Abstract
Additional research on soft ticks in the family Argasidae is needed to bridge the knowledge gap relative to hard ticks of the family Ixodidae; especially, the molecular mechanisms of Ornithodoros biology. Ornithodoros species are vectors of human and animal pathogens that include tick-borne relapsing fever spirochetes and African swine fever virus. Soft tick vector-pathogen interactions involving components of the tick immune response are not understood. Ticks utilize a basic innate immune system consisting of recognition factors and cellular and humoral responses to produce antimicrobial peptides, like defensins. In the present study, we identified and characterized the first putative defensins of Ornithodoros turicata, an argasid tick found primarily in the southwestern United States and regions of Latin America. Four genes (otdA, otdB, otdC, and otdD) were identified through sequencing and their predicted amino acid sequences contained motifs characteristic of arthropod defensins. A phylogenetic analysis grouped these four genes with arthropod defensins, and computational structural analyses further supported the identification. Since pathogens transmitted by O. turicata colonize both the midgut and salivary glands, expression patterns of the putative defensins were determined in these tissues 1 week post engorgement and after molting. Defensin genes up-regulated in the tick midgut 1 week post blood feeding were otdA and otdC, while otdD was up-regulated in the midgut of post-molt ticks. Moreover, otdB and otdD were also up-regulated in the salivary glands of flat post-molt ticks, while otdC was up-regulated within 1 week post blood-feeding. This work is foundational toward additional studies to determine mechanisms of vector competence and pathogen transmission from O. turicata.
Introduction
Ornithodoros (argasid) species are vectors of veterinary and medically significant pathogens. The primary species in the United States that transmit pathogens include Ornithodoros turicata, Ornithodoros hermsi, Ornithodoros parkeri, Ornithodoros talaje, and Ornithodoros coriaceus (Davis, 1939; Cooley and Kohls, 1944; Hess et al., 1987; Donaldson et al., 2016; Lopez et al., 2016; Sage et al., 2017). These species have been implicated in the transmission of tick-borne relapsing fever spirochetes (Lane et al., 1985; Dworkin et al., 2002; Nieto et al., 2012; Lopez et al., 2016; Christensen et al., 2017; Bissett et al., 2018). Moreover, O. turicata and O. coriaceus were experimentally shown to be competent vectors of African swine fever virus (ASFV) (Hess et al., 1987), an emerging pathogen in Europe and Asia. O. parkeri was able to be infected with ASFV, but unable to transmit the pathogen via tick bite (Hess et al., 1987). Ornithodoros ticks play a significant role in pathogen maintenance, yet very little is known regarding vector competence.
The life cycles of Ornithodoros ticks and their pathogens has been predominantly characterized utilizing O. hermsi and O. turicata models, and these studies identified significant challenges when attempting to elucidate mechanisms of vector competence. Ornithodoros species are rapid feeders, completing the bloodmeal within 5–60 min (Balashov, 1972). As ticks blood feed, pathogens initially colonize the midgut (Schwan, 1996; Schwan and Hinnebusch, 1998; Krishnavajhala et al., 2017). Given that transmission can occur within seconds of tick attachment, pathogens must also colonize the salivary glands to ensure entrance into a vertebrate host (Schwan and Hinnebusch, 1998; Boyle et al., 2014; Krishnavajhala et al., 2017). Ornithodoros species are also unique from other tick genera because they live for 10–20 years and can endure over 5 years of starvation and still remain competent vectors (Davis, 1943; Assous and Wilamowski, 2009). Recently, physiological differences were detected between the midgut and salivary glands of O. turicata, which revealed selective pressures that pathogens encounter in the argasid tick including reactive nitrogen and oxygen species (ROS and RNS) (Bourret et al., 2019). However, it remains vague what other immunological pressures exist in these two disparate environments.
Three identified branches of tick immunity are currently recognized: immune regulation components (recognition factors and signaling pathways), cellular, and humoral (Kopáček et al., 2010; Hynes, 2014). In argasid ticks, identified recognition factors include lectins, which are important for self and non-self-recognition (Grubhoffer et al., 2004; Kopáček et al., 2010). Cellular responses have primarily been found in the hemocoel and include hemocyte responses and phagocytosis of pathogens (Sonenshine et al., 2002; Nakajima et al., 2003b; Oliva Chavez et al., 2017; Sonenshine and Macaluso, 2017). The most characterized portion of soft tick immunity, though still significantly understudied, is humoral immunity. Within this branch of immunity are proteases, protease inhibitors, and antimicrobial peptides (AMPs) (Sonenshine and Hynes, 2008; Hajdusek et al., 2013; Oliva Chavez et al., 2017).
AMPs are a broad category of immune molecules that function to protect the vector from pathogens (Sonenshine et al., 2002; Boulanger et al., 2006; Hajdusek et al., 2013; Tonk et al., 2014). AMPs include lysozymes, hebraein, microplusin, ixodidin, ixosin, Ixodes scapularis AMP (isAMP), hemoglobin fragments, and defensins (Grunclová et al., 2003; Lai et al., 2004; Sonenshine et al., 2005; Fogaça et al., 2006; Liu et al., 2008; Silva et al., 2009; Chrudimska et al., 2010; Hajdusek et al., 2013). A key component of tick and other arthropod immunity are defensins. These are cationic molecules that disrupt the cell membrane of pathogens by binding to the negatively charged membrane and forming a pore leading to cell depolarization and ultimately cell death (Nakajima et al., 2003a; Bulet and Stöcklin, 2005). Tick defensins consist of a signal peptide, pro-segment containing a furin cleavage site (RVRR) (Chrudimska et al., 2014), and the mature peptide (Hosaka et al., 1991; Nakajima et al., 2001). The mature peptide is characterized with six cysteine residues that form three disulfide bonds resulting in a cysteine-stabilized αβ (CSαβ) motif (Bulet and Stöcklin, 2005). Proper cysteine pairing through disulfide bonds is crucial for antimicrobial activity (Isogai et al., 2011).
In this study, we focused on identifying immunological pressures produced in the tick midgut and salivary glands. Since genomic and transcriptomic resources are limited for O. turicata, we utilized a salivary gland transcriptome to identify putative defensins (Bourret et al., 2019). These candidates had the characteristic six cysteine residues observed in known defensin molecules of insects and arthropods. Transcripts were further evaluated by rapid amplification of cDNA ends (RACE) to obtain full-length sequences. We performed computational analyses at the protein level to generate predictive structures, which further supported the characterization of theses transcripts as defensins. A phylogenetic analysis was also performed with defensins from numerous arthropod species. Lastly, we investigated expression patterns of these putative defensins in the midgut and salivary gland tissues 1 week after O. turicata fed and after the molt. These time points were chosen because of their importance in early and post-molt pathogen colonization. Our initial findings suggest that in Ornithodoros species defensins may have a role directly after blood feeding, while others are utilized in post-molt ticks. Our findings provide a foundation to further investigate the molecular mechanisms of vector competence in a rapid feeding, long-lived tick.
Materials and Methods
Identification of Defensins and RACE Sequencing
O. turicata defensins were identified from our previously reported salivary gland transcriptome (Bourret et al., 2019). The transcriptome was analyzed to select transcripts that were annotated as defensins. Putative defensins were evaluated in National Center for Biotechnology Information (NCBI) using Basic Local Alignment Search Tool (BLAST) to confirm the transcriptome results by assessing amino acid sequence homology with other arthropod defensins (Altschul et al., 1990).
Rapid amplification of cDNA ends (RACE) was performed with mRNA extracted from a pool of 9 ticks 9 days post blood feeding, using the Nucleotrap mRNA MiniKit (Takara Bio Inc, Kusatsu, Japan) and following the manufacturer's instructions. Purified mRNA was used with the SMARTer RACE 5'/3' kit (Takara Bio Inc, Kusatsu, Japan) and for both the 5' and 3' ends of the defensin transcripts. Gene-specific oligos for 5' and 3' RACE (Table 1) were designed according to manufacturer's instructions based on sequences identified as defensins in the RNA-seq dataset and were manufactured by Sigma-Aldrich (St. Louis, MO). The 5' and 3' RACE reactions were performed following the manufacturer's instructions using the Touchdown PCR protocol. The only modification was the extension times throughout the protocol were shortened to 1 min. RACE PCR reactions were analyzed by agarose gel electrophoresis (0.8% agarose tris-acetate EDTA buffer) and positive PCR reactions were purified using the QIAquick PCR purification kit (Qiagen, Hilden, Germany). Following manufacturers' instructions, purified PCR products were cloned using the Zero Blunt TOPO PCR Cloning Kit for Sequencing (ThermoFisher, Waltham, MA) and used to transform NEB10-beta chemically competent cells (New England BioLabs, Ipswich, MA). Transformants were plated on LB-Miller agar (BD Biosciences, San Jose, CA) containing 50 ug/mL of kanamycin (Sigma-Aldrich, St. Louis, MO) overnight at 37°C. Colonies were screened by PCR with universal M13F/R primers (Sigma-Aldrich, St. Louis, MO) at a final concentration of 200 nM and using OneTaq 2x PCR mastermix with standard buffer (New England BioLabs, Ipswich, MA) using the following colony PCR protocol: 94°C for 5 min: 1 cycle; 94°C 30 s, 50°C 30 s, 68°C 40 s: 25 cycles; 68°C 5 min: 1 cycle; 10°C hold. Colony PCR was analyzed by agarose gel electrophoresis and the colonies with the largest products were selected for sequencing. Selected colonies were cultured overnight in 5 mL of LB-Miller with 50 ug/mL of kanamycin and plasmid isolated the following day with the QiaPrep Spin Miniprep Kit (Qiagen). Purified RACE product plasmids were sent to GeneWiz (Plainfield, NJ) for Sanger sequencing using M13F/R sequencing primers. Sequencing results were analyzed using FinchTV (v1.4.0, Digital World Biology) and the predicted amino acid sequences were BLASTed (Blastp) against representative non-redundant protein sequences on NCBI to confirm their identity (Altschul et al., 1990). Complete coding sequences were submitted to Genbank under the names otdA (MN725028), otdB (MN725029), otdC (MN725030), and otdD (MN725031).
Table 1
| Gene | Primer sequences (5′-3′) |
|---|---|
| qPCR primer sets | |
| OtdA F | AGGACGGTACGGGGAAT |
| OtdA R | CGCACTTCTGGTCCAGC |
| OtdA Probe | YAK-ACCAGTACCAGTGCCACAGCCACTG-BBQ |
| OtdB F | AGGACGGTACGGGGAAT |
| OtdB R | CGCACTTCTGGTCCAGC |
| OtdB Probe | YAK-AGCCCGGTGCATCTTCCATATGC-BBQ |
| OtdC F | TGTTCTGAGTGCCGTTGTTAC |
| OtdC R | TGCTTCCGACACATAGCG |
| OtdC Probe | YAK-AGGCGTGCTCCGTGTTATGCAC-BBQ |
| OtdD F | TTTCGGTGTGCATTGTAGC |
| OtdD R | GGCAATGCTGATTGCACT |
| OtdD Probe | YAK-TGCAGATGGTGGCAGCGGCT-BBQ |
| BA F | TATCCACGAGACCACCTACAA |
| BA R | TCTGCATACGATCGGCAATAC |
| BA Probe | FAM-AAGGACCTGTACGCCAACACTGTC-IBFQ |
| RACE primers | |
| M13 F | GTAAAACGACGGCCAG |
| M13 R | CAGGAAACAGCTATGAC |
| OtdA 5′ | AGTGGCTGTGGCACTGGTACTGG |
| OtdA 3′ | AAGAGTCATCAGCCGTCCGAGTTCGT |
| OtdB 5′ | CCTTTCGCACTTGAAGGTACAGGCAA |
| OtdB 3′ | TGCTGCTTCTTACTGGGCTTCTCACTTC |
| OtdC 5′ | AAGTCTCTACGCAGTGCTTCCGACACAT |
| OtdC 3′ | CCCAGCAATGACTCCTCTCCGTTT |
| OtdD 5′ | TCTGGTGTCGAGGCAATGCTGATT |
| OtdD 3′ | CGGTGTGCATTCTAGCCCTCCTGC |
Oligonucleotides and probes used for qPCR and RACE.
F, forward; R, reverse; YAK, Yakima dye; BBQ, blackberry quencher; FAM, fluorescein amide; IBFQ, Iowa Black FQ quencher.
Defensin Sequence Alignment and Protein Structure Prediction
The amino acid sequences of the identified O. turicata defensins were aligned with defensins published in Genbank from Ornithodoros moubata (BAB41028.1), Carios puertoricensis (ACJ04430.1), I. scapularis (XP_029834656.1), Haemaphysalis longicornis (ATN39848.1), Dermacentor variabilis (AAO24323.1), Amblyomma americanum (ABI74752.1), and Argas monolakensis (ABI52686.1). Mature peptide sequences were aligned using ClustalW in MEGAX 10.0.5 (Kumar et al., 2018). The signal peptide and propeptide cleavage sites were predicted using the ProP 1.0 Server (Duckert et al., 2004).
The structure of the defensins was predicted as described by Rodríguez-García et al. (2016). Briefly, protein model templates were identified based on sequence alignments generated with the Hhpred server (https://toolkit.tuebingen.mpg.de/tools/hhpred). The top three sequences were selected from tertiary structure prediction using MODELLER (https://toolkit.tuebingen.mpg.de/tools/modeller) (Webb and Sali, 2016; Zimmermann et al., 2018). The predicted structure was analyzed with ProSA-web (https://prosa.services.came.sbg.ac.at/prosa.php) to assess the Z-score (Wiederstein and Sippl, 2007). The final structure was generated using the Swiss-PDB Viewer 4.1.0 (Guex and Peitsch, 1997).
Phylogenetic Analysis of Arthropod Defensins
All reported analyses were performed using NGPhylogeny.fr (Lemoine et al., 2018). Analyses with the same input data were also performed using MEGAX for comparison (data not shown) (Kumar et al., 2018). Alignments of the mature peptide sequence were performed using MUSLCE v3.8.31 under the “most accurate, maxiters = 16” run option setting and “UPGMB” under the clustering setting (Edgar, 2004). Noisy v1.5.12.1 was used for alignment curation with a cut-off threshold of 0.8 and the Hamming distance method via the Neighbor-Net ordering method (Dress et al., 2008). FastTree v2.1.10_1 was used to infer the phylogenetic tree with the WAG evolutionary model using Gamma distribution and 1,000 bootstraps (Price et al., 2009, 2010).
Tick Colony Maintenance, Feedings, and Dissections
The present study used laboratory reared mid to late nymphal stage O. turicata ticks descendent of ticks originally collected in Travis County, Texas (Kim et al., 2017). The ticks were maintained in colony at 25°C and 80–85% humidity, as previously described (Lopez et al., 2013). Ticks were fed on an Institute of Cancer Research (ICR) mouse and dissected 1 week later (fed) or allowed to molt (post-molt). Each biological replicate consisted of 10 pooled midguts or salivary gland pairs from post-molt or fed ticks.
Midguts and salivary glands were extracted using an Axio Stemi dissection microscope (Zeiss, Munich, Germany). An individual tick was placed on a microscope slide in 10 to 20 μl of 1x Dulbecco's Phosphate Buffered Saline (DPBS) (Life Technologies, Grand Island, NY). The cuticle was removed, and the midgut extracted and placed in 100 μl of RNAlater (Qiagen, Hilden, Germany). The tick was then rinsed with 10 μl of 1x DPBS, the salivary glands removed and placed in 15 μl of 1x DPBS, rinsed, and placed in a tube containing 100 μl of RNAlater. Each sample consisted of 10 pooled midguts or salivary gland pairs. Samples were stored at −80°C until RNA was extracted.
RNA Extraction, cDNA Synthesis, and RT-qPCR Analysis
Tissues were homogenized using a pestle (Argos Technologies, Elgin, IL) and were spun through a QIAshredder column per manufacturer's instructions (Qiagen, Hilden, Germany). RNA was extracted using the RNeasy mini kit (Qiagen, Hilden, Germany) following manufacturer's instructions. Samples were DNase treated (Qiagen, Hilden, Germany) and eluted in 30 μl of nuclease free water (Ambion, Inc, Austin, TX). RNA was quantified using a NanoDrop 2000 spectrophotometer (software v1.6.198, ThermoFisher Scientific, Waltham, MA).
RNA was converted to cDNA using the iScript cDNA synthesis kit (Bio-Rad, Hercules, CA) per the manufacturer's instructions. Gene expression was assessed using the cDNA to perform duplex qPCR. Primers against the defensins for qPCR (Table 1) were designed using the sequences from RACE sequencing and were synthesized by Integrated DNA Technologies (Coralville, IA). Defensins were run in duplex with O. turicata β-actin (Krishnavajhala et al., 2018), using the SsoAdvanced Universal Probes Supermix (Bio-Rad, Hercules, CA). Assays were performed with primers and probes at a concentration of 400 and 300 nM, respectively. The conditions for the assay were 50°C for 2 min (hold), 95°C for 3 min (polymerase activation), 95°C for 15 s (DNA denaturation), 60°C for 30 s (annealing and extension), repeating steps three (DNA denaturation) and four (annealing and extension) for 40 cycles on a CFX384 Touch Real-Time PCR Detection System (Bio-Rad, Hercules, CA). Each defensin was run with at least four biological replicates per tissue, with each replicate being run in technical triplicate.
Statistical Analyses
The RT-qPCR data were statistically evaluated using Prism (Graphpad 8.2.1, San Diego, CA). Data were analyzed by normalizing the defensin genes to β-actin (ΔCt) and calculating the 2−ΔCt of each reaction and performing a Student's t-test with Welch's correction to determine significance. In order to perform a statistical analysis, any gene that we could not detect expression in a given condition, the Ct value was set to 40 (the cutoff number of cycles). This was done for otdC in post-molt midguts and otdD in fed midguts. To determine the log2 fold change, the average fold change was calculating by dividing the 2−ΔCt value by the average of the post-molt reactions 2−ΔCt for that defensin and tissue. Subsequently, the log2 fold change for each reaction was determined and the mean and standard deviation calculated for fed and post-molt samples. Expression was significantly different if there was a log2 fold change of at least 1 (equivalent to a fold change of 2) and the p-value for the t-test was ≤ 0.05.
Results
Molecular Analysis of O. turicata Defensins
We evaluated the O. turicata salivary gland transcriptome (Bourret et al., 2019) with the goal of identifying defensin transcripts. Through this analysis we identified five candidates. RACE and Sanger sequencing validated the transcriptome results and confirm the full coding sequence of each defensin. We analyzed the full coding sequences by BLASTp and one candidate was omitted because the full-length cDNA failed to align to known arthropod defensins. The remaining four defensin genes were designated putative O. turicata defensin A (otdA), B (otdB), C (otdC), and D (otdD), and their sequences are in Table 2.
Table 2
| Defensin | Amino acid sequence |
|---|---|
| OtdA | MKTVFVIALVFALAVASMA*QDVDDVEESSAVRVRR∧GYGCPFNQYQCHSHCSGIRGYKGGYCKGLFKQTCTCY |
| OtdB | MKVLCFLLLLLLTGLLTSRA*AVLDTRRDPEDGT‡GNDCPHNEIACTLKCERDGFAYGRCTGLVLDQKCECIA |
| OtdC | MTPLRFSLVCFLVLSAVVTATA*FQLRSVHNTEH‡AYGCPGYRAMCRKHCVETFGFEGYCGGAHRNECKCRG |
| OtdD | MKIVLVLLVCVMAFGVHS*SPPAADGGSGY‡GNGCPSNPAQCNQHCLDTRDLTGHCKGYQMTFCDCGW |
Predicted cleavage sites of putative O. turicata defensins.
Signal peptide cleavage site;
propeptide cleavage site;
predicted mature peptide start site if there is no propeptide.
We used the ProP 1.0 server to predict potential cleavage sites within the defensin sequences and to identify the signal, pro-, and mature peptides (Table 2). OtdA was predicted to have both a signal peptide and propeptide, as indicated by the presence of a furin motif (RVRR), while OtdB, OtdC, and OtdD only had predicted signal peptides. No other O. turicata putative defensins contained the furin motif. The amino acid sequences of the mature putative defensins also were aligned to the sequences of 10 tick defensins from ixodids and argasids (Figure 1). Importantly, all four putative O. turicata defensins had six cysteines that aligned with the cysteines of other tick defensins (Figure 1). OtdA also had the most conserved amino acids (67.6%) of any of the O. turicata defensins when compared to the other proteins. OtdB had the fewest conserved amino acids (25.5%), while OtdC and OtdD had 27.1 and 31.3% amino acid identity, respectively. Except for A. monolakensis, all other tick defensin sequences had at least 46.2% of their amino acids identical, and 7 of 10 sequences had more than 50% amino acid identity.
Figure 1
Using protein modeling templates, tertiary structures of the putative O. turicata defensins were predicted. Included in the analyses were the tertiary structures for O. moubata defensin A and A. monolakensis defensin because they were the most similar to the O. turicata defensins (Figures 2A,B). All the evaluated defensins had an alpha helix followed by two beta sheets held together by three disulfide bridges. As is characteristic of arthropod defensins, it is predicted that the disulfide bridges form between C1–C4, C2–C5, and C3–C6. From the prediction, OtdA and O. moubata defensin A had longer alpha helices (11 amino acids) and shorter beta sheets (three amino acids) (Figure 2A). OtdB had a longer alpha helix (10 amino acids) and longer beta sheets (five amino acids) (Figure 2A). OtdC and OtdD had shorter alpha helices (nine amino acids) and longer beta sheets (five amino acids), which was similar to A. monolakensis defensin (alpha helix: eight amino acids, beta sheets: five amino acids) (Figure 2B).
Figure 2
Phylogenetic Analysis of Arthropod Defensins
A maximum likelihood (ML) analysis of tick, insect, and scorpion mature defensins and defensin-like toxins was generated to assess the evolutionary relationship between our novel putative O. turicata defensins and other arthropod defensins (Figure 3). The ML analysis showed a distinct clade for scorpion defensin-like toxins (orange), insect defensins (green), and four clades for tick defensins. OtdA was within a clade made up of Ornithodoros and Argas defensins. OtdB, OtdC, and OtdD clustered together in one clade with Argas and Amblyomma defensins.
Figure 3
Expression of O. turicata Defensins in the Midgut and Salivary Glands of Post-molt and Fed Ticks
Previous studies indicate midgut and salivary gland colonization is essential for pathogen transmission from Ornithodoros species (Hess et al., 1987; Lopez et al., 2011; Boyle et al., 2014; Krishnavajhala et al., 2017). Therefore, expression of the four putative defensins was further evaluated in pooled midguts and salivary glands 1 week after ticks fed and after they molted. Expression was considered significantly different if there was a log2 fold change of at least 1 and the p ≤ 0.05. In fed ticks (Figure 4A), otdA and otdC were up-regulated compared to post-molt O. turicata. otdA was expressed in the midgut of post-molt ticks and significantly up-regulated in the midgut within a week after feeding (log2 fold change = 2.26 ± 0.29) (Figure 4A). otdA was expressed in the salivary glands of fed and post-molt ticks and there was not a significant change in expression between the conditions. Also, we did not detect transcripts of otdC within 40 cycles in the midgut of post-molt ticks, but the gene was significantly up-regulated in fed ticks (log2 fold change = 3.46 ± 1.18) (Figure 4A). otdC was expressed in the salivary glands of post-molt ticks and was significantly up-regulated within 1 week after ticks fed (log2 fold change = 4.14 ± 0.35) (Figure 4A).
Figure 4
We also detected defensin genes to be up-regulated in post-molt ticks (Figure 4B). Transcripts of otdD were not detected in the midgut of fed ticks but the gene was up-regulated after ticks molted (log2 fold change = 7.32 ± 1.59) (Figure 4B). Moreover, this gene was expressed in the salivary glands of fed ticks and significantly up-regulated in post-molt O. turicata (log2 fold change = 2.52 ± 1.31) (Figure 4B). While there was no significant difference in otdB expression in the midgut between fed and post-molt ticks, the gene was significantly up-regulated in the salivary glands of post-molt ticks relative to fed ticks (log2 fold change = 3.82 ± 2.02) (Figure 4B).
Discussion
The present study identified transcripts coding for annotated defensins from O. turicata and assessed their expression in the midgut and salivary glands of fed and post-molted ticks. Since the four putative defensin genes (otdA, otdB, otdC, and otdD) were initially identified in a salivary gland transcriptome from O. turicata (Bourret et al., 2019), we determined and validated their full sequences. Additionally, a computational analysis identified conserved motifs and the six cysteines characteristic of defensins. The expression patterns of these defensins in the midgut and salivary glands suggested they may have differing functional roles dependent upon whether the tick is fed or in the post-molted state. Collectively, these findings set the framework to further define soft tick immunity, an understudied aspect of vector biology.
Seminal work in Ornithodoros defensins was performed in the Old World species O. moubata. Van der Goes van Naters-Yasui and colleagues purified and determined the partial amino acid sequence of a small peptide (4 kDa) with homology to a scorpion defensin (Van Der Goes Van Naters-Yasui et al., 1999). Subsequently, Nakajima and co-workers identified four isoforms of this defensin that were over 78% homologous, constitutively produced in the midgut lumen of O. moubata, and up-regulated after ticks blood fed (Nakajima et al., 2001, 2002a,b). In O. turicata, OtdA was most homologous to O. moubata defensin isoform A. While additional isoforms of OtdA were not identified in our study, our transcriptional findings were consistent with the work performed in O. moubata. We detected otdA transcript in post-molt ticks, and upon feeding the gene was up-regulated in the midgut. Moreover, we expanded our investigation to assess otdA expression in the salivary glands, which is another tissue typically colonized by pathogens (Boyle et al., 2014; Krishnavajhala et al., 2017). Within the salivary glands otdA was expressed, but we failed to detect a change in transcript levels in response to blood feeding.
Our computational analyses indicated differences in amino acid motifs between the four identified defensins. Typically, arthropod defensin motifs include a signal peptide, a propeptide, and a mature peptide that consists of six cysteine residues that form three disulfide bonds (Bulet and Stöcklin, 2005). Furthermore, the propeptide is characterized by a furin motif that serves as a cleavage site. OtdA was most similar to other known tick defensins because it contained the signal peptide and propeptide. OtdB, OtdC, and OtdD lacked the propetide but retained the signal peptide. Furthermore, these proteins contain the necessary cysteines for disulfide bridge formation in the mature peptide, which is critical for microbicidal activity (Bulet and Stöcklin, 2005). Our findings suggest that not all defensins require the furin cleavage site for functionality, and that OtdB, OtdC, and OtdD likely form a mature peptide after the signal peptide is cleaved. In support of this, production of synthetic defensins only consists of the mature peptides, and they retain their functional activity (Nakajima et al., 2002b; Prinsloo et al., 2013; Malan et al., 2016).
While defensins are important in tick immunity, studies indicate that they possess a dual-function role in homeostasis. OsDef2, a defensin identified in Ornithodoros savignyi, was shown to have immune function and antioxidant properties acting as a scavenger for ROS and RNS, respectively) (Prinsloo et al., 2013; Malan et al., 2016). Previous work indicated that the midgut and salivary glands of O. turicata are nitrosative and oxidative environments, respectively (Bourret et al., 2019). Expression of two putative dual oxidase (duox1 and duox2) genes in midgut tissue from O. turicata, and a single nitric oxide synthase (nos) gene, was expressed in salivary glands (Bourret et al., 2019). Immunofluorescent staining of O. turicata further validated transcriptional findings and determined the production of RNS in midguts and ROS in salivary glands (Bourret et al., 2019). Given these findings, determining a dual role of tick defensins in homeostasis and immunity is important for the development of control measures for these vectors and their respective pathogenic microbes.
Pathogens transmitted by Ornithodoros ticks have evolved to colonize this long-lived vector that completes blood feeding within minutes of attachment to the host. Vector competence studies in relapsing fever spirochete and ASFV models demonstrated persistent colonization of Ornithodoros midguts, and within ~10–20 days the pathogens colonize the salivary glands (Hess et al., 1987; Schwan and Hinnebusch, 1998; Boyle et al., 2014; Krishnavajhala et al., 2017). Once colonized, the tick remains infected for years (Davis, 1943; Hess et al., 1987). Consequently, the tick immune response likely plays a role in early pathogen colonization after blood feeding and during persistent infection in post-molt ticks.
The expression kinetics of otdA, otdB, otdC, and otdD suggest functional roles of the proteins in early and persistent colonization, and our hypothesized model is shown in Figure 5. For example, otdA and otdC were significantly up-regulated in the midgut within a week after blood feeding, which suggests the proteins function in homeostasis and during early pathogen colonization. In the midgut of post-molt ticks, the up-regulation of otdD suggests the protein may function in maintaining pathogen load during persistent colonization.
Figure 5
Our study also evaluated defensin expression in salivary glands, which is an important tissue for pathogen maintenance and transmission. In these tissues, otdC was expressed in post-molt ticks and up-regulated within a week after blood feeding. We hypothesize that this gene may function in tick immunity during early microbe colonization of the salivary glands (Figure 5). Furthermore, persistent infection may be characterized by the up-regulation of otdB and otdD. While these genes were expressed 1 week after blood feeding, they were up-regulated after O. turicata molted.
With very little work focused on soft tick immunity and defensins, our study provides a basis to further define the molecular mechanisms of vector competence. While we assessed expression kinetics of four novel defensins in late stage O. turicata nymphs, additional studies should confirm expression at different tick life stages. Additionally, given that relapsing fever spirochetes and ASFV are transmitted transovarially, assessment of defensin expression in reproductive organs is an important aspect of vector biology and pathogenesis. Future work will also focus on the validation of our transcriptional findings at the protein level. We will also assess the bactericidal properties of the identified putative defensins on relapsing fever spirochetes and determine whether the pathogens have evolved mechanisms to modulate tick immunity. These studies will provide critical insight into the maintenance of pathogens in an understudied tick vector.
Statements
Data availability statement
The datasets generated for this study can be found in the Genbank database with the following accession numbers: otdA (MN725028), otdB (MN725029), otdC (MN725030), and otdD (MN725031).
Ethics statement
Tick feedings were performed with mice in accordance with the Institutional Care and Use Committee (IACUC) at Baylor College of Medicine under protocol number AN-6563. The animal program at Baylor College of Medicine is compliant with standards and guidance established by the Association for the Assessment and Accreditation of Laboratory Animal Care and the Nation Institution of Health of Laboratory Animal Welfare. The animal husbandry team at Baylor College of Medicine provided all veterinary staff and animal care.
Author contributions
BA designed the study, performed experiments, analyzed data, and wrote the manuscript. ARK performed the experiments and data analysis. RM performed the phylogenetic analysis and wrote the phylogenetic analysis. AK performed experiments and assisted in data analysis. PT provided samples and provided experimental critique. AP contributed to phylogenetic analysis. JL designed the study, analyzed the data, and wrote the manuscript.
Funding
These studies were supported by AI123651 and AI137412 (JL) and Baylor College of Medicine Junior Faculty Seed Grant (JL).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
AltschulS. F.GishW.MillerW.MyersE. W.LipmanD. J. (1990). Basic local alignment search tool. J. Mol. Biol. 215, 403–410. 10.1016/S0022-2836(05)80360-2
2
AssousM. V.WilamowskiA. (2009). Relapsing fever borreliosis in Eurasia–forgotten, but certainly not gone!Clin. Microbiol. Infect. 15, 407–414. 10.1111/j.1469-0691.2009.02767.x
3
BalashovY. S. (1972). Bloodsucking ticks (Ixodoidea)- vectors of diseases of man and animals. Misc. Publ. Entomol. Soc. Am. 8, 161–376.
4
BissettJ. D.LedetS.KrishnavajhalaA.ArmstrongB. A.KliouevaA.SextonC.et al. (2018). Detection of tickborne relapsing fever spirochete, Austin, Texas, USA. Emerg. Infect. Dis. 24, 2003–2009. 10.3201/eid2411.172033
5
BoulangerN.BuletP.LowenbergerC. (2006). Antimicrobial peptides in the interactions between insects and flagellate parasites. Trends Parasitol.22, 262–268. 10.1016/j.pt.2006.04.003
6
BourretT. J.BoyleW. K.ZaludA. K.ValenzuelaJ. G.OliveiraF.LopezJ. E. (2019). The relapsing fever spirochete Borrelia turicatae persists in the highly oxidative environment of its soft-bodied tick vector. Cell Microbiol. 21:e12987. 10.1111/cmi.12987
7
BoyleW. K.WilderH. K.LawrenceA. M.LopezJ. E. (2014). Transmission dynamics of Borrelia turicatae from the arthropod vector. PLoS Negl. Trop. Dis. 8:e2767. 10.1371/journal.pntd.0002767
8
BuletP.StöcklinR. (2005). Insect antimicrobial peptides structures, properties and gene regulation. Protein. Pept. Lett. 12, 3–11. 10.2174/0929866053406011
9
ChristensenA. M.PietralczykE.LopezJ. E.BrooksC.SchrieferM. E.WozniakE.et al. (2017). Diagnosis and management of Borrelia turicatae infection in febrile soldier, Texas, USA. Emerg. Infect. Dis. 23, 883–884. 10.3201/eid2305.162069
10
ChrudimskaT.CerovskyV.SlaninovaJ.RegoR. O.GrubhofferL. (2014). Defensin from the ornate sheep tick Dermacentor marginatus and its effect on Lyme borreliosis spirochetes. Dev. Comp. Immunol. 46, 165–170. 10.1016/j.dci.2014.04.005
11
ChrudimskaT.ChrudimskyT.GolovchenkoM.RudenkoN.GrubhofferL. (2010). New defensins from hard and soft ticks: similarities, differences, and phylogenetic analyses. Vet. Parasitol. 167, 298–303. 10.1016/j.vetpar.2009.09.032
12
CooleyR. A.KohlsG. M. (1944). The Agarasidae of North America, Central America, and Cuba. Notre Dame, IN: The University Press.
13
DavisG. E. (1939). Ornithodoros parkeri: distribution and host data; spontaneous infection with relapsing fever spirochetes. Pub. Health Rep. 54, 1345–1349. 10.2307/4582963
14
DavisG. E. (1943). Relapsing fever: the tick Ornithodoros turicata as a spirochetal reservoir. Pub. Health Rep. 58, 839–842. 10.2307/4584474
15
DonaldsonT. G.Perez De LeonA. A.LiA. I.Castro-ArellanoI.WozniakE.BoyleW. K.et al. (2016). Assessment of the geographic distribution of Ornithodoros turicata (Argasidae): climate variation and host diversity. PLoS Negl. Trop. Dis. 10:e0004383. 10.1371/journal.pntd.0004383
16
DressA. W. M.FlammC.FritzschG.GrünewaldS.KruspeM.ProhaskaS. J.et al. (2008). Noisy: identification of problematic columns in multiple sequence alignments. Algorithms Mol. Biol.3:7. 10.1186/1748-7188-3-7
17
DuckertP.BrunakS.BlomN. (2004). Prediction of proprotein convertase cleavage sites. Protein Eng. Des. Sel. 17, 107–112. 10.1093/protein/gzh013
18
DworkinM. S.SchwanT. G.AndersonD. E. (2002). Tick-borne relapsing fever in North America. Med. Clin. North Amer. 86, 417–433. 10.1016/S0025-7125(03)00095-6
19
EdgarR. C. (2004). MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res. 32, 1792–1797. 10.1093/nar/gkh340
20
FogaçaA. C.AlmeidaI. C.EberlinM. N.TanakaA. S.BuletP.DaffreS. (2006). Ixodidin, a novel antimicrobial peptide from the hemocytes of the cattle tick Boophilus microplus with inhibitory activity against serine proteinases. Peptides27, 667–674. 10.1016/j.peptides.2005.07.013
21
GrubhofferL.KovárV.RudenkoN. (2004). Tick lectins: structural and functional properties. Parasitology129, S113–S125. 10.1017/S0031182004004858
22
GrunclováL.FouquierH.HypšaV.KopáčekP. (2003). Lysozyme from the gut of the soft tick Ornithodoros moubata: the sequence, phylogeny and post-feeding regulation. Dev. Comp. Immunol.27, 651–660. 10.1016/S0145-305X(03)00052-1
23
GuexN.PeitschM. C. (1997). SWISS-MODEL and the Swiss-Pdb Viewer: an environment for comparative protein modeling. Electrophoresis18, 2714–2723. 10.1002/elps.1150181505
24
HajdusekO.SimaR.AyllonN.JaloveckaM.PernerJ.De La FuenteJ.et al. (2013). Interaction of the tick immune system with transmitted pathogens. Front. Cell. Infect. Microbiol. 3:26. 10.3389/fcimb.2013.00026
25
HessW. R.EndrisR. G.HaslettT. M.MonahanM. J.MccoyJ. P. (1987). Potential arthropod vectors of African swine fever virus in North America and the Caribbean basin. Vet. Parasitol. 26, 145–155. 10.1016/0304-4017(87)90084-7
26
HosakaM.NagahamaM.KimW. S.WatanabeT.HatsuzawaK.IkemizuJ.et al. (1991). Arg-X-Lys/Arg-Arg motif as a signal for precursor cleavage catalyzed by furin within the constitutive secretory pathway. J. Biol. Chem.266, 12127–12130.
27
HynesW. L. (2014). How ticks control microbes, in Biology of Ticks, eds SonenshineD. E.RoeR. M. (New York, NY: Oxford University Press), 129–146.
28
IsogaiE.IsogaiH.OkumuraK.HoriH.TsurutaH.KurebayashiY. (2011). Tertiary structure-related activity of tick defensin (persulcatusin) in the taiga tick, Ixodes persulcatus. Exp. Appl. Acarol. 53, 71–77. 10.1007/s10493-010-9379-3
29
KimH. J.FilatovS.LopezJ. E.PerezD. E. L. A. A.TeelP. D. (2017). Blood feeding of Ornithodoros turicata larvae using an artificial membrane system. Med. Vet. Entomol. 31, 230–233. 10.1111/mve.12223
30
KopáčekP.HajdušekO.BurešováV.DaffreS. (2010). Tick innate immunity, in Invertebrate Immunity, eds SöderhällK. (Springer Science+Business Media, LLC), 137–162. 10.1007/978-1-4419-8059-5_8
31
KrishnavajhalaA.ArmstrongB. A.LopezJ. E. (2018). Vector competence of geographical populations of Ornithodoros turicata for the tick-borne relapsing fever spirochete Borrelia turicatae. Appl. Environ. Microbiol. 84:18. 10.1128/AEM.01505-18
32
KrishnavajhalaA.WilderH. K.BoyleW. K.DamaniaA.ThorntonJ. A.Perez De LeonA. A.et al. (2017). Imaging of Borrelia turicatae producing the green fluorescent protein reveals persistent colonization of the Ornithodoros turicata midgut and salivary glands from nymphal acquisition through transmission. Appl. Environ. Microbiol. 83:16. 10.1128/AEM.02503-16
33
KumarS.StecherG.LiM.KnyazC.TamuraK. (2018). MEGA X: molecular evolutionary genetics analysis across computing platforms. Mol. Biol. Evol. 35, 1547–1549. 10.1093/molbev/msy096
34
LaiR.TakeuchiH.LomasL. O.JonczyJ.RigdenD. J.ReesH. H.et al. (2004). A new type of antimicrobial protein with multiple histidines from the hard tick, Amblyomma hebraeum. Faseb J18, 1447–1459. 10.1096/fj.03-1154fje
35
LaneR. S.BurgdorferW.HayesS. F.BarbourA. G. (1985). Isolation of a spirochete from the soft tick, Ornithodoros coriaceus: a possible agent of epizootic bovine abortion. Science230, 85–87. 10.1126/science.3898367
36
LemoineF.Domelevo EntfellnerJ. B.WilkinsonE.CorreiaD.Dávila FelipeM.De OliveiraT.et al. (2018). Renewing Felsenstein's phylogenetic bootstrap in the era of big data. Nature556, 452–456. 10.1038/s41586-018-0043-0
37
LiuZ.LiuH.LiuX.WuX. (2008). Purification and cloning of a novel antimicrobial peptide from salivary glands of the hard tick, Ixodes sinensis. Comp. Biochem. Physiol. B. Biochem. Mol. Biol.149, 557–561. 10.1016/j.cbpb.2007.10.002
38
LopezJ. E.KrishnavahjalaA.GarciaM. N.BermudezS. E. (2016). Tick-borne relapsing fever spirochetes in the Americas. Vet. Sci. 3, 1–18. 10.3390/vetsci3030016
39
LopezJ. E.MccoyB. N.KrajacichB. J.SchwanT. G. (2011). Acquisition and subsequent transmission of Borrelia hermsii by the soft tick Ornithodoros hermsi. J. Med. Entomol. 48, 891–895. 10.1603/ME10283
40
LopezJ. E.WilderH. K.HargroveR.BrooksC. P.PetersonK. E.BeareP. A.et al. (2013). Development of genetic system to inactivate a Borrelia turicatae surface protein selectively produced within the salivary glands of the arthropod vector. PLoS Negl. Trop. Dis. 7:e2514. 10.1371/journal.pntd.0002514
41
MalanM.SeremJ. C.BesterM. J.NeitzA. W.GasparA. R. (2016). Anti-inflammatory and anti-endotoxin properties of peptides derived from the carboxy-terminal region of a defensin from the tick Ornithodoros savignyi. J. Pept. Sci.22, 43–51. 10.1002/psc.2838
42
NakajimaY.IshibashiJ.YukuhiroF.AsaokaA.TaylorD.YamakawaM. (2003a). Antibacterial activity and mechanism of action of tick defensin against Gram-positive bacteria. Biochim. Biophys. Acta. 1624, 125–130. 10.1016/j.bbagen.2003.10.004
43
NakajimaY.OgiharaK.TaylorD.YamakawaM. (2003b). Antibacterial hemoglobin fragments from the midgut of the soft tick, Ornithodoros moubata (Acari: Argasidae). J. Med. Entomol. 40, 78–81. 10.1603/0022-2585-40.1.78
44
NakajimaY.TaylorD.YamakawaM. (2002a). Involvement of antibacterial peptide defensin in tick midgut defense. Exp. Appl. Acarol. 28, 135–140. 10.1023/A:1025399610947
45
NakajimaY.Van Der Goes Van Naters-YasuiA.TaylorD.YamakawaM. (2001). Two isoforms of a member of the arthropod defensin family from the soft tick, Ornithodoros moubata (Acari: Argasidae). Insect. Biochem. Mol. Biol. 31, 747–751. 10.1016/S0965-1748(01)00066-2
46
NakajimaY.Van Der Goes Van Naters-YasuiA.TaylorD.YamakawaM. (2002b). Antibacterial peptide defensin is involved in midgut immunity of the soft tick, Ornithodoros moubata. Insect Mol. Biol. 11, 611–618. 10.1046/j.1365-2583.2002.00372.x
47
NietoN. C.TeglasM. B.StewartK. M.WasleyT.WolffP. L. (2012). Detection of relapsing fever spirochetes (Borrelia hermsii and Borrelia coriaceae) in free-ranging mule deer (Odocoileus hemionus) from Nevada, United States. Vector Borne Zoonotic Dis.12, 99–105. 10.1089/vbz.2011.0716
48
Oliva ChavezA. S.ShawD. K.MunderlohU. G.PedraJ. H. (2017). Tick humoral responses: marching to the beat of a different drummer. Front. Microbiol. 8:e223. 10.3389/fmicb.2017.00223
49
PriceM. N.DehalP. S.ArkinA. P. (2009). FastTree: computing large minimum evolution trees with profiles instead of a distance matrix. Mol Biol Evol26, 1641–1650. 10.1093/molbev/msp077
50
PriceM. N.DehalP. S.ArkinA. P. (2010). FastTree 2–approximately maximum-likelihood trees for large alignments. PLoS ONE5:e9490. 10.1371/journal.pone.0009490
51
PrinslooL.NaidooA.SeremJ.TauteH.SayedY.BesterM.et al. (2013). Structural and functional characterization of peptides derived from the carboxy-terminal region of a defensin from the tick Ornithodoros savignyi. J. Pept. Sci.19, 325–332. 10.1002/psc.2505
52
Rodríguez-GarcíaM. J.García-ReinaA.MachadoV.GaliánJ. (2016). Identification, structural characterisation and expression analysis of a defensin gene from the tiger beetle Calomera littoralis (Coleoptera: Cicindelidae). Gene589:30. 10.1016/j.gene.2016.05.030
53
SageK. M.JohnsonT. L.TeglasM. B.NietoN. C.SchwanT. G. (2017). Ecological niche modeling and distribution of Ornithodoros hermsi associated with tick-borne relapsing fever in western North America. PLoS Negl. Trop. Dis. 11:e6047. 10.1371/journal.pntd.0006047
54
SchwanT. G. (1996). Ticks and Borrelia: model systems for investigating pathogen-arthropod interactions. Infect. Agents Dis. 5, 167–181.
55
SchwanT. G.HinnebuschB. J. (1998). Bloodstream- versus tick-associated variants of a relapsing fever bacterium. Science280, 1938–1940. 10.1126/science.280.5371.1938
56
SilvaF. D.RezendeC. A.RossiD. C. P.EstevesE.DyszyF. H.SchreierS.et al. (2009). Structure and mode of action of microplusin, a copper II-chelating antimicrobial peptide from the cattle tick Rhipicephalus (Boophilus) microplus. J. Biol. Chem.284, 34735–34746. 10.1074/jbc.M109.016410
57
SonenshineD. E.CeraulS. M.HynesW. E.MacalusoK. R.AzadA. F. (2002). Expression of defensin-like peptides in tick hemolymph and midgut in response to challenge with Borrelia burgdorferi, Escherichia coli, and Bacillus subtilis. Exp. Appl. Acarol. 28, 127–134. 10.1023/A:1025354326877
58
SonenshineD. E.HynesW. L. (2008). Molecular characterization and related aspects of the innate immune response in ticks. Front. Biosci. 13, 7046–7063. 10.2741/3209
59
SonenshineD. E.HynesW. L.CeraulS. M.MitchellR.BenzineT. (2005). Host blood proteins and peptides in the midgut of the tick Dermacentor variabilis contribute to bacterial control. Exp. Appl. Acarol. 36, 207–223. 10.1007/s10493-005-2564-0
60
SonenshineD. E.MacalusoK. R. (2017). Microbial invasion vs. tick immune regulation. Front. Cell. Infect. Microbiol. 7:e390. 10.3389/fcimb.2017.00390
61
TonkM.Cabezas-CruzA.ValdésJ. J.RegoR. O. M.ChrudimskáT.StrnadM.et al. (2014). Defensins from the tick Ixodes scapularis are effective against phytopathogenic fungi and the human bacterial pathogen Listeria grayi. Parasit. Vectors. 7, 554–554. 10.1186/s13071-014-0554-y
62
Van Der Goes Van Naters-YasuiA.TaylorD.ShonoT.YamakawaM. (1999). Purification and partial amino acid sequence of antibacterial peptides from the hemolymph of the soft tick, Ornithodoros moubata, (Acari: Argasidae), in Proceedings of the Third International Conference on Ticks and Tick-borne Pathogens: Into the 21st Century, eds KazimirovaM.LabudaM.NutallP.A. (Institute of Zoology, Slovak Academy of Sciences), 189–194.
63
WebbB.SaliA. (2016). Comparative protein structure modeling using MODELLER. Curr. Protoc. Protein Sci. 86, 291–297. 10.1002/cpps.20
64
WiedersteinM.SipplM. J. (2007). ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res. 35, W407–W410. 10.1093/nar/gkm290
65
ZimmermannL.StephensA.NamS.-Z.RauD.KüblerJ.LozajicM.et al. (2018). A completely reimplemented MPI bioinformatics toolkit with a new HHpred server at its core. J. Mol. Biol. 430, 2237–2243. 10.1016/j.jmb.2017.12.007
Summary
Keywords
Ornithdoros turicata, antimicrobial peptide (AMP), gene expression, defensins, argasid (soft) ticks, immune response
Citation
Armstrong BA, Kneubehl AR, Mitchell III RD, Krishnavajhala A, Teel PD, Pérez de León AA and Lopez JE (2020) Differential Expression of Putative Ornithodoros turicata Defensins Mediated by Tick Feeding. Front. Cell. Infect. Microbiol. 10:152. doi: 10.3389/fcimb.2020.00152
Received
10 December 2019
Accepted
23 March 2020
Published
05 May 2020
Volume
10 - 2020
Edited by
Emily Derbyshire, Duke University, United States
Reviewed by
Iris Bruchhaus, Bernhard Nocht Institute for Tropical Medicine (BMITM), Germany; Galadriel Hovel-Miner, George Washington University, United States
Updates
Copyright
© 2020 Armstrong, Kneubehl, Mitchell, Krishnavajhala, Teel, Pérez de León and Lopez.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Job E. Lopez job.lopez@bcm.edu
This article was submitted to Parasite and Host, a section of the journal Frontiers in Cellular and Infection Microbiology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.