Abstract
The goal of the study was to test the effects of an antibiotic substitute, plectasin, on the growth performance, immune function, intestinal morphology and structure, intestinal microflora, ileal mucosal layer construction and tight junctions, ileal immune-related cytokines, and blood biochemical indices of yellow-feathered chickens. A total of 1,500 one-day-old yellow-feathered chicks were randomly divided into four dietary treatment groups with five replicates in each group and 75 yellow-feathered chicks in each replication, as follows: basal diet (group A); basal diet supplemented with 10 mg enramycin/kg of diet (group B), basal diet supplemented with 100 mg plectasin/kg of diet (group C), and basal diet supplemented with 200 mg plectasin/kg of diet (group D). It was found that the dietary antimicrobial peptide plectasin could improve the ADG and had better F/G for the overall period of 1–63 days. Dietary plectasin can enhance H9N2 avian influenza virus (AIV) and Newcastle disease virus (NDV) antibody levels of yellow-feathered chickens at 21, and 35 days of age. Dietary plectasin can enhance the intestine structure, inhibit Escherichia coli and proinflammatory cytokines in the ileum, and ameliorate the blood biochemical indices of yellow-feathered chickens at 21 days of age. This study indicates that the antimicrobial peptide plectasin has beneficial effects on the growth performance, intestinal health and immune function of yellow-feathered chickens.
Introduction
Antibiotics have been used by the poultry industry to enhance the health and productivity of flocks and treat diseases (1, 2). However, the long-term use of antibiotics will induce pathogens to produce resistance genes and reduce the bactericidal effect of antibiotics on the pathogens (3, 4). Due to the large amounts of antibiotics remaining in the bodies of livestock and poultry, they will eventually enter the human body through meat, eggs, milk, and other livestock and poultry products (5). Over time, antibiotics will accumulate in the human body, causing various organ diseases and immunosuppression (6). Furthermore, the wide use of antibiotics as a therapeutic measure frequently causes disturbances in the human gut microbiota (7). The use of antimicrobials is strictly regulated by the Food and Drug Administration (FDA) and the USDA to warrant their safety and efficacy (2). The limitations of antibiotics have led to reductions in animal performance and feed conversion and a rise in the incidence of certain animal diseases; thus, there is an urgent need to explore alternatives to antibiotics (8).
Antimicrobial peptides (AMPs) are small molecules (12–15 amino acids) containing positive charges and amphipathic structures, which have broad-spectrum antibacterial, fungal, and protozoan activity as well as a certain level of virus activity (9). Due to the broad spectrum of antimicrobial activity and low propensity for the development of bacterial resistance, AMPs have also been regarded as important alternatives to antibiotics (10). AMPs have been reported that have beneficial effects on growth performance, intestinal microflora and morphology, immunity function and nutrient digestibility in chickens (11, 12). AMPs are innate and specific immune molecules that regulate pro-inflammatory and anti-inflammatory reactions and chemotactic activity and improve specific immunity (13). According to the final effect of an AMP on target cells, its mechanism can be divided into two types: the first is membrane decomposing peptides that cause cell death by changing the permeability of cell membranes (14) and the second is a non-membrane active peptide that affects intracellular targets and interferes with cell metabolism to show its bactericidal activity (15). It has been reported that dietary AMPs can improve the intestinal tissue structure and promote growth (16–19).
Defensins are cationic antibacterial active peptides that are found in antibacterial peptides, which are widely present in animals and plants (20, 21). Plectasin was the first fungal defensin to be isolated from the saprophytic ascomycete Pseudoplectania nigrella (22). Plectasin contains 40 amino acids (GFGCN GPWNE DDLRC HNHCK SIKGY KGGYC AKGGF VCKCY) that has a molecular weight of about 4.4 ku, and has demonstrated activity against bacteria, such as gram-negative and gram-positive, in particular various strains resistant to conventional antibiotics (22, 23). Plectasin contains α-β motif that is comprised of an α-helix and two antiparallel β-strands, and is stabilized by three disulphide bonds (Cys4-Cys30, Cys15-Cys37 and Cys19-Cys39) (22). Cysteine-rich peptide is a broad-spectrum antimicrobial agent, the unique reactivity of the cysteine side chain makes it possible to carry out a variety of useful chemical reactions to regulate innate immune systems in different life forms such as bacteria, protozoa, fungi, plants, insects and animals (24, 25). The range of Minimum Inhibitory Concentration (MIC) of plectasin was between 0.007 mg/ml to 1.8 mg/ml (26). Plectasin was confirmed to promote the proliferation of beneficial intestinal bacteria and have no cytotoxicity to normal human bronchial epithelial cell, A549 cells or lung fibroblasts, and did not induce IL-8 transcription or production in A549 cells (27). In 2010, it was reported that plectasin acts antibacterially by targeting the bacterial cell wall precursor lipid II (28). In 2015, plectasin was the first-reported animal toxin-like fungal defensin with the ability to block potassium channels through recognizing the channel pore region (29). In 2017, Li et al. (30) reported the research advances on plectasin and its derivatives as new potential antimicrobial candidates. One report showed that dietary plectasin have beneficial effects on broilers (Arbor Acres, white-feathered chickens) (23), however, there has been no report on the effect of the antimicrobial peptide plectasin on yellow-feathered chickens. Hence, this study aims to investigate the effects of dietary plectasin on the growth performance, intestinal health, and immune function of yellow-feathered chickens. The significance of this study is that it explores the mechanism by which plectasin can act as a feed additive for yellow-feathered chickens and provides a certain theoretical basis for the replacement of antibiotics by plectasin.
Materials and Methods
Animals, Plectasin, and Experimental Design
Fifteen hundred healthy 1-day-old yellow-feathered chicks with similar body weights were purchased from Guangdong Wen's Food Group Co., Ltd., China. The plectasin (amino acid sequence: GFGCNGPWNEDDLRCHNHCKSIKGYKGGYCAKGGFVCKCY; NCBI accession number: PDB: 6K50_A) used in this study was purchased from Guangdong Hinabiotech Co., Ltd. (Guangzhou, China). The method for producing the plectasin was as follows according to previous reported study with some modifications (31): The mycelium gene from saprophytic ascomycetes was cloned into vector pPICZ αA to construct a recombinant plasmid. The recombinant plasmid was transferred into Pichia pastoris by electroporation. The positive transformants were cultured in 10 mL yeast extract peptone glucose (YPD) medium containing 100 μg/mL bleomycin at 30°C and 250 r/min for 24 h. After that, the positive transformants were centrifuged at 4°C and 4,000 r/min for 5 min. The supernatant was discarded and the bacteria were re-suspended with 1 L YPD culture medium. Finally, recombinant mycelium was prepared by high-density fermentation in a 2 T fermentor containing basic salt medium (BSM), in which the dissolved oxygen was kept above 30%. The original carbon source in the culture medium was consumed, and then the expression was induced by methanol at 37°C for 72 hours, the concentration of total protein in the supernatant was 4 g/L. The yeast cells were removed by centrifugation, the supernatant of the fermentation broth was concentrated, and then purified by ion exchange chromatography, finally, the recombinant plectasin was obtained.
A single-factor, randomized trial design was used in this study. The 1,500 one-day-old yellow-feathered chicks were randomly divided into four treatment groups with five replicates in each group and 75 yellow-feathered chicks in each replication. All of the chickens were reard in an over pressure isolator and the temperature of the isolator was maintained 32°C during the first week, and the it was reduced 2°C each week until reaching at 22°C in week 4, and then the temperature was lasted to the end of the experiment. The light was programmed as continuous for 24 h for the first 2 days, while chickens were exposed to 23 h of white light a day and 1 h a dark after 2 days. Plastic drinkers and feeders were used for supplying water and feed. All of chickens in different treatment groups were free to feed intake and water every day. The overall trial period was 63 days. The groupings are shown in Table 1. The basal diet was feed based on corn-soybean, manufactured by Guangdong Wen's Food Group Co., Ltd., designed based on the “NY/T33-2004 feeding standard of chicken” and the recommend nutrition standard for yellow-feathered chickens. Table 2 shows the composition and nutritional information for the basal diet.
Table 1
| Group | Treatment | Quantity |
|---|---|---|
| A | Basal diet | 375 |
| B | Basal diet + 10 mg enramycin/kg diet | 375 |
| C | Basal diet + 100 mg plectasin/kg diet | 375 |
| D | Basal diet + 200 mg plectasin /kg diet | 375 |
The grouping of experiment.
Table 2
| Raw material (kg) | Day 1–21 | Day 22–42 | Day 43–63 | Nutrition levelb | Day 1–21 | Day 22–42 | Day 43–63 |
|---|---|---|---|---|---|---|---|
| Corn | 61.643 | 64.864 | 68.067 | Metabolic energy/ (MJ/kg) | 12.13 | 12.76 | 13.18 |
| Soybean | 30.250 | 26.554 | 21.731 | Crude protein (%) | 20.50 | 18.50 | 17.00 |
| Corn protein powder | 3.000 | 1.507 | 2.437 | Crude fat (%) | 3.66 | 5.71 | 6.78 |
| Soybean oil | 1.050 | 3.120 | 4.090 | Crude fiber (%) | 2.23 | 2.12 | 1.98 |
| Calcium hydrophosphate | 1.280 | 1.070 | 0.920 | Ca (%) | 0.90 | 0.85 | 0.80 |
| Limestone | 1.290 | 1.300 | 1.300 | Total P (%) | 0.58 | 0.53 | 0.48 |
| Salt | 0.340 | 0.350 | 0.350 | Available p (%) | 0.35 | 0.31 | 0.28 |
| Mold inhibitor | 0.100 | 0.100 | 0.100 | Lys (%) | 1.21 | 1.10 | 0.97 |
| Choline chloride | 0.080 | 0.080 | 0.080 | Digestible Lys (%) | 1.10 | 1.00 | 0.88 |
| Premixa | 0.400 | 0.400 | 0.400 | Digestible Met + Digestible Cys (%) | 0.75 | 0.78 | 0.65 |
| Lys | 0.342 | 0.317 | 0.308 | ||||
| DL-Met | 0.170 | 0.267 | 0.163 | ||||
| Thr | 0.55 | 0.070 | 0.054 | ||||
| Total | 100.00 | 100.00 | 100.00 |
The composition and nutrition level of basal diet (air-dry basis).
The premix provided the following per kg of diets: Cu 11 mg, Fe 149 mg, Mn 32 mg, Zn 35 mg, I 0.50 mg, Se 0.35 mg, VA 15 000 IU, VD 33 000 IU, VE 46 mg, VB1 7 mg, VB2 11 mg, VB6 14 mg, VB12 30 ug, niacin 83 mg, D- Pantothenic acid 32 mg, folic acid 2 mg, biotin 190 ug.
The value of metabolizable energy is calculated, other items are tested.
Production Performance
The weight of each yellow-feathered chick and the feed consumption of each treatment group were recorded daily. The average daily feed intake (ADFI), average daily gain (ADG), feed to gain ratio (F/G). and the survival rate of chickens at 1–21, 22–42, 43–63 and 1–63 days of age were evaluated.
Determination of Antibody Titer
The yellow-feathered chickens were vaccinated with the commercial inactivated vaccines for H9N2 avian influenza virus (AIV) (cat. No. DL034, Beijing biolab technology co. LTD) and Newcastle disease virus (NDV) (cat. no. DL032, Beijing biolab technology co. LTD) via spray immunization at 1-day-old, and then they were revaccinated with the same vaccine via subcutaneous neck injection at 10 days of age. There were 25 birds in each treatment group with five chickens were randomly selected from each replicate (total five replicates) at 7, 21, 35, and 42 days old. Five milliliters of blood was transferred into the centrifuge tube by a 10 mL syringe, left to stand for 30 min at room temperature, and centrifuged for 10 min at 3,000 rpm. Then, the supernatant was collected to detect the antibody levels of H9N2 AIV and NDV by HI assay as described previously (32, 33).
Observation and Measurement of Intestinal Morphology
Chickens at 21 days of age were selected for testing the intestinal morphology (34). There were 25 birds in each treatment group with five chickens were randomly selected from each replicate (total five replicates) for euthanasia by cervical dislocation at 21 days of age, and 1 cm gut tissue samples from the duodenum, jejunum, and ileum were taken, the gut cavity was carefully washed with PBS (phosphate buffer saline) buffer, and samples were put into 5 mL centrifuge tubes with 10% formalin solution to fix samples. The hematoxylin-eosin staining and paraffin section making were conducted by using the fixed samples. The villus lengths and crypt depths of ten intact villi were measured, and calculated the average values of each tissue.
Detection of Immune-Related Cytokines, Mucosal Layer Structure, and Tight-Junction-Related Factors of Ileum Using Quantitative Real-Time PCR (qRT-PCR)
Chickens at 21 days of age were selected for testing the immune-related cytokines, the ileum mucosal layer structure, and tight-junction-related factors (35, 36). There were 25 birds in each treatment group with five chickens were randomly selected from each replicate (total five replicates) for euthanasia by cervical dislocation at 21 days of age. A small piece of the ileum was cut off in an aseptic environment and put into a 2 mL EP tube containing 1 mL TRIzol (Invitrogen, Carlsbad, CA, USA). Total RNA was extracted from the samples with TRIzol and a NanoDrop-2000 spectrophotometer (ThermoFisher Scientific Co., Waltham, MA, USA) with the 260/280 nm absorbance ratio was used to measure the purity and concentration of the total RNA. The RecerTra Ace qPCR RT Master Mix with gDNA remover (TOYOBO Co., LTD. Life Science Department, OSAKA, Japan) was used for reverse transcription of cDNA with 1.0 μg RNA of each sample. Quantitative Real-time PCR (qRT-PCR) was performed in triple with the following reaction system: nuclease free water (1.5 μL), 1 μL of each forward and reverse primer of each gene (5 μM), 1.5 μL of cDNA (1:20 dilution), and the SYBR® Premix Ex TaqTM II kit (ThermoFisher Scientific Co., Waltham, MA, USA) was 5 μL, the reaction performed on an CFX96 Touch™ real-time PCR detection system (Bio-Rad Laboratories, Mississauga, ON, Canada). The specific primers used for the mucosal layer structure and the tight-junction-related factors and inflammation-related cytokines of ileum were designed using Primer Express 3.0 (Applied Biosystems) in accordance with the sequences published in GenBank for qRT-PCR and are shown in Table 3. The PCR condition was this: initial denaturation (95°C for 3 min), followed by 40 cycles (95°C for 5 s and at 60°C for 30 s). Each sample was analyzed in triplicate. The specificity of the PCR products was evaluated by melting curve analysis. The internal reference gene was GAPDH. The 2−ΔΔCt method was used to calculate the relative expression of each gene (37).
Table 3
| Gene names | Primers | Accession No. |
|---|---|---|
| ZO-1 | F: GCACAAGGAGGTCAGCCAGATG | Accession: XM_015278981.2 |
| R: ATCATTGCCACCAGCGAGCC | ||
| Claudin-3 | F: CTTCATCGGCAACAACATC | Accession: NM_204202.1 |
| R: CATGGAGTCGTACACCTTG | ||
| TFF2 | F: CCAGGAATCTCAGCAGCAGACT | Accession: XM_416743.4 |
| R: AGCCACAGTTCACTCGGATACG | ||
| MUC2 | F: CGCAAGTCCTGGGCAGAGAAAG | Accession: NM_001318434.1 |
| R: GCAGCAACAGCAGAACAGAAGC | ||
| IFN-γ | F: GCCTCCACACCTTCCTCCAAGA | Accession: NM_205427.1 |
| R: GCGTGTTGCCTGTGAGGTTGT | ||
| IFN-α | F: CTGCCTCCACACCTTCCTCCAA | Accession: NM_205427.1 |
| R: GCGTGTTGCCTGTGAGGTTGT | ||
| IL-1β | F: AGCAGCAGCCTCAGCGAAGA | Accession: XM_015297469.1 |
| R: CCAGCCCTCCCATCCTTACCTT | ||
| IL-17A | F: AATCGGTCTCTCGCTCCTTGGA | Accession: XM_426223.6 |
| R: GGCACTCGGCATCAGCAATCA | ||
| IL-22 | F: AGGGAGAACAACCGCTGCTACA | Accession: NM_001199614.1 |
| R: GAGGTCAGGGATGCCAGGAACT | ||
| IL-6 | F: GTGTGCGAGAACAGCATGGAGA | Accession: NM_204628.1 |
| R: CTGGAGAGCTTCGTCAGGCATT | ||
| GAPDH | F: GCTGTGGAGAGATGGCAGAGGT | Accession: NM_204305.1 |
| R: ACGGCAGGTCAGGTCAACAACA |
Primers for qRT-PCR detection of ileum mucosal barrier related indices and inflammation-related cytokines.
Intestinal Flora Determination
Chickens at 21 days of age were selected for testing the intestinal flora (38). There were 25 birds in each treatment group with five chickens were randomly selected from each replicate (total 5 replicates) for euthanasia by cervical dislocation at 21 days of age. One hundred milligram ileum and cecum samples under sterilization were put into 2 mL sterilizing centrifuge tubes and stored at −80°C after pre-freezing in liquid nitrogen. Escherichia coli and Lactobacilli were detected in the ileum and cecum by the absolute quantitative PCR method. Gut microorganism DNA were extracted with the feces genome DNA Extracting Kit [DP328, Tiangen Biotech (Beijing) Co. Ltd.]. Primers (E. coli: F: 5′- GTATTGACCCGTCAGGTGTG−3′ R: 5′- GCTGGCCTGTTTGGTGATAA-3′; Lactobacilli: F: 5′- AGATGTTGGGTTAAGTCCCGC-3′ R: 5′- GTGCTGATCCGCGATTACTA-3′) were used to amplify the fragment inserts of E. coli (243 bp) and Lactobacilli (200 bp) by PCR. DNA standards were prepared from E. coli or Lactobacilli strains carrying plasmids with E. coli or Lactobacilli fragment inserts which were ligated into a PMD19-T vector (TaKaRa, Biotechnology, Dalian, China). The DNA concentration was calculated by measuring the absorbance at 260 nm. Using the DNA concentration, the copy number of the plasmid was calculated using the following formula: copy/μL = 6.02 × 1023(copy/mol) × DNA concentration (g/μL)/MW (g/mol). Serial 10 fold dilutions from 104 to 1010 copies of the purified plasmid were prepared in duplicate to produce a standard curve. The quantitative Real-time PCR (qRT-PCR) was used to evaluate the copy number of E. coli and Lactobacilli in ileum and cecum with following reaction system: DNA (1.0 μL), 10.0 μL of SYBR Green qPCR Mix (Roche Diagnostics, Shanghai, China), each primer was 0.5 μL, and 8 μL of H2O. Samples were amplified under the following conditions: 94°C for 2 min (initial denaturation), 40 cycles of 94°C for 10 s (heat denaturation), 60°C for 40 s (primer annealing). Fluorescence signal acquisition was set at 60°C. The primers for the amplification of E. coli by qRT-PCR were: 5′-GTTAATACCTTTGCTCATTGA-3′ and 5′-ACCAGGGTATCTTAATCCTGTT-3′. The primers for Lactobacilli amplification by qRT-PCR were as follows: 5′- CCCTTGTCATTAGTTGCCAGCATTAAG-3′ and 5′- CCTCCTCGTTGTACTGTCCATTGTAGC-3′.
Detection of Blood Biochemical Indices
Chickens at 21 days of age were selected for testing the blood biochemical indices (35). Venous blood was taken from 25 birds in each treatment group with five chickens were randomly selected from each replicate (total five replicates) at 21 days of age. The blood without anticoagulant treatment was put in a water bath at 37°C for 30 min. The serum was isolated after centrifugation at 3,000 r/min for 10 min. Serum biochemical indices were assessed in terms of triglycerides, blood glucose, high-density cholesterol, total cholesterol, albumin and total proteins by a Mindray BS-5800M automatic biochemical analyzer.
Statistical Analysis of the Data
SPSS 20.0 software was used for the one-way ANOVA analysis and Tukey's test was used for multiple comparisons. The experimental data are expressed as the mean ± standard error of the mean (SEM). P < 0.05 was considered significant.
Results
Effects of Plectasin on the Performance of Yellow-Feathered Chickens
The average daily feed intake (ADFI), average daily gain (ADG), feed to gain ratio (F/G) and survival rate of yellow-feathered chickens were determined by different treatments on days 1–21, 22–42, 43–63 and 1–63 among group A (control group), group B (10 mg enramycin/kg of diet), and group C (100 mg plectasin/kg of diet) and group D (200 mg plectasin/kg of diet). The results are shown in Table 4.
Table 4
| Stage | Index | Group A | Group B | Group C | Group D |
|---|---|---|---|---|---|
| 1–21 days | ADG/g | 17.05 ± 0.26c | 21.22 ± 0.30ab | 20.44 ± 0.18b | 21.45 ± 0.22a |
| ADFI/g | 30.11 ± 0.38a | 29.36 ± 0.43ab | 29.03 ± 0.31b | 28.94 ± 0.41b | |
| F/G | 1.77 ± 0.009a | 1.40 ± 0.007c | 1.44 ± 0.005b | 1.35 ± 0.004c | |
| Survival rate (%) | 96.80 | 98.67 | 98.40 | 98.93 | |
| 22–42 days | ADG/g | 30.71 ± 0.52b | 38.72 ± 0.68a | 37.55 ± 0.73a | 37.98 ± 0.66a |
| ADFI/g | 76.69 ± 0.58 | 75.84 ± 1.01 | 75.91 ± 1.17 | 75.58 ± 1.17 | |
| F/G | 2.50 ± 0.030a | 1.96 ± 0.028c | 2.02 ± 0.024b | 1.99 ± 0.021b | |
| Survival rate (%) | 98.6 | 99.72 | 99.19 | 99.73 | |
| 43–63 days | ADG/g | 37.00 ± 1.31d | 39.60 ± 0.96c | 41.75 ± 0.63b | 43.69 ± 0.73a |
| ADFI/g | 115.59 ± 2.63a | 113.05 ± 1.45b | 112.52 ± 1.57b | 113.17 ± 1.9b | |
| F/G | 3.12 ± 0.05a | 2.86 ± 0.06b | 2.70 ± 0.03c | 2.59 ± 0.05d | |
| Survival rate (%) | 98.04 | 98.37 | 98.36 | 99.19 | |
| 1–63 days | ADG/g | 27.78 ± 0.62c | 30.22 ± 0.33b | 32.25 ± 0.47a | 32.62 ± 0.60a |
| ADFI/g | 74.38 ± 1.21a | 71.32 ± 0.29ab | 70.90 ± 0.83b | 70.17 ± 1.37b | |
| F/G | 2.68 ± 0.02a | 2.36 ± 0.02b | 2.20 ± 0.02c | 2.15 ± 0.02c | |
| Survival rate (%) | 93.60 | 96.80 | 96.00 | 97.87 |
The growth performance of yellow-feathered chickens in different treatment groups.
In the same row, values with different letter superscripts mean significant difference (P < 0.05), while with the same or no letter superscripts mean no significant difference (P > 0.05). Group A represents the basal diet; Group B represents basal diet supplemented with 10 mg enramycin/kg; Group C represents basal diet supplemented with 100 mg plectasin/kg; Group D represents basal diet supplemented with 200 mg plectasin/kg.
As shown in Table 4, on days 1–21, the ADG of group D was significantly higher than those in group A and group C (P < 0.05), the ADFI in group D and group C was significantly lower than that in group A (P < 0.05), the F/G in group D and group C was significantly lower than that in group A (P < 0.05). Additionally, the ADG of group D was significantly higher than that in group C (P < 0.05), while the F/G of group D was significantly lower than that in group C (P < 0.05), indicating that administration of 200 mg plectasin/kg of diet is better than 100 mg plectasin/kg of diet. On days 22–42, the ADG of groups B, C, and D was significantly higher than that in group A (P < 0.05), while the F/G of groups B, C, and D was significantly lower than that in group A (P < 0.05). On days 43–63, the ADG of group D was significantly higher than that in groups A, B, and C (P < 0.05) and the ADFI in groups B, C, and D was significantly lower than that in group A (P < 0.05). Furthermore, the F/G was significantly lower in groups C and D than in groups A and B (P < 0.05). For the overall 63-day period, the ADG was significantly higher in groups C and D than in groups A and B, while the ADFI was significantly lower in groups C and D than in group A (P < 0.05). Furthermore, the F/G was significantly lower in groups C and D than in group A (P < 0.05).
Effects of Plectasin on the Antibody Titer of the H9N2 Influenza Virus and Newcastle Disease Virus in Yellow-Feathered Chickens
Tables 5, 6 show the serum antibody levels of each stage of yellow-feathered chickens after immunization with the H9N2 AIV and NDV vaccines in group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet).
Table 5
| Group | A | B | C | D |
|---|---|---|---|---|
| 7 days of age | 9.81 ± 0.20 | 9.83 ± 0.49 | 9.85 ± 0.20 | 9.86 ± 0.40 |
| 21 days of age | 6.24 ± 0.20b | 6.26 ± 0.24b | 6.53 ± 0.24a | 6.59 ± 0.20a |
| 35 days of age | 7.29 ± 0.73b | 7.32 ± 0.58b | 8.02 ± 0.40ab | 8.75 ± 1.03a |
| 42 days of age | 9.41 ± 0.24c | 9.97 ± 0.37b | 10.18 ± 0.20b | 11.53 ± 0.24a |
Serum H9N2 AIV antibody levels of yellow-feathered chickens in different treatment groups.
In the same row, values with different letter superscripts mean significant difference (P < 0.05), while with the same or no letter superscripts mean no significant difference (P > 0.05). Group A represents the basal diet; Group B represents basal diet supplemented with 10 mg enramycin/kg; Group C represents basal diet supplemented with 100 mg plectasin/kg; Group D represents basal diet supplemented with 200 mg plectasin/kg.
Table 6
| Group | A | B | C | D |
|---|---|---|---|---|
| 7 days of age | 8.78 ± 0.20 | 8.84 ± 0.37 | 9.00 ± 0.32 | 9.10 ± 0.48 |
| 21 days of age | 6.40 ± 0.24c | 6.85 ± 0.29bc | 7.00 ± 0.55b | 7.61 ± 0.25a |
| 35 days of age | 7.60 ± 0.68b | 8.25 ± 0.75b | 8.40 ± 0.60b | 9.50 ± 0.29a |
| 42 days of age | 9.04 ± 0.32a | 9.48 ± 0.51a | 9.59 ± 0.65a | 9.74 ± 0.40a |
Serum NDV antibody levels of yellow-feathered chickens in different treatment groups.
In the same row, values with different letter superscripts mean significant difference (P < 0.05), while with the same or no letter superscripts mean no significant difference (P > 0.05). Group A represents the basal diet; Group B represents basal diet supplemented with 10 mg enramycin/kg; Group C represents basal diet supplemented with 100 mg plectasin/kg; Group D represents basal diet supplemented with 200 mg plectasin/kg.
As shown in Table 5, serum antibody levels of H9N2 AIV were significantly higher in group D than in groups A and B at 21 and 35 days of age (P < 0.05). Besides, the serum antibody level of H9N2 AIV was significantly higher in group D than in groups A, B, and C at 42 days of age (P < 0.05).
As shown in Table 6, the serum antibody level of NDV was significantly higher in group D than in groups A, B, and C at 21 and 35 days of age (P < 0.05). Additionally, the serum antibody level of NDV was significantly higher in group D than in group C at 21 and 35 days of age (P < 0.05).
Effects of Plectasin on the Intestinal Morphology and Structure in Yellow-Feathered Chickens
The villus lengths, crypt depths, and villus length/crypt depth ratio of the ileum, jejunum and duodenum of 21-day-old yellow-feathered chickens in group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet) are shown in Table 7.
Table 7
| Site | Index | Group A | Group B | Group C | Group D |
|---|---|---|---|---|---|
| Ileum | Villus length | 0.659 ± 0.007d | 0.713 ± 0.008b | 0.685 ± 0.004c | 0.740 ± 0.002a |
| Crypt depth | 0.152 ± 0.002a | 0.142 ± 0.002c | 0.147 ± 0.002b | 0.137 ± 0.001d | |
| Villus length/crypt depth | 4.337 ± 0.080d | 5.035 ± 0.060b | 4.825 ± 0.067c | 5.205 ± 0.075a | |
| Jejunum | Villus length | 0.953 ± 0.002c | 0.959 ± 0.003bc | 0.966 ± 0.006b | 0.981 ± 0.001a |
| Crypt depth | 0.165 ± 0.003a | 0.158 ± 0.001b | 0.156 ± 0.003b | 0.150 ± 0.002c | |
| Villus length/crypt depth | 5.778 ± 0.114c | 6.070 ± 0.049b | 6.194 ± 0.109b | 6.541 ± 0.083a | |
| Duodenum | Villus length | 1.134 ± 0.001c | 1.137 ± 0.002c | 1.168 ± 0.004b | 1.191 ± 0.001a |
| Crypt depth | 0.254 ± 0.003a | 0.244 ± 0.001b | 0.236 ± 0.001c | 0.227 ± 0.002d | |
| Villus length/crypt depth | 4.465 ± 0.051d | 4.660 ± 0.020c | 4.949 ± 0.018b | 5.247 ± 0.061a |
Villus length, crypt depth and villus length/crypt depth of 21-day-old yellow -feathered chickens in different treatment groups.
Unit: mm.
In the same row, values with different letter superscripts mean significant difference (P < 0.05), while with the same or no letter superscripts mean no significant difference (P > 0.05). Group A represents the basal diet; Group B represents basal diet supplemented with 10 mg enramycin/kg; Group C represents basal diet supplemented with 100 mg plectasin/kg; Group D represents basal diet supplemented with 200 mg plectasin/kg.
As shown in Table 7, the villus lengths of the ileum, jejunum, and duodenum were significantly greater in group D than in groups A, B, and C (P < 0.05); the crypt depths of the ileum, jejunum and duodenum were significantly lower in group D than in groups A, B, and C (P < 0.05), and the villus length/crypt depth of the ileum, jejunum, and duodenum was significantly greater in group D than in groups A, B, and C (P < 0.05). Tissue sections of the ileum, jejunum, and duodenum are shown in Figures 1–3, respectively.
Figure 1
Figure 2
Figure 3
Effects of Plectasin on the Intestinal Microflora in Yellow-Feathered Chickens
The effects of plectasin on the intestinal microflora of 21-day-old yellow-feathered chickens from group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet) are shown in Figure 4.
Figure 4
As can be seen from Figure 4A, compared with the group A, the content of E. coli in the ileums of chickens from groups B, C, and D significantly decreased (P < 0.05). In addition, the content of E. coli in the ceca of chickens in groups B, C, and D was not significantly changed compared with that of group A (P > 0.05) (Figure 4B). As shown in Figures 4C,D, there was no significantly change in the Lactobacilli concentration in the ileums and ceca of chickens in groups A, B, C, and D (P > 0.05). As shown in Figure 4E, in the ileum, the ratio between Lactobacilli and E. coli was significantly higher in groups C and D than in groups A and B (P < 0.05), while the ratio between Lactobacilli and E. coli was significantly higher in the ceca of chickens in group B than in groups A, C, and D (Figure 4F). The above results show that dietary plectasin can cause intestinal flora changes in yellow-feathered chickens through reducing the concentration of E. coli in the ileum while increasing the ratio of between Lactobacilli and E. coli in the ileum.
Effects of Plectasin on Mucosal Layer Construction and Tight Junctions of Ileum of Yellow-Feathered Chickens
The effects of plectasin on the mucosal layer construction and tight junctions of ileum of 21-day-old yellow-feathered chickens from group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet) are shown in Figure 5.
Figure 5
As shown in Figure 5A, at 21 days of age, the mRNA expression of TFF2 was significantly higher in group D than in other groups (P < 0.05). As shown in Figure 5B, the mRNA expression of MUC2 was significantly higher in groups A, C, and D than in group B (P < 0.05). As shown in Figure 5C, the mRNA expression of ZO-1 in groups C and D was significantly higher than in groups A and B (P < 0.05). As shown in Figure 5D, the mRNA expression of Claudin-3 was significantly higher in group D than in group A (P < 0.05).
Effects of Plectasin on Ileal Immune Factors in Yellow-Feathered Chickens
The effects of plectasin on the ileal immune factors IL-17A, IL-22, IFN-α, IFN-γ, IL-1β, and IL-6 in 21-day-old yellow-feathered chickens from group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet) are shown in Figure 6.
Figure 6
As shown in Figure 6A, IL-17A expression in the ileum was significantly decreased in groups B, C, and D compared with group A (P < 0.05). As shown in Figure 6B, the expression of IL-22 in the ileum was significantly decreased in groups B, C, and D compared with group A (P < 0.05). As shown in Figure 6C, IFN-α expression in the ileum was significantly decreased in groups B, C, and D compared with group A (P < 0.05). Additionally, IFN-α expression in the ileum was significantly lower in group D than in group B (P < 0.05). As shown in Figure 6D, IFN-γ expression in the ileum was significantly decreased in groups B, C, and D compared with group A (P < 0.05). As shown in Figure 6E, IL-1β expression in the ileum was significantly lower in groups B, C, and D compared with group A (P < 0.05). Furthermore, IL-1β expression in the ileum was significantly lower in group D than in group B (P < 0.05). As shown in Figure 6F, IL-6 expression in the ileum was significantly lower in groups B, C, and D than in group A (P < 0.05). Moreover, IL-6 expression in the ileum was significantly lower in group D than in group B (P < 0.05).
Effects of Plectasin on Blood Biochemical Indices in Yellow-Feathered Chickens
The effects of plectasin on blood biochemical indices in 21-day-old yellow-feathered chickens in chickens from group A (control group), group B (10 mg enramycin/kg of diet), group C (100 mg plectasin/kg of diet), and group D (200 mg plectasin/kg of diet) are shown in Table 8.
Table 8
| Group A | Group B | Group C | Group D | |
|---|---|---|---|---|
| Glucose (mmol/L) | 14.891 ± 0.03c | 14.987 ± 0.07c | 15.523 ± 0.08b | 16.093 ± 0.05a |
| Triglyceride (g/L) | 2.724 ± 0.04b | 2.960 ± 0.02a | 2.877 ± 0.05a | 2.983 ± 0.02a |
| Total cholesterol (g/L) | 18.070 ± 0.03c | 18.641 ± 0.04b | 18.653 ± 0.01b | 19.032 ± 0.04a |
| High-densitycholesterol (g/L) | 3.696 ± 0.01 | 3.787 ± 0.03 | 3.772 ± 0.06 | 3.833 ± 0.04 |
| Total proteins (g/L) | 20.523 ± 0.04b | 20.403 ± 0.02b | 20.444 ± 0.05b | 20.982 ± 0.04a |
| Albumin (g/L) | 11.687 ± 0.04b | 12.093 ± 0.06a | 11.687 ± 0.05b | 11.743 ± 0.03b |
Blood biochemical indices of 21-day-old yellow-feathered chickens in different treatment groups.
In the same row, values with different letter superscripts mean significant difference (P < 0.05), while with the same or no letter superscripts mean no significant difference (P > 0.05). Group A represents the basal diet; Group B represents basal diet supplemented with 10 mg enramycin/kg; Group C represents basal diet supplemented with 100 mg plectasin/kg; Group D represents basal diet supplemented with 200 mg plectasin/kg.
As shown in Table 8, the glucose concentration was significantly higher in group D than in groups A, B, and C (P < 0.05). The triglyceride concentration was significantly higher in groups B, C, and D than in group A (P < 0.05). The total cholesterol concentration was significantly higher in groups B, C, and D than in group A (P < 0.05). Meanwhile, the total cholesterol was significantly higher in group D than in groups A, B, and C (P < 0.05). However, there was no significant difference in the high-density cholesterol concentration among the different groups (P > 0.05). The albumin concentration was significantly higher in group B than in groups A, C, and D (P < 0.05). The total protein content was significantly higher in group D than in groups A, B, and C (P < 0.05). Additionally, the total protein content was significantly higher in group D than in group C (P < 0.05).
Discussion
AMPs have good potential as suitable alternatives to the conventional antibiotics used in swine and poultry industries (39). It was reported that AMPs have beneficial effects on growth performance, reducing the incidence of diarrhea and increasing the rate of weaned pigs (40). It was also reported that the bioactive peptides derived from cottonseed (BPC) could induce favorable influences on growth performance, immune responses and total antioxidant activity of serum in broiler chickens (41, 42). Additionally, Daneshmand et al. (18) showed that the AMPs could protect broilers against in vivo challenging E. coli. A previous study showed that plectasin elicits similar improvements in performance and intestinal mucosa growth and activity in weaned pigs when used as an antibiotic (43). However, there has been no research on the growth performance of yellow-feathered chickens treated with plectasin. Hence, this study for the first time reveals that dietary plectasin could increase ADG while decreasing the F/G ratio for an overall period of 1–63 days. This may be because plectasin could enhance the intestinal barrier and immune function and promote chickens to digest and absorb nutrients.
Cellular immunity and humoral immunity are two important immune responses in animals. Antibodies are secreted by plasma cells and used by the immune system to recognize and neutralize foreign substances such as bacteria and viruses (44). The antibody titer in serum reflects the strength of the body's humoral immune function and the body's health under certain conditions (45). A previous study showed that the artificial antimicrobial peptide KLKLLLLLKLK predominantly induces a TH2-type immune response to coinjected antigens (46). In this study, after oral administration of plectasin, we speculated that plectasin can be absorbed by the intestinal tract and improve intestinal health. Some studies have shown that the improvement of intestinal health can improve the immunity of chickens (47, 48), so we speculated that the improvement of immunity of chickens plays a certain role in improving humoral immunity. The level of the antibody titer produced by the body receiving the antigen reflects the level of the chicken's specific humoral immune function. Theoretically, plectasin can generate specific and non-specific immunity in the intestine through the proliferation of beneficial bacteria, and then improve the body's cellular and humoral immunity through T lymphocytes and B lymphocytes. After being metabolized by the animal, the serum contains active ingredients that promote the proliferation of spleen lymphocytes, which can exert its immune regulation function, and significantly increased the antibody titer, thereby improving the protection rate of the vaccine to the animal and has the effect of preventing and controlling diseases.
The small intestine is an important place for digestion and absorption of the animal body, so the morphological structure of the small intestine is often used as an indicator to measure the digestion and absorption functions of an animal. The length of the villi and the depth of crypts reflect the effective area and function of intestinal digestion and absorption of nutrients, and their ratio comprehensively reflects the functional status of the small intestine (49): the larger the ratio, the larger the contact area of the intestinal mucosa with nutrients and the stronger digestion and absorption functions. In this study, we showed that dietary antimicrobial peptide plectasin (200 mg plectasin/kg of diet) could increase the ratio between the villus length and crypt depth of the ileum, jejunum, and duodenum. Previous study has shown that dietary plectasin could improve the jejunal morphology in broiler chickens (Arbor Acres) (23). The reduced ratio between the villus length and crypt depth is a crucial indicator of gut morphology alterations as it reflects in reduced surface area (50). The possible mechanism of plectasin (200 mg plectasin/kg of diet) for increasing the ratio between the villus length and crypt depth of the ileum, jejunum, and duodenum may be that the dietary antimicrobial peptide plectasin has the function of protecting and promoting the repair of intestinal villi, and is conducive to the growth of intestinal epithelial cells, thus enlarging the absorption area and improving the absorption efficiency of nutrients, as well as facilitating the synthesis of important substances.
Tight junction proteins in intestinal epithelial cells play a key role in the intestinal mucosal barrier, and the destruction of these proteins can lead to an increase in cell-to-cell permeability (51). A previous study showed that oral administration of antimicrobial peptide such as CL36 and cLFchimera could improve the abundance of tight junction proteins in chickens (18, 19). The results in this study indicated that antimicrobial peptide plectasin could maintain the integrity of the intestinal physical barrier by up-regulating the expression of TFF-2, ZO-1, and Claudin-3 to stabilize the structural distribution of tight junction proteins, thereby improving the permeability of the colonic mucosal barrier, suggesting that its potential role in promoting intestinal function and growth performance.
The intestinal microecological flora of chickens plays an important role in immune regulation and disease control. Intestinal microbes can be divided into intestinal symbiotic bacteria, conditional pathogenic bacteria, and pathogenic bacteria regarding to the relationship between the intestinal tract and host (52). The intestinal tract concentrations of conditioned pathogens are low, such as E. coli which is facultative anaerobes, but when intestinal homeostasis is disrupted, for instance, when the body is infected by virus, the proliferation of E. coli is rapidly promoted and led to intestinal disorders (53). In this study, application of the dietary antimicrobial peptide plectasin can significantly reduce the number of E. coli in the ileum and promote an increase in the content of Lactobacillus in the ileum, illustrating that plectasin can inhibit the proliferation of harmful bacteria in the intestine and change the structure of intestinal flora. However, the specific mechanism by which this occurs still needs further study. On possible reason for increasing the Lactobacillus population in the intestinal of chicken is due to decreasing the pathogenic population such as E. coli and in this condition the Lactobacillus have more opportunity to grow. It seems, the peptide in higher dose (200 mg) likely can escape more from intestinal digestion and can direct antibacterial effects on E. coli. May be the peptide have more antibacterial effects on Gram negative bacteria vs. Gram positive bacteria for yellow-feathered chickens.
Cytokines play an important role in the immune response. Some studies indicated that AMPs have an important effect on NF-kB pathway regarding immunomodulatory activities of AMPs (54, 55). Besides, AMPs plays a crucial role in immune regulation by activating the mitogen-activated protein kinase signaling pathway (56). The expression of proinflammatory cytokines in the body is abnormal when disease occurs, causing pathological damage and immune function lessening. Both IL-17A and IL-22 are representative cytokines secreted by Th17 cells. IL-17A is an inflammatory cytokine that can promote the activation of T cells and stimulate epithelial cells to produce a variety of inflammatory factors (such as IL-6 etc.). Both IFN-α and IFN-γ play important anti-infection and immune regulation roles. Our study showed that the expression of interferon was positively correlated with the degree of inflammation in vivo of the intestine, and dietary plectasin can significantly decrease the mRNA expression levels of IFN-α and IFN-γ in the ileums of yellow-feathered chickens at 21 days of age. In this study, plectasin may maintain intestinal homeostasis by inhibiting the production of pro-inflammatory cytokines, reducing inflammatory cell infiltration, repairing intestinal barrier damage to a certain extent, enhancing intestinal epithelial barrier function, thereby reducing intestinal inflammation and achieving a protective effect on the intestinal tract.
Serum biochemical indices were commonly used as a standard to measure animal health because that they can reflect the physiological state and health of the animals (57). A large number of studies have demonstrated that antimicrobial peptides could affect the serum biochemical indices in Epinephelus coioides, weaned piglets, and chickens (58, 59). To a certain extent, blood biochemical indices could reflect the body's absorption and utilization of nutrients. For example, glucose is an important energy source of animal body, and the decrease of glucose content may be closely related to abnormal glucose metabolism, severe liver disease, malnutrition (60). The decrease of serum triglyceride is commonly associated with impaired liver function and malnutrition (61). Serum total cholesterol is mainly synthesized by the liver and is the main component that synthesizes a variety of hormones and forms the cell membrane (62). As a reflection of protein metabolism and immune function, the level of serum total protein can reflect the strength of protein synthesis and metabolism (61). In this study, pletasin is beneficial to improve the disorder of lipid metabolism and increase feed conversion rate of broilers to a certain extent by changing the contents of serum glucose, triglyceride and total cholesterol. Feeding the antimicrobial peptide for a long time could have the effects of disease prevention and resistance, which is conducive to the body health, ensures the health and production performance, and further improves the quality of meat products.
In summary, production performance, measured as the ADG, was improved while F/G was decreased after the addition of plectasin to feed compared with the addition of enramycin over a period of 63 days. Dietary plectasin intake can enhance the antibody levels of H9N2 AIV and NDV in yellow-feathered chickens at 21 and 35days of age. Dietary plectasin can enhance the intestine structure, inhibit E. coli and proinflammatory cytokines in the ileum, and ameliorate blood biochemical indices in yellow-feathered chickens.
Statements
Data availability statement
The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.
Ethics statement
The animal study was reviewed and approved by Animal Care Committee of South China Agricultural University (approval ID: SYXK-2014-0136).
Author contributions
QX and FenC conceived and designed the study. ZYao, ZYan, FeiC, and ZX collected the samples. CW, LW, RL, and LC conducted laboratory analysis and acquired the data. XZ and QZ conducted bioinformatics, data analysis, and drafted the manuscript. LW analyzed the data and provided suggestions on the design of the experiment. All authors contributed to the article, critically revised the manuscript, and approved the submitted version.
Funding
This work was supported by the Construction of Modern Agricultural Science and Technology Innovation Alliance in Guangdong Province (2020KJ128), Special project of national modern agricultural industrial technology system (grant no. CARS-41), and Creation of Triple Chimeric Vaccine (rIBV-ND-H9) based on attenuated Avian Infectious bronchitis virus D90 (grant no. 2017KZDM008).
Conflict of interest
LW was employed by Guangdong Hinabiotech Co., Ltd. ZYan was employed by Wen's Foodstuff Group Co., Ltd. The remaining authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1.
WitteW. Selective pressure by antibiotic use in livestock. Int J Antimicrob Ag. (2000) 16:S19–24. 10.1016/S0924-8579(00)00301-0
2.
DonoghueDJ. Antibiotic residues in poultry tissues and eggs: human health concerns?Poult Sci. (2003) 82:618–21. 10.1093/ps/82.4.618
3.
KolarMPantucekRBardonJVagnerovaITypovskaHValkaIet al. Occurrence of antibiotic-resistant bacterial strains isolated in poultry. Vet Med-Czech. (2002) 47:52–9. 10.17221/5803-VETMED
4.
Stepien-PysniakDMarekABanachTAdaszekLPyzikEWilczynskiJet al. Prevalence and antibiotic resistance of enterococcus strains isolated from poultry. Acta Vet Hung. (2016) 64:148–63. 10.1556/004.2016.016
5.
PalmieriBDi CerboALaurinoC. Antibiotic treatments in zootechnology and effects induced on the food chain of domestic species and, comparatively, the human specie. Nutr Hosp. (2014) 29:1427–33. 10.3305/nh.2014.29.6.7350
6.
BlumenthalKGPeterJGTrubianoJAPhillipsEJ. Antibiotic allergy. Lancet. (2019) 393:183–98. 10.1016/S0140-6736(18)32218-9
7.
LindbergRJarnheimerPAOlsenBJohanssonMTysklindM. Determination of antibiotic substances in hospital sewage water using solid phase extraction and liquid chromatography/mass spectrometry and group analogue internal standards. Chemosphere. (2004) 57:1479–88. 10.1016/j.chemosphere.2004.09.015
8.
DibnerJJRichardsJD. Antibiotic growth promoters in agriculture: history and mode of action. Poult Sci. (2005) 84:634–43. 10.1093/ps/84.4.634
9.
BrogdenKA. Antimicrobial peptides: pore formers or metabolic inhibitors in bacteria?Nat Rev Microbiol. (2005) 3:238–50. 10.1038/nrmicro1098
10.
HadleyEBHancockRE. Strategies for the discovery and advancement of novel cationic antimicrobial peptides. Curr Top Med Chem. (2010) 10:1872–81. 10.2174/156802610793176648
11.
WangGSongQHuangSWangYCaiSYuHet al. Effect of antimicrobial peptide microcin J25 on growth performance, immune regulation, and intestinal microbiota in broiler chickens challenged with Escherichia coli and Salmonella. Animals (Basel). (2020) 10:345. 10.3390/ani10020345
12.
ChoiSCIngaleSLKimJSParkYKKwonIKChaeBJ. An antimicrobial peptide-A3: effects on growth performance, nutrient retention, intestinal and faecal microflora and intestinal morphology of broilers. Br Poult Sci. (2013) 54:738–46. 10.1080/00071668.2013.838746
13.
WangSThackerPAWatfordMQiaoS. Functions of antimicrobial peptides in gut homeostasis. Curr Protein Pept Sci. (2015) 16:582–91. 10.2174/1389203716666150630135847
14.
HuangHWCharronNE. Understanding membrane-active antimicrobial peptides. Q Rev Biophys. (2017) 50:e10. 10.1017/S0033583517000087
15.
ScocchiMMardirossianMRuntiGBenincasaM. Non-membrane permeabilizing modes of action of antimicrobial peptides on bacteria. Curr Top Med Chem. (2016) 16:76–88. 10.2174/1568026615666150703121009
16.
HuFGaoXSheRChenJMaoJXiaoPet al. Effects of antimicrobial peptides on growth performance and small intestinal function in broilers under chronic heat stress. Poult Sci. (2017) 96:798–806. 10.3382/ps/pew379
17.
WuSZhangFHuangZLiuHXieCZhangJet al. Effects of the antimicrobial peptide cecropin AD on performance and intestinal health in weaned piglets challenged with Escherichia coli. Peptides. (2012) 35:225–30. 10.1016/j.peptides.2012.03.030
18.
DaneshmandAKermanshahiHSekhavatiMHJavadmaneshAAhmadianM. Antimicrobial peptide, CLF36, affects performance and intestinal morphology, microflora, junctional proteins, and immune cells in broilers challenged with E. coli. Sci Rep. (2019) 9:14176. 10.1038/s41598-019-50511-7
19.
DaneshmandAKermanshahiHSekhavatiMHJavadmaneshAAhmadianMAlizadehMet al. Effects of CLFchimera peptide on intestinal morphology, integrity, microbiota, and immune cells in broiler chickens challenged with necrotic enteritis. Sci Rep. (2020) 10:17704. 10.1038/s41598-020-74754-x
20.
GanzT. Defensins: antimicrobial peptides of innate immunity. Nat Rev Immunol. (2003) 3:710–20. 10.1038/nri1180
21.
SelstedMEOuelletteAJ. Mammalian defensins in the antimicrobial immune response. Nat Immunol. (2005) 6:551–7. 10.1038/ni1206
22.
MygindPHFischerRLSchnorrKMHansenMTSonksenCPLudvigsenSet al. Plectasin is a peptide antibiotic with therapeutic potential from a saprophytic fungus. Nature. (2005) 437:975–80. 10.1038/nature04051
23.
MaJLZhaoLHSunDDZhangJGuoYPZhangZQet al. Effects of dietary supplementation of recombinant plectasin on growth performance, intestinal health and innate immunity response in broilers. Probiotics Antimicrob Proteins. (2020) 12:214–23. 10.1007/s12602-019-9515-2
24.
OstrowskiMKowalczykS. Plant signaling peptides. Cysteine-rich peptides. Postepy Biochem. (2015) 61:79–92.
25.
CharletMChernyshSPhilippeHHetruCHoffmannJABuletP. Innate immunity. Isolation of several cysteine-rich antimicrobial peptides from the blood of a mollusc, Mytilus edulis.J Biol Chem. (1996) 271:21808–13. 10.1074/jbc.271.36.21808
26.
AfolabiOOAdigunMOPetersRFOkonofuaCUmarUAfuwapeOE. Plectasin against local strains of gram negative and positive bacteria. Glob Sci J. (2018) 6:107–23. Available online at: https://www.researchgate.net/publication/328703045_Assessment_of_antimicrobial_activity_of_plectasin_against_local_strains_of_gram_negative_and_positive_bacteria
27.
HaraSMukaeHSakamotoNIshimotoHAmenomoriMFujitaHet al. Plectasin has antibacterial activity and no affect on cell viability or IL-8 production. Biochem Bioph Res Co. (2008) 374:709–13. 10.1016/j.bbrc.2008.07.093
28.
SchneiderTKruseTWimmerRWiedemannISassVPagUet al. Plectasin, a fungal defensin, targets the bacterial cell wall precursor lipid II. Science. (2010) 328:1168–72. 10.1126/science.1185723
29.
XiangFXieZLFengJYangWSCaoZJLiWXet al. Plectasin, first animal toxin-Like fungal defensin blocking potassium channels through recognizing channel pore region. Toxins. (2015) 7:34–42. 10.3390/toxins7010034
30.
LiZZWangXMWangXDa TengDMaoRYHaoYet al. Research advances on plectasin and its derivatives as new potential antimicrobial candidates. Process Biochem. (2017) 56:62–70. 10.1016/j.procbio.2017.02.006
31.
ZhangJYangYTengDTianZWangSWangJ. Expression of plectasin in Pichia pastoris and its characterization as a new antimicrobial peptide against Staphyloccocus and Streptococcus. Protein Expr Purif. (2011) 78:189–96. 10.1016/j.pep.2011.04.014
32.
SinghSMAlkieTNHodginsDCNagyEShojadoostBSharifS. Systemic immune responses to an inactivated, whole H9N2 avian influenza virus vaccine using class B CpG oligonucleotides in chickens. Vaccine. (2015) 33:3947–52. 10.1016/j.vaccine.2015.06.043
33.
ReynoldsDLMaraqaAD. Protective immunity against Newcastle disease: the role of cell-mediated immunity. Avian Dis. (2000) 44:145–54. 10.2307/1592518
34.
HanJCZhangJLZhangNYangXQuHXGuoYet al. Age, phosphorus, and 25-hydroxycholecalciferol regulate mRNA expression of vitamin D receptor and sodium-phosphate cotransporter in the small intestine of broiler chickens. Poult Sci. (2018) 97:1199–208. 10.3382/ps/pex407
35.
El-SenouseyHKChenBWangJYAttaAMMohamedFRNieQH. Effects of dietary vitamin C, vitamin E, and alpha-lipoic acid supplementation on the antioxidant defense system and immune-related gene expression in broilers exposed to oxidative stress by dexamethasone. Poult Sci. (2018) 97:30–8. 10.3382/ps/pex298
36.
JiSQiXMaSLiuXLiuSMinY. A deficient or an excess of dietary threonine level affects intestinal mucosal integrity and barrier function in broiler chickens. J Anim Physiol Anim Nutr. (2019) 103:1792–9. 10.1111/jpn.13185
37.
LivakKJSchmittgenTD. Analysis of relative gene expression data using real-time quantitative PCR and the 2(-Delta delta c[T]) method. Methods. (2001) 25:402–8. 10.1006/meth.2001.1262
38.
MakledMNAbouelezzKFMGad-ElkareemAEGSayedAM. Comparative influence of dietary probiotic, yoghurt, and sodium butyrate on growth performance, intestinal microbiota, blood hematology, and immune response of meat-type chickens. Trop Anim Health Prod. (2019) 51:2333–42. 10.1007/s11250-019-01945-8
39.
WangSZengXFYangQQiaoSY. Antimicrobial peptides as potential alternatives to antibiotics in food animal industry. Int J Mol Sci. (2016) 17:603. 10.3390/ijms17050603
40.
XiongXYangHSLiLWangYFHuangRLLiFNet al. Effects of antimicrobial peptides in nursery diets on growth performance of pigs reared on five different farms. Livest Sci. (2014) 167:206–10. 10.1016/j.livsci.2014.04.024
41.
LandyNKheiriFFaghaniM. Effects of periodical application of bioactive peptides derived from cottonseed on performance, immunity, total antioxidant activity of serum and intestinal development of broilers. Anim Nutr. (2021) 7:134–41. 10.1016/j.aninu.2020.06.008
42.
LandyNKheiriFFaghaniM. Evaluation of cottonseed bioactive peptides on growth performance, carcase traits, immunity, total antioxidant activity of serum and intestinal morphology in broiler chickens. Ital J Anim Sci. (2020) 19:1375–86. 10.1080/1828051X.2020.1844085
43.
WanJLiYChenDWYuBChenGZhengPet al. Recombinant plectasin elicits similar improvements in the performance and intestinal mucosa growth and activity in weaned pigs as an antibiotic. Anim Feed Sci Tech. (2016) 211:216–26. 10.1016/j.anifeedsci.2015.12.003
44.
JuntTMosemanEAIannaconeMMassbergSLangPABoesMet al. Subcapsular sinus macrophages in lymph nodes clear lymph-borne viruses and present them to antiviral B cells. Nature. (2007) 450:110–4. 10.1038/nature06287
45.
YurongYYibaoJRuipingSQingqiangYKaisongPHuihuiBet al. Effects of chicken intestinal antimicrobial peptides on humoral immunity of chickens and antibody titres after vaccination with infectious bursal disease virus vaccine in chicken. Arch Anim Nutr. (2006) 60:427–35. 10.1080/17450390600884484
46.
FritzJHBrunnerSBirnstielMLBuschleMGabainAMattnerFet al. The artificial antimicrobial peptide KLKLLLLLKLK induces predominantly a TH2-type immune response to co-injected antigens. Vaccine. (2004) 22:3274–84. 10.1016/j.vaccine.2004.03.007
47.
YangXXinHYangCYangX. Impact of essential oils and organic acids on the growth performance, digestive functions and immunity of broiler chickens. Anim Nutr. (2018) 4:388–93. 10.1016/j.aninu.2018.04.005
48.
BroomLJKogutMH. The role of the gut microbiome in shaping the immune system of chickens. Vet Immunol Immunopathol. (2018) 204:44–51. 10.1016/j.vetimm.2018.10.002
49.
ZhangXZhaoQCiXChenSXieZLiHet al. Evaluation of the efficacy of chlorogenic acid in reducing small intestine injury, oxidative stress, and inflammation in chickens challenged with Clostridium perfringens type A. Poult Sci. (2020) 99:6606–18. 10.1016/j.psj.2020.09.082
50.
PatraAKKarI. Heat stress on microbiota composition, barrier integrity, and nutrient transport in gut, production performance, and its amelioration in farm animals. J Anim Sci Technol. (2021) 63:211–47. 10.5187/jast.2021.e48
51.
ChasiotisHKolosovDBuiPKellySP. Tight junctions, tight junction proteins and paracellular permeability across the gill epithelium of fishes: a review. Respir Physiol Neurobiol. (2012) 184:269–81. 10.1016/j.resp.2012.05.020
52.
ZhangXZhaoQCiXChenSChenLLianJet al. Effect of baicalin on bacterial secondary infection and inflammation caused by H9N2 AIV infection in chickens. Biomed Res Int. (2020) 2020:2524314. 10.1155/2020/2524314
53.
ZhangXHZhaoQQWuCXieZCiXTLiHXet al. Nitrate is crucial for the proliferation of gut Escherichia coli caused by H9N2 AIV infection and effective regulation by Chinese herbal medicine ageratum-liquid. Front Microbiol. (2020) 11:555739. 10.3389/fmicb.2020.555739
54.
ZhuFZhangBLiJZhuL. Effects of fermented feed on growth performance, immune response, and antioxidant capacity in laying hen chicks and the underlying molecular mechanism involving nuclear factor-kappaB. Poult Sci. (2020) 99:2573–80. 10.1016/j.psj.2019.12.044
55.
FadlSEEl-GammalGASakrOASalahAAtiaAAPrinceAMet al. Impact of dietary mannan-oligosaccharide and beta-Glucan supplementation on growth, histopathology, E-coli colonization and hepatic transcripts of TNF-alpha and NF- varkappaB of broiler challenged with E. coli O78. BMC Vet Res. (2020) 16:204. 10.1186/s12917-020-02423-2
56.
HongYLeeJVuTHLeeSLillehojHSHongYH. Chicken avian beta-defensin 8 modulates immune response via the mitogen-activated protein kinase signaling pathways in a chicken macrophage cell line. Poult Sci. (2020) 99:4174–82. 10.1016/j.psj.2020.05.027
57.
ChenYGongXLiGLinMHuoYLiSet al. Effects of dietary alfalfa flavonoids extraction on growth performance, organ development and blood biochemical indexes of Yangzhou geese aged from 28 to 70 days. Anim Nutr. (2016) 2:318–22. 10.1016/j.aninu.2016.09.004
58.
SuYLChenGChenLSLiJZWangGHeJYet al. Effects of antimicrobial peptides on serum biochemical parameters, antioxidant activity and non-specific immune responses in Epinephelus coioides. Fish Shellfish Immunol. (2019) 86:1081–7. 10.1016/j.fsi.2018.12.056
59.
WangJHWuCCFengJ. Effect of dietary antibacterial peptide and zinc-methionine on performance and serum biochemical parameters in piglets. Czech J Anim Sci. (2011) 56:30–6. 10.17221/341/2009-CJAS
60.
NordlieRCFosterJDLangeAJ. Regulation of glucose production by the liver. Annu Rev Nutr. (1999) 19:379–406. 10.1146/annurev.nutr.19.1.379
61.
StohlWKenolBKellyAJAnanth CorreaAPanushRS. Elevated serum globulin gap as a highly reliable marker of elevated erythrocyte sedimentation rate in patients with systemic rheumatic diseases. Semin Arthritis Rheum. (2019) 49:485–92. 10.1016/j.semarthrit.2019.05.001
62.
TabasI. Cholesterol in health and disease. J Clin Invest. (2002) 110:583–90. 10.1172/JCI0216381
Summary
Keywords
plectasin, performance, immune, intestinal health, yellow-feathered chickens
Citation
Zhang X, Zhao Q, Wen L, Wu C, Yao Z, Yan Z, Li R, Chen L, Chen F, Xie Z, Chen F and Xie Q (2021) The Effect of the Antimicrobial Peptide Plectasin on the Growth Performance, Intestinal Health, and Immune Function of Yellow-Feathered Chickens. Front. Vet. Sci. 8:688611. doi: 10.3389/fvets.2021.688611
Received
31 March 2021
Accepted
19 May 2021
Published
23 June 2021
Volume
8 - 2021
Edited by
Amlan Kumar Patra, West Bengal University of Animal and Fishery Sciences, India
Reviewed by
Mohammad Hadi Sekhavati, Ferdowsi University of Mashhad, Iran; Ilias Giannenas, Aristotle University of Thessaloniki, Greece; Nasir Landy, Islamic Azad University of Shahrekord, Iran
Updates
Copyright
© 2021 Zhang, Zhao, Wen, Wu, Yao, Yan, Li, Chen, Chen, Xie, Chen and Xie.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Qingmei Xie qmx@scau.edu.cn
This article was submitted to Animal Nutrition and Metabolism, a section of the journal Frontiers in Veterinary Science
†These authors have contributed equally to this work and share first authorship
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.