillaL.FeudiC.CurcioL.OrsiniS.LuppiA.et al (2017). Novel plasmid-mediated colistin resistance MCR-4 gene in Salmonella and Escherichia coli, Italy 2013, Spain and Belgium, 2015 to 2016.Eurosurveillance22:30589. 10.2807/1560-7917.ES.2017.22.31.30589

  • 16

    CarrollL. M.GaballaA.GuldimannC.SullivanG.HendersonL. O.WiedmannM. (2019). Identification of novel mobilized colistin resistance gene MCR-9 in a multidrug-resistant, colistin-susceptible salmonella enterica serotype typhimurium isolate.mBio10:e00853-19. 10.1128/mBio.00853-19

  • 17

    DaiP.HuD. (2022). The making of hypervirulent Klebsiella pneumoniae.J. Clin. Lab. Anal.36:e24743. 10.1002/jcla.24743

  • 18

    De CosterW.RademakersR. (2023). NanoPack2: Population-scale evaluation of long-read sequencing data.Bioinformatics39:btad311. 10.1093/bioinformatics/btad311

  • 19

    DGS, DGAV, and APA (2019). Plano nacional de combate à resistência aos antimicrobianos 2019-2023 âmbito do conceito “Uma Só Saúde [National plan to combat antimicrobial resistance 2019-2023 within the scope of the “One Health” concept].Washington, DC: DGS. Portuguese

  • 20

    DongN.YangX.ChanE. W.-C.ZhangR.ChenS. (2022). Klebsiella species: Taxonomy, hypervirulence and multidrug resistance.eBioMedicine79:103998. 10.1016/j.ebiom.2022.103998

  • 21

    DraliR.BerrazegM.ZidouniL. L.HamitoucheF.AbbasA. A.DerietA.et al (2018). Emergence of MCR-1 plasmid-mediated colistin-resistant Escherichia coli isolates from seawater.Sci. Total Environ.6429094. 10.1016/j.scitotenv.2018.05.387

  • 22

    DurrantM. G.PerryN. T.PaiJ. J.JangidA. R.AthukoralageJ. S.HiraizumiM.et al (2024). Bridge RNAs direct programmable recombination of target and donor DNA.Nature630984993. 10.1038/s41586-024-07552-4

  • 23

    European Centre for Disease Prevention and Control (2015). Antimicrobial resistance surveillance in Europe 2014.Stockholm: European Centre for Disease Prevention and Control.

  • 24

    European Medicines Agency (2016). Updated advice on the use of colistin products in animals within the European Union: Development of resistance and possible impact on human and animal health.Amsterdam: European Medicines Agency.

  • 25

    FournierC.PalmieriM.KiefferN.NordmannP.PoirelL. (2021). MCR-like protein from Kosakonia sacchari, an environmental Enterobacterales.J. Glob. Antimicrob. Resist.25339340. 10.1016/j.jgar.2021.03.029

  • 26

    GaballaA.WiedmannM.CarrollL. M. (2023). More than MCR: Canonical plasmid- and transposon-encoded mobilized colistin resistance genes represent a subset of phosphoethanolamine transferases.Front. Cell. Infect. Microbiol.13:1060519. 10.3389/fcimb.2023.1060519

  • 27

    GeH.QiaoJ.XuH.LiuR.ChenR.LiC.et al (2022). First report of Klebsiella pneumoniae co-producing OXA-181, CTX-M-55, and MCR-8 isolated from the patient with bacteremia.Front. Microbiol.13:1020500. 10.3389/fmicb.2022.1020500

  • 28

    GeoffroyV. A.FetherstonJ. D.PerryR. D. (2000). Yersinia pestis YbtU and YbtT are involved in synthesis of the siderophore Yersiniabactin but have different effects on regulation.Infect. Immun.6844524461. 10.1128/IAI.68.8.4452-4461.2000

  • 29

    HadjadjL.BaronS. A.OlaitanA. O.MorandS.RolainJ.-M. (2019). Co-occurrence of variants of MCR-3 and MCR-8 genes in a Klebsiella pneumoniae isolate from laos.Front. Microbiol.10:2720. 10.3389/fmicb.2019.02720

  • 30

    HatrongjitR.WongsurawatT.JenjaroenpunP.ChopjittP.BoueroyP.AkedaY.et al (2024). Genomic analysis of carbapenem- and colistin-resistant Klebsiella pneumoniae complex harbouring MCR-8 and MCR-9 from individuals in Thailand.Sci. Rep.14:16836. 10.1038/s41598-024-67838-5

  • 31

    HiraizumiM.PerryN. T.DurrantM. G.SomaT.NagahataN.OkazakiS.et al (2024). Structural mechanism of bridge RNA-guided recombination.Nature6309941002. 10.1038/s41586-024-07570-2

  • 32

    HrenovicJ.Goic-BarisicI.KazazicS.KovacicA.GanjtoM.TonkicM. (2016). Carbapenem-resistant isolates of Acinetobacter baumannii in a municipal wastewater treatment plant. Croatia, 2014.Eurosurveillance212130. 10.2807/1560-7917.ES.2016.21.15.30195

  • 33

    IlyasM.PurkaitD.AtmakuriK. (2024). Genomic islands and their role in fitness traits of two key sepsis-causing bacterial pathogens.Brief. Funct. Genomics235568. 10.1093/bfgp/elac051

  • 34

    JainC.Rodriguez-RL. M.PhillippyA. M.KonstantinidisK. T.AluruS. (2018). High throughput ANI analysis of 90K prokaryotic genomes reveals clear species boundaries.Nat. Commun.9:5114. 10.1038/s41467-018-07641-9

  • 35

    JianZ.LiuY.WangZ.ZengL.YanQ.LiuW. (2024). A nosocomial outbreak of colistin and carbapenem-resistant hypervirulent Klebsiella pneumoniae in a large teaching hospital.Sci. Rep.14:27744. 10.1038/s41598-024-79030-w

  • 36

    JoshiA.MatangeN. (2024). Sequence variation in the active site of mobile colistin resistance proteins is evolutionarily accommodated through inter-domain interactions.Biochem. J.48117411755. 10.1042/BCJ20240373

  • 37

    KempfI.JouyE.ChauvinC. (2016). Colistin use and colistin resistance in bacteria from animals.Int. J. Antimicrob. Agents48598606. 10.1016/j.ijantimicag.2016.09.016

  • 38

    LeeJ.-Y.ChoiM.-J.ChoiH. J.KoK. S. (2016). Preservation of acquired colistin resistance in gram-negative bacteria.Antimicrob. Agents Chemother.60609612. 10.1128/AAC.01574-15

  • 39

    LegerA.LeonardiT. (2019). Pycoqc, interactive quality control for Oxford nanopore sequencing.J. Open Source Softw.4:1236. 10.21105/joss.01236

  • 40

    LetunicI.BorkP. (2021). Interactive Tree Of Life (iTOL) v5: An online tool for phylogenetic tree display and annotation.Nucleic Acids Res.49W293W296. 10.1093/nar/gkab301

  • 41

    LiS.JiangX.LiC.JuY.YueL.ChenF.et al (2022). A blaSIM–1 and MCR-9.2 harboring Klebsiella michiganensis strain reported and genomic characteristics of Klebsiella michiganensis.Front. Cell. Infect. Microbiol.12:973901. 10.3389/fcimb.2022.973901

  • 42

    LimaT.DominguesS.Da SilvaG. J. (2020). Manure as a potential hotspot for antibiotic resistance dissemination by horizontal gene transfer events.Vet. Sci.7:110. 10.3390/vetsci7030110

  • 43

    LimaT.FernandesL.MatiasM.MateusA.SilveiraE.DominguesS.et al (2022). Longitudinal study detects the Co-Carriage of ESBL and MCR-1 and -4 Genes in Escherichia coli strains in a Portuguese farrow-to-finish swine herd.Animals12:2209. 10.3390/ani12172209

  • 44

    LiuC.LiG.QinX.XuY.WangJ.WuG.et al (2022). Profiles of antibiotic- and heavy metal-related resistance genes in animal manure revealed using a metagenomic analysis.Ecotoxicol. Environ. Saf.239:113655. 10.1016/j.ecoenv.2022.113655

  • 45

    LiuJ.-H.LiuY.-Y.ShenY.-B.YangJ.WalshT. R.WangY.et al (2024). Plasmid-mediated colistin-resistance genes: MCR.Trends Microbiol.32365378. 10.1016/j.tim.2023.10.006

  • 46

    LiuY.-Y.WangY.WalshT. R.YiL.-X.ZhangR.SpencerJ.et al (2016). Emergence of plasmid-mediated colistin resistance mechanism MCR-1 in animals and human beings in China: A microbiological and molecular biological study.Lancet Infect. Dis.16161168. 10.1016/S1473-3099(15)00424-7

  • 47

    LongH.FengY.MaK.LiuL.McNallyA.ZongZ. (2019). The co-transfer of plasmid-borne colistin-resistant genes MCR-1 and mcr-3.5, the carbapenemase gene blaNDM–5 and the 16S methylase gene rmtB from Escherichia coli.Sci. Rep.9:696. 10.1038/s41598-018-37125-1

  • 48

    ManageiroV.Jones-DiasD.FerreiraE.CaniçaM. (2020). Plasmid-Mediated colistin resistance (mcr-1) in Escherichia coli from non-imported fresh vegetables for human consumption in Portugal.Microorganisms8:429. 10.3390/microorganisms8030429

  • 49

    ManageiroV.SalgueiroV.RosadoT.BandarraN. M.FerreiraE.SmithT.et al (2022). Genomic analysis of a MCR-9.1-Harbouring IncHI2-ST1 plasmid from Enterobacter ludwigii isolated in fish farming.Antibiotics11:1232. 10.3390/antibiotics11091232

  • 50

    Mark OsbornA.BöltnerD. (2002). When phage, plasmids, and transposons collide: Genomic islands, and conjugative- and mobilizable-transposons as a mosaic continuum.Plasmid48202212. 10.1016/S0147-619X(02)00117-8

  • 51

    MarutescuL. G.JagaM.PostolacheC.BarbuceanuF.MilitaN. M.RomascuL. M.et al (2022). Insights into the impact of manure on the environmental antibiotic residues and resistance pool.Front. Microbiol.13:965132. 10.3389/fmicb.2022.965132

  • 52

    MendesA. C.NovaisÂCamposJ.RodriguesC.SantosC.AntunesP.et al (2018). MCR-1 in carbapenemase-producing Klebsiella pneumoniae with hospitalized patients, Portugal, 2016–2017.Emerg. Infect. Dis.24762766. 10.3201/eid2404.171787

  • 53

    MmatliM.MbelleN. M.Osei SekyereJ. (2022). Global epidemiology, genetic environment, risk factors and therapeutic prospects of MCR genes: A current and emerging update.Front. Cell. Infect. Microbiol.12:941358. 10.3389/fcimb.2022.941358

  • 54

    MoX.ZhangH.FanJ.XuL.FuH.YueJ.et al (2024). Co-existence of two plasmids harboring transferable resistance-nodulation-division pump gene cluster, tmexCD1-toprJ1, and colistin resistance gene MCR-8 in Klebsiella pneumoniae.Ann. Clin. Microbiol. Antimicrob.23:67. 10.1186/s12941-024-00727-x

  • 55

    MoreS. J. (2020). European perspectives on efforts to reduce antimicrobial usage in food animal production.Ir. Vet. J.73:2. 10.1186/s13620-019-0154-4

  • 56

    MoritaD.TakahashiE.MoritaM.OhnishiM.MizunoT.MiyoshiS.et al (2020). Genomic characterization of antibiotic resistance-encoding genes in clinical isolates of Vibrio cholerae non-O1/non-O139 strains from Kolkata, India: Generation of novel types of genomic islands containing plural antibiotic resistance genes.Microbiol. Immunol.64435444. 10.1111/1348-0421.12790

  • 57

    PenwellW. F.ArivettB. A.ActisL. A. (2012). The Acinetobacter baumannii entA gene located outside the acinetobactin cluster is critical for siderophore production, iron acquisition and virulence.PLoS One7:e36493. 10.1371/journal.pone.0036493

  • 58

    PortesA. B.RodriguesG.LeitãoM. P.FerrariR.Conte JuniorC. A.PanzenhagenP. (2022). Global distribution of plasmid-mediated colistin resistance MCR gene in Salmonella : A systematic review.J. Appl. Microbiol.132872889. 10.1111/jam.15282

  • 59

    PrahI.NukuiY.YamaokaS.SaitoR. (2022). Emergence of a high-Risk Klebsiella michiganensis clone disseminating carbapenemase genes.Front. Microbiol.13:880248. 10.3389/fmicb.2022.880248

  • 60

    PrimN.TurbauM.RiveraA.Rodríguez-NavarroJ.CollP.MirelisB. (2017). Prevalence of colistin resistance in clinical isolates of Enterobacteriaceae: A four-year cross-sectional study.J. Infect.75493498. 10.1016/j.jinf.2017.09.008

  • 61

    RebeloA.MourãoJ.FreitasA. R.DuarteB.SilveiraE.Sanchez-ValenzuelaA.et al (2021). Diversity of metal and antibiotic resistance genes in Enterococcus spp. from the last century reflects multiple pollution and genetic exchange among phyla from overlapping ecosystems.Sci. Total Environ.787:147548. 10.1016/j.scitotenv.2021.147548

  • 62

    RhoumaM.BeaudryF.LetellierA. (2016). Resistance to colistin: What is the fate for this antibiotic in pig production?Int. J. Antimicrob. Agents48119126. 10.1016/j.ijantimicag.2016.04.008

  • 63

    RiquelmeM. P.MartinezR.BritoB.GarcíaP.LegarragaP.WozniakA. (2023). Chromosome-Mediated colistin resistance in clinical isolates of Klebsiella pneumoniae and Escherichia coli: Mutation analysis in the light of genetic background.Infect. Drug Resist.1664516462. 10.2147/IDR.S427398

  • 64

    SalloumT.PanossianB.BitarI.HrabakJ.ArajG. F.TokajianS. (2020). First report of plasmid-mediated colistin resistance mcr-8.1 gene from a clinical Klebsiella pneumoniae isolate from Lebanon.Antimicrob. Resist. Infect. Control9:94. 10.1186/s13756-020-00759-w

  • 65

    SchellerD.TwittenhoffC.BeckerF.HollerM.NarberhausF. (2021). OmpA, a common virulence factor, is under RNA thermometer control in Yersinia pseudotuberculosis.Front. Microbiol.12:687260. 10.3389/fmicb.2021.687260

  • 66

    SeiffertS. N.WüthrichD.GerthY.EgliA.KohlerP.NolteO. (2019). First clinical case of KPC-3–producing Klebsiella michiganensis in Europe.New Microbes New Infect.29:100516. 10.1016/j.nmni.2019.100516

  • 67

    ShahzadS.WillcoxM. D. P.RayamajheeB. (2023). A review of resistance to polymyxins and evolving mobile colistin resistance gene (mcr) among pathogens of clinical significance.Antibiotics12:1597. 10.3390/antibiotics12111597

  • 68

    SherryN. L.HoranK. A.BallardS. A.Gonçalves da SilvaA.GorrieC. L.SchultzM. B.et al (2023). An ISO-certified genomics workflow for identification and surveillance of antimicrobial resistance.Nat. Commun.14:60. 10.1038/s41467-022-35713-4

  • 69

    ShibuP.McCuaigF.McCartneyA. L.KujawskaM.HallL. J.HoylesL. (2021). Improved molecular characterization of the Klebsiella oxytoca complex reveals the prevalence of the kleboxymycin biosynthetic gene cluster.Microb. Genomics7:000592. 10.1099/mgen.0.000592

  • 70

    SilveiraL.Pista (2023). First report of salmonella serovar typhimurium and monophasic typhimurium clinical isolates harboring MCR-9 in Portugal.Acta Med. Port36609610. 10.20344/amp.20111

  • 71

    SimãoF. A.WaterhouseR. M.IoannidisP.KriventsevaE. V.ZdobnovE. M. (2015). BUSCO: Assessing genome assembly and annotation completeness with single-copy orthologs.Bioinformatics3132103212. 10.1093/bioinformatics/btv351

  • 72

    SimoniS.LeoniF.VeschettiL.MalerbaG.CarelliM.LleòM. M.et al (2023). The emerging nosocomial pathogen Klebsiella michiganensis: Genetic analysis of a KPC-3 producing strain isolated from venus clam.Microbiol. Spectr.11:e0423522. 10.1128/spectrum.04235-22

  • 73

    SnesrudE.MaybankR.KwakY. I.JonesA. R.HinkleM. K.McGannP. (2018). Chromosomally encoded MCR-5 in colistin-nonsusceptible Pseudomonas aeruginosa.Antimicrob. Agents Chemother.62:e00679-18. 10.1128/AAC.00679-18

  • 74

    SunS.GaoH.LiuY.JinL.WangR.WangX.et al (2020). Co-existence of a novel plasmid-mediated efflux pump with colistin resistance gene MCR in one plasmid confers transferable multidrug resistance in Klebsiella pneumoniae.Emerg. Microbes Infect.911021113. 10.1080/22221751.2020.1768805

  • 75

    SuzukiS.HorinouchiT.FurusawaC. (2014). Prediction of antibiotic resistance by gene expression profiles.Nat. Commun.5:5792. 10.1038/ncomms6792

  • 76

    TatusovaT.DiCuccioM.BadretdinA.ChetverninV.NawrockiE. P.ZaslavskyL.et al (2016). NCBI prokaryotic genome annotation pipeline.Nucleic Acids Res.4466146624. 10.1093/nar/gkw569

  • 77

    TeixeiraP.RamosM.RivièreR.AzevedoM.FerreiraM.CanoM. M.et al (2025). Genomic epidemiology and resistome dynamics of Enterobacter species in a portuguese open air laboratory: The emergence of the FRI-8 carbapenemase.Front. Microbiol.16:1593872. 10.3389/fmicb.2025.1593872

  • 78

    TorresR. T.CunhaM. V.AraujoD.FerreiraH.FonsecaC.PalmeiraJ. D. (2021). Emergence of colistin resistance genes (MCR-1) in Escherichia coli among widely distributed wild ungulates.Environ. Pollut.291:118136. 10.1016/j.envpol.2021.118136

  • 79

    WalshT. R.WuY. (2016). China bans colistin as a feed additive for animals.Lancet Infect. Dis.1611021103. 10.1016/S1473-3099(16)30329-2

  • 80

    WangC.FengY.LiuL.WeiL.KangM.ZongZ. (2020). Identification of novel mobile colistin resistance gene MCR-10.Emerg. Microbes Infect.9508516. 10.1080/22221751.2020.1732231

  • 81

    WangX.WangY.ZhouY.LiJ.YinW.WangS.et al (2018). Emergence of a novel mobile colistin resistance gene, MCR-8, in NDM-producing Klebsiella pneumoniae.Emerg. Microbes Infect.7:122. 10.1038/s41426-018-0124-z

  • 82

    WangX.WangY.ZhouY.WangZ.WangY.ZhangS.et al (2019). Emergence of colistin resistance gene MCR-8 and its variant in Raoultella ornithinolytica.Front. Microbiol.10:228. 10.3389/fmicb.2019.00228

  • 83

    WangY.DaganT. (2024). The evolution of antibiotic resistance islands occurs within the framework of plasmid lineages.Nat. Commun.15:4555. 10.1038/s41467-024-48352-8

  • 84

    WaterhouseA. M.ProcterJ. B.MartinD. M. A.ClampM.BartonG. J. (2009). Jalview Version 2—a multiple sequence alignment editor and analysis workbench.Bioinformatics2511891191. 10.1093/bioinformatics/btp033

  • 85

    World Health Organization (2018). Critically important antimicrobials for human medicine: 6th revision 2018 ranking of medically important antimicrobials for risk management of antimicrobial resistance due to non-human use.Geneva: World Health Organization.

  • 86

    XavierB. B.LammensC.RuhalR.Malhotra-KumarS.ButayeP.GoossensH.et al (2016). Identification of a novel plasmid-mediated colistin resistance gene, mcr-2, in Escherichia coli, Belgium, june 2016.Eurosurveillance21:07. 10.2807/1560-7917.ES.2016.21.27.30280

  • 87

    XuP.ZhangD.ZhuoW.ZhouL.DuY.ZhangP.et al (2024). Characterization of a highly virulent Klebsiella michiganensis strain isolated from a preterm infant with sepsis.Infect. Drug Resist.1749734983. 10.2147/IDR.S481750

  • 88

    YangJ.LongH.HuY.FengY.McNallyA.ZongZ. (2022). Klebsiella oxytoca complex: Update on taxonomy, antimicrobial resistance, and virulence.Clin. Microbiol. Rev.35e0000621. 10.1128/CMR.00006-21

  • 89

    YangX.LiuL.WangZ.BaiL.LiR. (2019). Emergence of MCR-8.2-bearing Klebsiella quasipneumoniae of animal origin.J. Antimicrob. Chemother.7428142817. 10.1093/jac/dkz213

  • 90

    YangY. Q.LiY. X.LeiC. W.ZhangA. Y.WangH. N. (2018). Novel plasmid-mediated colistin resistance gene MCR-7.1 in Klebsiella pneumoniae.J. Antimicrob. Chemother.7317911795. 10.1093/jac/dky111

  • 91

    YinW.LiH.ShenY.LiuZ.WangS.ShenZ.et al (2017). Novel plasmid-mediated colistin resistance gene MCR-3 in Escherichia coli.mBio8:e00543-17. 10.1128/mBio.00543-17

  • 92

    ZelendovaM.PapagiannitsisC. C.SismovaP.MedveckyM.PomorskaK.PalkovicovaJ.et al (2023). Plasmid-mediated colistin resistance among human clinical Enterobacterales isolates: National surveillance in the Czech Republic.Front. Microbiol.14:1147846. 10.3389/fmicb.2023.1147846

  • 93

    ZhangH.MiaoM.YanJ.WangM.TangY.-W.KreiswirthB. N.et al (2017). Expression characteristics of the plasmid-borne MCR-1 colistin resistance gene.Oncotarget8107596107602. 10.18632/oncotarget.22538

  • 94

    ZhangN.LiuX.QiL.ChenJ.QinS.JinM.et al (2023). A clinical KPC-producing Klebsiella michiganensis strain carrying IncFII/IncFIA (HI1)/IncFIB (K) multiple replicon plasmid.Front. Microbiol.13:1086296. 10.3389/fmicb.2022.1086296

  • 95

    ZhangX.-W.HuangX.-Y.ZhouZ.-Y.LiB.-L.LuJ.-H.SongJ.-J.et al (2025). Genetic framework and evolutionary dynamics of MCR-positive Klebsiella pneumoniae from 2000 to 2023.Int. J. Antimicrob. Agents66:107533. 10.1016/j.ijantimicag.2025.107533

  • 96

    ZhengJ.ZhouZ.WeiY.ChenT.FengW.ChenH. (2018). High-throughput profiling of seasonal variations of antibiotic resistance gene transport in a peri-urban river.Environ. Int.1148794. 10.1016/j.envint.2018.02.039

  • 97

    ZhouY.AiW.CaoY.GuoY.WuX.WangB.et al (2022). The Co-occurrence of NDM-5, MCR-1, and FosA3-Encoding plasmids contributed to the generation of extensively drug-resistant Klebsiella pneumoniae.Front. Microbiol.12:811263. 10.3389/fmicb.2021.811263

Summary

Keywords

Klebsiella michiganensis, mcr-8.6, manure, colistin resistance, mobile genetic elements, genomic island, chromosome-encoded resistance, Portugal

Citation

Rivière R, Teixeira P, Silva C, Ramos M, Dias E, Manageiro V and Caniça M (2025) Unraveling the genome-wide repertoire of the novel chromosomally encoded mcr-8.6 gene variant in Klebsiella michiganensis isolated from manure. Front. Microbiol. 16:1673320. doi: 10.3389/fmicb.2025.1673320

Received

28 July 2025

Accepted

22 September 2025

Published

03 December 2025

Volume

16 - 2025

Edited by

Elisabeth Grohmann, Berlin Technical University of Applied Sciences, Germany

Reviewed by

Leonardo Gabriel Panunzi, CEA Saclay, France

Tsolaire Sourenian, Charles University, Czechia

Updates

Copyright

*Correspondence: Manuela Caniça,

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics