Abstract
The extracellular matrix (ECM) is important in cardiac remodeling and syndecans have gained increased interest in this process due to their ability to convert changes in the ECM to cell signaling. In particular, syndecan-4 has been shown to be important for cardiac remodeling, whereas the role of its close relative syndecan-2 is largely unknown in the heart. To get more insight into the role of syndecan-2, we here sought to identify interaction partners of syndecan-2 in rat left ventricle. By using three different affinity purification methods combined with mass spectrometry (MS) analysis, we identified 30 novel partners and 9 partners previously described in the literature, which together make up the first cardiac syndecan-2 interactome. Eleven of the novel partners were also verified in HEK293 cells (i.e., AP2A2, CAVIN2, DDX19A, EIF4E, JPH2, MYL12A, NSF, PFDN2, PSMC5, PSMD11, and RRAD). The cardiac syndecan-2 interactome partners formed connections to each other and grouped into clusters mainly involved in cytoskeletal remodeling and protein metabolism, but also into a cluster consisting of a family of novel syndecan-2 interaction partners, the CAVINs. MS analyses revealed that although syndecan-2 was significantly enriched in fibroblast fractions, most of its partners were present in both cardiomyocytes and fibroblasts. Finally, a comparison of the cardiac syndecan-2 and -4 interactomes revealed surprisingly few protein partners in common.
Introduction
To cope with injury and mechanical stress, the heart can change its shape and function, a process associated with alterations of the extracellular matrix (ECM) and progression toward heart failure (Cohn et al., 2000). At the cellular level, this includes hypertrophy or death of cardiomyocytes and activation of fibroblasts to ECM producing myofibroblasts, which manifests itself as hypertrophy of the myocardium and stiffening through fibrosis (Cohn et al., 2000). Proteoglycans are emerging as important players in ECM remodeling in the heart, including members of the syndecan family (Christensen et al., 2019). Syndecan-4 has been shown to be a pro-remodeling molecule, acting in both cardiomyocytes and fibroblasts (Finsen et al., 2011; Herum et al., 2015). Knock-out of syndecan-4 in mice has been shown to hinder development of pressure overload induced hypertrophy and stiffening of the myocardium through the calcineurin-NFAT pathway and collagen crosslinking (Finsen et al., 2011; Herum et al., 2013; Herum et al., 2015). Although syndecan-4 has been identified as an important signaling mediator, little is known about its close relative, syndecan-2 in the heart. Both syndecan-2 and -4 are expressed in the heart and upregulated following aortic banding (Strand et al., 2013).
The vertebrate syndecan family arose as a result of two rounds of gene duplication, resulting in four family members where syndecan-2 and -4 form one subfamily (Chakravarti and Adams, 2006). While syndecan-4 is ubiquitously expressed, syndecan-2 is primarily expressed in cells from mesenchymal origin, including fibroblasts, endothelial and neuronal cells and is upregulated during development (David et al., 1993; Kim et al., 1994; Ethell and Yamaguchi, 1999; Chen E. et al., 2004). However, syndecan-2 expression has also been observed in cardiomyocytes (Balza and Misra, 2006). Syndecan-2 has been implicated in diverse cellular events, including highly dynamic processes such as angiogenesis and cancer metastasis, but also in formation of mature structures like dendritic spines and control of ECM assembly, all of which appear to require the intact cytoplasmic domain (Ethell and Yamaguchi, 1999; Klass et al., 2000; Chen E. et al., 2004; Essner et al., 2006; Lee et al., 2011; Lim and Couchman, 2014). Its cytoplasmic tail is short, can be subdivided into three regions and has no known intrinsic enzymatic activity, but can connect to multiple proteins (Couchman, 2010). The membrane proximal C1 region can connect to ezrin, which associates with the actin cytoskeleton (Granes et al., 2000). The membrane distal C2 region binds PDZ domain proteins and is mainly involved in intracellular trafficking (Ethell et al., 2000; Zimmermann et al., 2005). The C1 and C2 regions are in common, whereas the middle V (variable) region is unique to each of the syndecans and is probably responsible for syndecan specific signaling (Couchman et al., 2015).
To better understand the role of syndecan-2 in the heart, we here aimed to identify cytoplasmic interaction partners of syndecan-2 in rat left ventricle (LV) and to construct the cardiac syndecan-2 interactome.
Results
Combining Three Affinity Purification Approaches to Capture Syndecan-2 Interaction Partners
We identified putative syndecan-2 interaction partners from rat LV lysates by combining three AP approaches with MS. Figure 1A depicts the experimental design, emphasizing the three different baits and respective controls (bottom of the boxes). The left panel (i) shows biotinylated peptides of the syndecan-2 cytoplasmic domain (SDC2cyt) used as bait to pull down interaction partners by streptavidin coated beads. An ahx linker was inserted in between the biotin-tag and the syndecan-2 cytoplasmic sequence to avoid steric hindrance (Figure 1B, upper sequence). A scrambled syndecan-2 peptide (scram) (Figure 1B, lower sequence) and beads without peptides (beads only) were used as negative controls. The middle panel of Figure 1A, (ii), illustrates IP with anti-syndecan-2 (anti-SDC2) where endogenous syndecan-2 was used as bait. Specificity of the antibody was demonstrated by overlaying anti-SDC2 onto membranes with spot-synthesized 20-mer overlapping peptides, which covered the protein sequence of either mouse, rat or human syndecan-2 or rat syndecan-4. This revealed an ectodomain epitope in syndecan-2 across species, which left the cytoplasmic tail free to interact with protein partners (Figure 1C). Importantly, the antibody only recognized syndecan-2 and showed no cross reactivity toward rat syndecan-4 (Figure 1C, lower panel). Anti-SDC2 was also demonstrated to be able to precipitate endogenous syndecan-2 from rat LV lysates (Figure 1D). The right panel of Figure 1A, (iii), illustrates IP-GST where a recombinant N-terminal GST-tagged full-length syndecan-2 protein (GST-SDC2) was used as bait to capture interaction partners. Recombinant GST without syndecan-2 and beads were used as negative controls. The GST antibody was demonstrated to precipitate GST-SDC2 in rat LV lysates prior to the large AP-MS analysis (Figure 1E). Following the three different APs, the precipitated interaction partners were subjected to trypsin digestion and subsequent MS analysis (Figure 1A, bottom part).
FIGURE 1
Identification of 30 Novel Syndecan-2 Interaction Partners
All APs were done in biological triplicates. To be considered as a syndecan-2 interaction partner, proteins had to be identified in IP-SDC2 (Figure 2 peach colored circle) and additionally in either IP-GST (Figure 2 dark green circle) or pull down with SDC2cyt (Figure 2 light green circle). Proteins known to be confined in the nucleus, ribosome and mitochondria were excluded since they were regarded as contaminants. Overall, 30 novel syndecan-2 interaction partners were identified by AP-MS with these criteria (hereafter referred to as MS partners) and are listed in Table 1 (detailed overview in Supplementary Table S1). Table 2 summarizes syndecan-2 protein interaction partners described in the literature across tissues and species (hereafter referred to as literature partners). Importantly, both the literature partners cortactin (CTTN) and syntenin-1 (SDCBP) were identified in either two or three of the AP-MS approaches (underlined in Figure 2 and in Tables 1, 2). In addition, seven literature partners were identified by fishing with the SDC2cyt peptide or GST-SDC2 in the LV lysate. These were the cell division control protein 42 homolog (CDC42), band 4.1-like protein 1 (EPB41L1), ezrin (EZR), β1 integrin (ITGB1), matrix metalloproteinase-2 (MMP2), matrix metalloproteinase-9 (MMP9) and ras-related C3 botulinum toxin substrate 1 (RAC1) (underlined in Figure 2 and Table 2, n = 3).
FIGURE 2
TABLE 1
| Gene | Protein (Uniprot) | AP-MS (n = 3) | Molecular function (HPRD) |
| AP2A2(a) FB | AP-2 complex subunit alpha-2 | IP-SDC2, GST-SDC2 | Transporter activity |
| CAVIN1/PTRFCM | Caveolae-associated protein 1 | IP-SDC2, SDC2cyt | Transcription regulator activity |
| CAVIN2/SDPR(a) FB | Caveolae-associated protein 2 | IP-SDC2, SDC2cyt | Serine-type peptidase activity |
| CAVIN4/MURCCM | Caveolae-associated protein 4 | IP-SDC2, SDC2cyt | Unknown |
| CDC42BPB/MRCKβ | Serine/threonine-protein kinase MRCK beta | IP-SDC2, SDC2cyt | Protein serine/threonine kinase activity |
| CTTN(a) FB | Src substrate cortactin | IP-SDC2, SDC2cyt | Cytoskeletal protein binding |
| DDX19A(a) | ATP-dependent RNA helicase DDX19A | IP-SDC2, GST-SDC2 | Unknown |
| DUSP3 | Dual-specificity phosphatase 3 | IP-SDC2, GST-SDC2 | Protein tyrosine/serine/threonine phosphatase activity |
| EIF4E(a) | Eukaryotic translation initiation factor 4E | IP-SDC2, GST-SDC2, SDC2cyt | Translation regulator activity |
| EIF4G3 | Eukaryotic translation initiation factor 4 gamma, 3 | IP-SDC2, GST-SDC2 | Translation regulator activity |
| GPHNCM | Gephyrin | IP-SDC2, SDC2cyt | Unknown |
| JPH2(a) CM | Junctophilin-2 | IP-SDC2, SDC2cyt | Cell adhesion molecule activity |
| NHLRC1(b) | E3 ubiquitin-protein ligase NHLRC1 | IP-SDC2, GST-SDC2 | Ubiquitin-specific protease activity |
| MYL12A(a) CM | Myosin regulatory light chain 12A | IP-SDC2, SDC2cyt | Calcium ion binding |
| NSF(a) | Vesicle-fusing ATPase | IP-SDC2, SDC2cyt | ATPase activity |
| PABPC4CM | Polyadenylate-binding protein 4 | IP-SDC2, GST-SDC2 | RNA binding |
| PFDN2(a) | Prefoldin subunit 2 | IP-SDC2, GST-SDC2, SDC2cyt | Chaperone activity |
| PHACTR2(b) | Phosphatase and actin regulator 2 | IP-SDC2, GST-SDC2 | Phosphatase regulator activity |
| PLECCM | Plectin | IP-SDC2, GST-SDC2 | Cytoskeletal anchoring activity |
| PPP2CACM | Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform | IP-SDC2, GST-SDC2 | Protein serine/threonine phosphatase activity |
| PRPSAP2CM | Phosphoribosyl pyrophosphate synthase-associated protein 2 | IP-SDC2, GST-SDC2 | Unknown |
| PSMC5(a) CM | 26S protease regulatory subunit 8 | IP-SDC2, SDC2cyt | Ubiquitin-specific protease activity |
| PSMD11(a) | 26S proteasome non-ATPase regulatory subunit 11 | IP-SDC2, SDC2cyt | Ubiquitin-specific protease activity |
| REEP5 | Receptor expression-enhancing protein 5 | IP-SDC2, GST-SDC2 | Unknown |
| RRAD(a,b) | GTP-binding protein RAD | IP-SDC2, SDC2cyt | GTPase activity |
| SDCBP(a) CM | Syntenin-1 | IP-SDC2, GST-SDC2, SDC2cyt | Receptor signaling complex scaffold activity |
| SNRPD2 | Small nuclear ribonucleoprotein Sm D2 | IP-SDC2, SDC2cyt | RNA binding |
| SPHKAP | A-kinase anchor protein SPHKAP | IP-SDC2, GST-SDC2 | Unknown |
| SPTBN2 | Spectrin beta chain, non-erythrocytic 2 | IP-SDC2, GST-SDC2 | Cytoskeletal protein binding |
| TJP1/ZO-1CM | Tight junction protein ZO-1 | IP-SDC2, SDC2cyt | Cell adhesion molecule activity |
| TRIM21(b) | E3 ubiquitin-protein ligase TRIM21 | IP-SDC2, GST-SDC2 | Ribonucleoprotein |
| UBAP2l | Ubiquitin-associated protein 2-like | IP-SDC2, GST-SDC2 | Unknown |
Thirty novel syndecan-2 interaction partners identified by AP-MS.
(a)Precipitated also HA-SDC2 in HEK293 cells. (b)Not found in rat neonatal cardiomyocytes or fibroblasts by MS analyses. CMEnriched in rat neonatal cardiomyocytes. FBEnriched in rat neonatal fibroblasts. Underlined proteins have previously been described in the literature.
TABLE 2
| Gene | Protein | Where in SDC2 | Evidencec | Biological role | Reference | AP-MSb |
| ARHGAP35CM | Rho GTPase-activating protein 35/p190ARhoGAP | Functional interaction | Actin cytoskeletal organization (SDC2 might control localization of p190RhoGAP) | Lim and Couchman, 2014 | ||
| CASK | Peripheral plasma membrane protein CASK | C2 (motif: EFYA) Direct | Peptide binding assays, Y2H and co-localization | Link to actin cytoskeleton and protein 4.1 | Cohen et al., 1998; Hsueh et al., 1998 | |
| CAV2 | Caveolin-2 | Co-IP | Regulation of adhesion. SDC2 might also be in complex with CAV1 (Shi et al., 2013) | Huang and Chuang, 2006; Lim et al., 2015 | ||
| CDC42CM | Cell division control protein 42 homolog | Cooperative interaction Cell adhesion studies | Filopodia formation in fibroblasts | Granes et al., 1999 | IP-GST | |
| CDH1 | Cadherin-1/E-cadherin | Functional interaction | SDC2 promote E-cadherin shedding probably by MMP7 | Jang et al., 2016 | ||
| CTTN | Cortactin | C1 (Motif: RMKKKDEGSY) Indirect | Affinity chromatography | Cortical actin organization | Kinnunen et al., 1998; Halden et al., 2004 | IP-SDC2, SDC2cyt |
| IL8/CXCL8 | Interleukin-8 | HS chains and possibly ectodomain | Co-IP, isothermal titration | Inflammation signaling | Halden et al., 2004 | |
| CXCR2 | C-X-C chemokine receptor type 2 | Co-IP, co-localization | After stimulation CXCR2 and SDC2 co-localize | Renga et al., 2012 | ||
| DNM2 | Dynamin-2 | C1 Indirect | Co-IP, Y2H, pull down | Yoo et al., 2005 | ||
| EPB41L1 | Band 4.1-like protein 1/Protein 4.1N | Cytoplasmic domain | Pull down | Formation of quaternary complex InsP3R1–4.1N–CASK–SDC2 in brain | Maximov et al., 2003 | SDC2cyt |
| EPHB2 | EphB2 receptor tyrosine kinase/Ephrin type-B receptor 2 | C1 + V region Direct | Co-IP, phosphorylation assay, co-localization | Phosphorylation on Y179 and Y191 (human numbering) Phosphorylation causes SDC2 clustering and is important for dendritic spine maturation | Ethell et al., 2001 | |
| EZRCM | Ezrin | C1 (motif: DEGSYD) Direct | Co-IP, pull-down with peptides, co-localization, triton resistant complex | Link to actin cytoskeleton Interaction enhanced by RhoA | Granes et al., 2000; Granés et al., 2003 | IP-GST |
| FYN | Fyn | C1 | Affinity chromatography | Protein complex in brain | Kinnunen et al., 1998 | |
| GIPC1 | Synectin/PDZ domain-containing protein GIPC | C2 | Y2H, Co-IP | Migration | Gao et al., 2000 | |
| ITGA2 | Integrin α2 | Cooperative interaction, cell adhesion experiments | Cancer migration | Choi et al., 2009 | ||
| ITGA5 | Integrin α5 | Cooperative interaction, cell adhesion experiments | Stress fiber formation in lung carcinoma cell line | Kusano et al., 2000 | ||
| ITGAL | Integrin alpha-L (LFA-1) | Cytoplasmic domain | Cooperative interaction | SDC2 regulates the activity conformation of ITGAL | Rovira-Clave et al., 2014 | |
| ITGAVCM | Integrin alpha-V | Cooperative interaction | Localization and virus entry | Cheshenko et al., 2007 | ||
| ITGB1 | Integrin β1 | Indirect ectodomain | Cooperative interaction, cell adhesion experiments | Adhesion | Kusano et al., 2000; Whiteford et al., 2007 | IP-GST |
| ITGB4 | Integrin β4 | C2 | Y2H | Cell spreading | Wang et al., 2010 | |
| ITPR1FB | Inositol 1,4,5-trisphosphate receptor type 1/InsP3R1 | Cyt domain Indirect | Pull down with SDC2 cytoplasmic peptides | Quaternary complex with SDC2-CASK-EPB41L1 in brain | Maximov et al., 2003 | |
| MMP2FB | Matrix metalloproteinase-2/72 kDa type IV collagenase | Direct? | Ability to shed from cell surface (MMP added to cells, cell lysate dot blotted) | Shedding | Fears et al., 2006 | IP-GST |
| MMP7 | Matrix metalloproteinase-7 | Direct, ectodomain | Co-IP, overlay assay | SDC2 might regulate processing of pro-MMP7 | Ryu et al., 2009 | |
| MMP9 | Matrix metalloproteinase-9 | Direct? | Ability to shed from cell surface | Shedding | Fears et al., 2006 | IP-GST |
| MMP14FB | Matrix metalloproteinase-14 | Direct | Cleavage analysis | Shedding of SDC2 by membrane anchored MMP14 | Lee et al., 2017 | |
| NF1 | Neurofibromin | Membrane proximal region of cytoplasmic domain Direct | Y2H, pull down, co-localization | Syndecans might localize neurofibromin to the membrane | Hsueh et al., 2001 | |
| NOTCH3 | Neurogenic locus notch homolog protein 3 | Co-IP | SDC2 might amplify notch signaling | Zhao et al., 2012 | ||
| PRKC –PRKCA –PRKCB –PRKCG | Protein kinase C | V region Direct | In vitro peptide phosphorylation studies, PKC inhibitor blocks phosphorylation | Phosphorylation on S187 and S188 (human numbering) | Prasthofer et al., 1995; Oh et al., 1997 | |
| PTPRJ | Protein tyrosine phosphatase receptor CD148/Receptor-type tyrosine-protein phosphatase eta | Membrane proximal region of shed SDC2 Direct | Solid-phase binding assay | Adhesion | Whiteford et al., 2011 | |
| RAC1 | Ras-related C3 botulinum toxin substrate 1 | Functional interaction, overexpression of SDC2 increase Rac1 activity in cancer cells | Cancer migration | Choi et al., 2010 | IP-GST | |
| RACK1/NB2L1 | Receptor of activated protein C kinase 1 | FL | Co-IP, affinity chromatography | Scaffolding and downstream signaling | Huang et al., 2005a, b; Renga et al., 2012 | |
| RASA1 | Ras GTPase-activating protein 1/P120-GAP | FL | Co-IP | Downstream signaling | Huang et al., 2005a | |
| SARM1 | Sarm1/Sterile alpha and TIR motif-containing protein 1 | Cytoplasmic domain Direct | Pull down, co-IP | Regulation of dendritic outgrowth | Chen et al., 2011 | |
| SDC2FB | Syndecan-2 | TM: GXXXG | Mutation studies | Oligomerization | Choi et al., 2005; Dews and Mackenzie, 2007 | IP-SDC2, IP-GST, SDC2cyt |
| SDC4 | Syndecan-4 | TM: GXXXG | Hetero-oligomerization | Choi et al., 2015 | ||
| SDCBP | Syntenin/syntenin-1 | C2 (motif: EFYA) Direct | Y2H, surface plasmon resonance, peptide binding assays and co-localization | Adaptor and intracellular trafficking | Grootjans et al., 1997 | IP-SDC2, IP-GST, SDC2cyt |
| SRC | Proto-oncogene tyrosine-protein kinase Src | C1 | Affinity purification | Protein complex in brain | Kinnunen et al., 1998 | |
| TGFBR1 | TGF-beta receptor type-1 (TβRI) | Co-IP, functional studies | SDC2 may attenuate TGF-β1 signaling by internalizing | Shi et al., 2013 | ||
| TGFBR3 | Transforming growth factor beta receptor type 3 (Betaglycan) | Cytoplasmic domain is needed | Co-IP | May be involved in fibrosis | Chen L. et al., 2004 | |
| TIAM1 | Tiam1 | C2 (EFYA) | Co-IP, fluorescence- and NMR-based binding assays | Cell migration | Shepherd et al., 2010 | |
| TRAPPC4/SBDN | Trafficking protein particle complex subunit 4/Synbindin | C2 (motif: EFYA) Direct | Co-IP, pull-down, ligand overlay, Y2H and co-localization | Vesicle trafficking (neurons, spine maturation) | Ethell et al., 2000 |
Protein interaction partners previously reported for syndecan-2 or a conserved syndecan motif across species and tissuea.
aCore-protein binders only, partners who bind exclusively to glycosaminoglycan (GAG) chains were excluded. bThis includes all three affinity purification methods (each in triplicates, p < 0.05). Pull down with SDC2 peptides is given as “SDC2cyt”. Expanded information is given in Supplementary Table S1. cFunctional and cooperative interactions refer to partners where there is no evidence of direct binding, but good evidence that the two molecules collaborate together. Previously scientists have referred to the syndecan-integrin interactions as cooperation and we have kept that nomenclature here. ns, not significant. CMEnriched in rat neonatal cardiomyocytes. FBEnriched in rat neonatal fibroblasts.
Verification of 11 Syndecan-2 Interaction Partners in HEK293 Cells
We decided to verify selected MS partners in additional binding studies using HEK293 cells and chose a set-up that reversed the strategy used for MS. Two syndecan-2 bands of approximately 30 (doublet) and 45 kDa were detected when HA-tagged syndecan-2 (HA-SDC2) was analyzed by immunoblotting (Figure 3A). The core domain of human syndecan-2 is predicted to approximately 23 kDa and is known to form SDS resistant dimers through the transmembrane domain. Eleven of the 30 MS partners were expressed with a FLAG-tag together with HA-SDC2 in HEK293 cells and subjected to IP-FLAG. Cortactin (CTTN) was included as a positive control and heat shock protein beta-6 (HSPB6) and serine/threonine-protein phosphatase PP1-alpha catalytic subunit (PPP1CA) were included as negative controls. The latter controls were included to ensure that protein precipitation was not due to simple overexpression. As expected, CTTN precipitated HA-SDC2 (Figure 3B), whereas the negative controls did not show specific binding (Figures 3C,D). The 11 MS partners that precipitated HA-SDC2 were AP-2 complex subunit alpha-2 (AP2A2), caveolae-associated protein 2 (CAVIN2), ATP-dependent RNA helicase DDX19A (DDX19A), eukaryotic translation initiation factor 4E (EIF4E), junctophilin-2 (JPH2), myosin regulatory light chain 12A (MYL12A), vesicle-fusing ATPase (NSF), prefoldin subunit 2 (PFDN2), 26S protease regulatory subunit 8 (PSMC5), 26S proteasome non-ATPase regulatory subunit 11 (PSMD11) and GTP-binding protein RAD (RRAD) (Figures 3E–O, respectively).
FIGURE 3
Overview of the Syndecan-2 Interactome
To get a more comprehensive overview of the syndecan-2 interactome, we combined the 30 novel MS partners (Table 1) together with the 41 literature partners identified in different tissues and species (Table 2) and grouped them according to the GO annotation biological process (Figure 4A). The MS partners (in green) distributed into several groups together with literature partners (Figure 4A), where the three largest were; cell communication, protein metabolism and cell growth and/or maintenance (Figure 4A). Within the three largest groups we also found the nine literature partners identified in our MS approach (Figure 4A underlined). We further performed a STRING database network analysis to predict connections among the 30 novel MS partners and the nine literature partners (Figure 4B). This revealed that the cardiac syndecan-2 interactome contained more connections than expected from a random set of proteins (PPI enrichment p-value: <0.000117, a list of all connections is given in Supplementary Table S2). Importantly, several of the novel MS partners connected with the literature partners and formed clusters (Figure 4B).
FIGURE 4
Functional Annotation of the Syndecan-2 Interactome
The syndecan-2 interactome was also subjected to a functional annotation analysis through the DAVID Bioinformatics Resources1. The disease-class enrichment database revealed “cancer” and “cardiovascular” to be the top most prevalent enriched disease classes (Table 3). In line with this, the Kyoto Encyclopedia of Genes and Genome (KEGG) enrichment analysis predicted “proteoglycans in cancer,” “focal adhesion,” “leukocyte transendothelial migration,” “regulation of actin cytoskeleton,” and “pathways in cancer” as the top five pathways, but also “VEGF signaling” and different “cardiomyopathies” were predicted (Table 4). The DAVID tool was also used to search for enriched protein domains in the syndecan-2 interactome through the PFAM database (Table 5). The two most significant enriched protein domains were “integrin alpha” and” FG-GAP repeat,” which is part of the propeller structure of integrin alpha subunits. The third most enriched protein domain group was the “putative peptidoglycan binding domain,” which included several metalloproteinases. Interestingly, the fourth most enriched protein domain group was the CAVIN family, which contained the three novel MS partners caveolae-associated protein 1 (CAVIN1/PTRF), caveolae-associated protein 2 (CAVIN2/SDPR) and caveolae-associated protein 4 (CAVIN4/MURC).
TABLE 3
| Term | Gene name | Count | p-value |
| CANCER | CXCL8, CXCR2, CDC42BPB, EPHB2, GIPC1, RASA1, SPHKAP, SRC, TIAM1, CDH1, CAV2, EZR, ITPR1, ITGA2, ITGAV, ITGB1, ITGB4, MMP14, MMP2, MMP7, MMP9, NF1, NOTCH3, PRKCA, PTPRJ, RAC1, RACK1, TGFBR1, TGFBR3, TRIM21 | 30 | 1.7 × 10–5 |
| CARDIOVASCULAR | CAVIN4/MURC, CXCL8, CXCR2, FYN, RASA1, ARHGAP35, SPHKAP, TIAM1, CAV2, GPHN, ITPR1, ITGA2, ITGAV, ITGB1, JPH2, MMP14, MMP2, MMP7, MMP9, NF1, NOTCH3, PHACTR2, PRKCB, RAC1, REEP5, SDC2, SDC4, TGFBR1, TGFBR3 | 29 | 2.0 × 10–2 |
The genetic disease-class database analysis of the syndecan-2 interactome, 81.7% annotated.
TABLE 4
| Term | Gene name | Count | p-value |
| Proteoglycans in cancer | CAV2, CDC42, CTTN, EZR, ITPR1, ITGA2, ITGA5, ITGAV, ITGB1, MMP2, MMP9, PRKCA, PRKCB, PRKCG, RAC1, SDC2, SDC4, SRC, TIAM1 | 19 | 5.1 × 10–16 |
| Focal adhesion | ARHGAP35, CAV2, CDC42, FYN, ITGA2, ITGA5, ITGAV, ITGB1, ITGB4, MYL12A, PRKCA, PRKCB, PRKCG, RAC1, SRC | 15 | 8.0 × 10–11 |
| Leukocyte transendothelial migration | ARHGAP35, CDC42, EZR, ITGAL, ITGB1, MMP2, MMP9, MYL12A, PRKCA, PRKCB, PRKCG, RAC1 | 12 | 3.0 × 10–11 |
| Regulation of actin cytoskeleton | ARHGAP35, CDC42, EZR, ITGA2, ITGA5, ITGAL, ITGAV, ITGB1, ITGB4, MYL12A, RAC1, SRC, TIAM1 | 13 | 1.6 × 10–8 |
| Pathways in cancer | CXCL8, CDH1, CDC42, ITGA2, ITGAV, ITGB1, MMP2, MMP9, PRKCA, PRKCB, PRKCG, RAC1, TGFBR1 | 13 | 1.4 × 10–5 |
| VEGF signaling pathway | CDC42, PRKCA, PRKCB, PRKCG, RAC1, SRC | 6 | 6.6 × 10–5 |
| Arrhythmogenic right ventricular cardiomyopathy (ARVC) | ITGA2, ITGA5, ITGAV, ITGB1, ITGB4 | 5 | 1.3 × 10–3 |
| Hypertrophic cardiomyopathy (HCM) | ITGA2, ITGA5, ITGAV, ITGB1, ITGB4 | 5 | 2.2 × 10–3 |
| Dilated cardiomyopathy | ITGA2, ITGA5, ITGAV, ITGB1, ITGB4 | 5 | 2.9 × 10–3 |
| Vascular smooth muscle contraction | ITPR1, PRKCA, PRKCB, PRKCG | 4 | 5.0 × 10–2 |
| Viral myocarditis | EIF4G3, FYN, ITGAL, RAC1 | 4 | 7.6 × 10–3 |
Enriched KEGG pathways in the syndecan-2 interactome, 70.4% annotated.
TABLE 5
| Term | Gene name | Count | p-value |
| Integrin alpha | ITGA2, ITGA5, ITGAL, ITGAV, | 4 | 4.8 × 10–5 |
| FG-GAP repeat | ITGA2, ITGA5, ITGAL, ITGAV | 4 | 5.7 × 10–5 |
| Putative peptidoglycan binding domain | MMP2, MMP7, MMP9, MMP14 | 4 | 6.7 × 10–5 |
| PTRF/SDPR family | CAVIN1/PTRF, CAVIN2/SDPR, CAVIN4/MURC | 3 | 9.4 × 10–5 |
PFAM protein domains enriched in the syndecan-2 interactome, annotated 100%.
Relative Levels of the Syndecan-2 Interactome Partners in Cardiac Fibroblasts and Cardiomyocytes
We decided to test whether the interactome proteins were mostly expressed in primary rat neonatal fibroblast or cardiomyocytes by MS analysis (Figure 5). Troponin-3 (TNNI3) was included as a marker for cardiomyocytes and vimentin (VIM) as a marker for fibroblasts (Figure 5 in bold). Purity of the cell fractions was based on the enrichment of TNN13 in the cardiomyocyte fraction and the lack thereof in the fibroblast fraction. Both endothelial cells and fibroblasts express vimentin [reviewed in Ivey and Tallquist (2016)] and some contamination of endothelial cells might have occurred. Except for NHLRC1, PHACTR2, RRAD, and TRIM21 (Table 1, markedb)), all novel MS partners and several of the syndecan-2 literature partners were identified in both cell types and most were enriched in one of the cell fractions (Figure 5). Syndecan-2 was enriched in the fibroblast fraction. The reason that not all interactome partners were detected might be because they are expressed at a more mature stage or expressed in other cell types.
FIGURE 5
Discussion
In order to understand the mechanisms of cardiac disease, it is important to know the underlying players. Here we used three different AP-MS approaches to identify protein partners of the poorly described cardiac proteoglycan syndecan-2. In total, we identified 30 novel syndecan-2 partners and 9 out of 41 literature partners in rat LV lysates, which together constitute the first cardiac syndecan-2 interactome. Importantly, several of the interactome partners formed connections to each other, suggesting that these proteins are important for the role of syndecan-2 in the heart (Figure 4B).
Unlike a genome, a proteome is highly dynamic (Bonetta, 2010) and an interactome analysis like ours only provide a snapshot view of interaction partners in the given tissue. To include all potential syndecan-2 interaction partners, we used a membrane dissolving lysis buffer containing 1% triton to extract the LVs. We chose a relatively stringent set-up, where novel MS partners had to be detected in at least two of three AP-MS approaches. Although this strategy probably left out more transient binders, it increased the confidence in the novel syndecan-2 partners we identified in this study. Accordingly, all the novel partners tested in HEK293 cells showed binding to syndecan-2. Peptides of the syndecan-4 cytoplasmic domain have been shown to form dimers (Shin et al., 2001), but it is unsure if the syndecan-2 cytoplasmic tail without the transmembrane domain also form proper dimers (Choi et al., 2005). However, we identified both the C1 binder cortactin (CTTN) (Kinnunen et al., 1998) as well as the C2 binder syntenin-1 (SDCBP) (Grootjans et al., 1997) with the SDC2cyt peptide, suggesting that the peptide did retain some functionality. However, to increase confidence in our results, we included a third AP approach using GST-SDC2, which successfully precipitated the C1 binder EZR (Granés et al., 2003). We detected more proteins in either pull down with biotin-ahx-SDC2cyt or IP-GST-SDC2 than in both, which is probably due to the different nature of the baits.
Syndecans have generally been regarded as regulators of cell-matrix and cell-cell communication, and in particular, syndecan-2 has been coupled to dynamic processes and motile events (Oh and Couchman, 2004; Couchman et al., 2015). This was reflected in the syndecan-2 interactome where the largest group was “cell communication” (Figure 4A), the top disease enrichment was “cancer” and “cardiovascular” (Table 3), and the top KEGG pathway was “proteoglycans in cancer” (Table 4). In line with this, the largest cluster of connected proteins was involved in cytoskeletal remodeling and migration (Figure 4B, main cluster). One of these novel partners was the AP-2 complex subunit α-2 (AP2A2), which connected with the two literature partners CTTN and EZR (Figure 4B, cluster 1). AP2A2 is an adaptor molecule involved in endocytosis of cargo and has been shown to mediate endocytosis of the syndecan-2 co-receptor CXCR2 (Renga et al., 2012; Raman et al., 2014). It also coordinates intracellular trafficking together with ARF6, a GTP binding protein found to regulate intracellular traffic of the syndecans, along with the literature partner SDCBP (Zimmermann et al., 2005; Lau and Chou, 2008). EZR links the plasma membrane to the actin cytoskeleton and has been found to regulate podosomal rosette formation together with CTTN in pancreatic cancer cells (Kocher et al., 2009). The rosette structures have been associated with invasive properties and reported to require adhesion to fibronectin (FN) and subsequent digestion of the ECM (Kocher et al., 2009). CTTN has been shown to regulate the secretion of FN, which is necessary for cell motility (Sung et al., 2011; Schnoor et al., 2018) and is also reported to regulate secretion of ECM digesting matrix metalloproteinases (MMPs) (Clark et al., 2007), which were also present in the syndecan-2 interactome (Figure 4B, main cluster). Interestingly, knockdown of syndecan-2 in fibroblasts has been shown to block FN matrix assembly (Galante and Schwarzbauer, 2007) and cells expressing syndecan-2 without the cytoplasmic tail have been found unable to assemble matrix at the cell surface (Klass et al., 2000) and to form proper FN fibrils in Xenopus (Kramer and Yost, 2002). Because of the involvement of CTTN in FN secretion, it is tempting to speculate that CTTN might act prior to the FN assembly role of syndecan-2. Overall, this points to a role for syndecan-2 in regulating cortical actin dynamics, possibly mediated through trafficking of co-receptors, cargo or syndecan-2 itself. AP2A2, CTTN and syndecan-2 were all found enriched in fibroblast fractions (Figure 5). Since ECM secretion is a characteristic feature of myofibroblasts [reviewed in Frangogiannis (2019)] and syndecan-2 has been shown to cooperate with integrin β1 (ITGB1) (Figure 4B, main cluster) in stress fiber formation (Kusano et al., 2000), another myofibroblast feature, we speculate whether this cluster of proteins might play a role in cardiac fibroblast activation.
The two novel MS partners serine/threonine-protein kinase MRCKβ (CDC42BPB) and tight junction protein ZO-1 (TJP1) connected to the syndecan-2 literature partner cell division control protein 42 homolog (CDC42) (Figure 4B, cluster 2). CDC42 is a plasma membrane associated small GTPase involved in syndecan-2 mediated filopodia extensions (Granes et al., 1999), and CDC42BPB is a CDC42 effector kinase (Huo et al., 2011). After binding of CDC42, CDC42BPB has been shown to form a complex with TJP1, which targets the CDC42BPB-TJP1 complex to the leading edge of migrating cells (Huo et al., 2011). TJP1 is a scaffolding protein that has been found to bind to cell surface transmembrane receptors through its N-terminal PDZ domain and further couples them to the actin cytoskeleton through its C-terminal proline rich region (Fanning et al., 1998; González-Mariscal et al., 2000). Although initially identified in tight junctions, TJP1 has also been found to regulate dynamic processes like angiogenesis and migration (Mattagajasingh et al., 2000; Tornavaca et al., 2015). Since syndecan-2 spans the plasma membrane, we speculate whether syndecan-2 is involved in the membrane localization of the CDC42BPB-TJP1 complex, and perhaps these proteins work together in cytoskeletal rearrangements and/or angiogenesis. TJP1 also connects to the MS partner plectin (PLEC) (Figure 4B, main cluster), which has been shown to be important in vascular integrity and to dysregulate tight junctions when absent (Osmanagic-Myers et al., 2015). Less is known about the novel MS partner myosin regulatory light chain 12A (MYL12A) (Figure 4B, main cluster), but it has been suggested to be involved in fibroblast contractility (Park et al., 2011).
Protein metabolism is important during cardiac remodeling (Chorghade et al., 2017). Interestingly, several MS partners were involved in protein metabolism, including the eukaryotic initiation factor 4E (EIF4E) and prefoldin subunit 2 (PFDN2) (Figure 4B, cluster 3). EIF4E is involved in regulation of translation initiation [reviewed in Shahbazian et al. (2006) and Siddiqui and Sonenberg (2015)] and PFDN2 is a co-chaperone involved in folding of cytosolic protein [reviewed in Sahlan et al. (2018)]. Like the well-known syndecan partner SDCBP (Grootjans et al., 1997), both EIF4E and PFDN2 precipitated in all three AP-MS approaches (Figure 2), which suggested that these bind syndecan-2 quite robustly. The third cluster was connected to the main cluster through the novel partner serine/threonine-protein phosphatase 2A catalytic subunit α (PPP2CA), which is known to regulate multiple cardiac signaling pathways [reviewed in Lubbers and Mohler (2016)] and to have a vast amount of targets, including EIF4E (Li et al., 2010). We cannot exclude that PPP2CA might also dephosphorylate syndecan-2. Although dephosphorylation of syndecans is less well understood, we have previously found that dephosphorylation of syndecan-4 might work as a molecular switch in the progression toward heart failure (Finsen et al., 2011). Future studies are needed to investigate the role of syndecan-2 in protein metabolism.
The last cluster consisted of three novel syndecan-2 partners, all from one of the most abundant families in the interactome, the CAVIN family (Table 5 and Figure 4B, cluster 4). Members of the CAVIN family have been reported to form homo- and heterologous complexes at caveolae sites, where CAVIN1 and CAVIN2 are involved in caveolae formation and curvature (Hill et al., 2008; Hansen et al., 2009; Nassar and Parat, 2015). In addition, individual signaling roles have been reported for all members. In response to insulin like growth factor 1 (IGF-1) and in consort with caveolin-1 (CAV1), CAVIN1 has been reported to regulate endocytosis and thereby signaling of the IGF-1 receptor (Aboulaich et al., 2006; Salani et al., 2010). IGF-1 has also been proposed to regulate syndecan-2-mediated actin polymerization and migration of a fibroblast cell line (Mytilinaiou et al., 2017). Moreover, in lungs, syndecan-2 has been reported to be involved in the sequestering of pro-fibrotic TGF-β1 receptors into intracellular vesicles together with CAV1 (Shi et al., 2013; Tsoyi et al., 2018). Taken together this could suggest that syndecan-2 might mediate the binding of growth factors, like IGF-1, to co-receptors at caveolae sites, leading to internalization in cooperation with the CAVINs and CAV1. Since, e.g., insulin has been suggested to mediate translocation of CAVIN1 (Liu and Pilch, 2016), it is also possible that syndecan-2 in response to growth factor stimulation, regulates the release of CAVINs from the membrane. Less is known about CAVIN2, but like syndecan-2, CAVIN2 has been found to be upregulated after aortic banding (Ogata et al., 2008), able to regulate angiogenesis in zebrafish (Chen E. et al., 2004; Ogata et al., 2008; Boopathy et al., 2017) and enriched in cardiac fibroblasts (Figure 5). Future studies will reveal the role of their interaction in cardiac fibroblasts and if CAVIN2 has a role in the syndecan-2 mediated angiogenesis. The CAVIN1 knock-out mouse shows cardiac dysfunction including fibrosis (Taniguchi et al., 2016), whereas CAVIN2 has not yet been coupled to fibrosis. CAVIN4 is restricted to muscle cells and involved in cardiac dysfunction (Ogata et al., 2008; Ogata et al., 2014). Overall, this could point to a role for syndecan-2 and the CAVINs in heart disease.
In two recent studies, syndecan-2 interaction partners were extracted from various interactome databases and previous high-throughput AP-MS experiments (Huttlin et al., 2015; Gondelaud and Ricard-Blum, 2019; Zandonadi et al., 2019). These did not overlap with the novel MS partners identified in our study and is probably a consequence of the different AP methods, tissues and cell models used. Recently we also identified the cardiac syndecan-4 interactome using similar strategy as described here (Mathiesen et al., 2019). Despite the close relationship between syndecan-2 and syndecan-4, their cardiac interactomes were surprisingly different, suggesting different functions. Except for the literature partners CTTN, ITGB1, MMP2, MMP9, RAC1, and SDCBP, we only found the novel MS partner CAVIN1 to be a common partner (Figure 6). The two syndecans also connected to some proteins within the same family, including the adaptor protein complexes (AP2A2 and AP3D1), tight junction proteins (TJP1 and TJP2) and the protein 4.1 proteins (EPB41L1 and EPB41) (Figure 6). Notably, proteins that bind to the common C1 or C2 region are often listed to bind all four syndecans (Gondelaud and Ricard-Blum, 2019; Mathiesen et al., 2019) (Table 2). However, the relatively low overlap of the C1 and C2 binding partners in the cardiac syndecan-2 and syndecan-4 interactomes suggests that this might not always be the case. On the other hand, CTTN has previously only been described as a syndecan-3 partner, but its presence in both the syndecan-2 and syndecan-4 interactomes suggests that it can indeed bind multiple syndecans.
FIGURE 6
All four syndecans are expressed in the heart (Strand et al., 2013), however, previous studies have focused on syndecan-1 and -4. Syndecan-1 is mainly known as a pro-fibrotic player and regulator of immune cell infiltration after a myocardial infarct (Vanhoutte et al., 2007; Frangogiannis Nikolaos, 2010; Schellings Mark et al., 2010). Syndecan-4 has been shown to act as a pro-remodeling molecule in both cardiomyocytes and fibroblasts in addition to recruiting immune cells (Finsen et al., 2011; Herum et al., 2013, 2015; Strand et al., 2013). Based on our data, the notion that the expression of syndecan-2 increases after aortic banding (Strand et al., 2013) and that syndecan-2 has been correlated with fibrosis in other tissues (Chen L. et al., 2004; Renga et al., 2012; Ruiz et al., 2012) it is tempting to speculate that syndecan-2 might be involved in cardiac fibrosis, perhaps together with CTTN and the CAVINs. Another important observation is that the interactome partners are not necessarily involved in cell adhesion, which is a primary feature associated with syndecans, thus the main role of syndecan-2 in the heart might be found outside the major adhesion sites.
Future studies are needed to verify the syndecan-2 interactions identified in this study and to determine their biological significance. Altogether, we hope that the interactome will spur future hypotheses and direct future studies on syndecan-2 in the heart.
Materials and Methods
Antibodies
Immunoprecipitations and immunoblotting were carried out using anti-SDC2 (LS-C150258, Nordic Biosite, Sweden), normal sheep IgG (6C0333, Merck KGaA, Germany), anti-GST (sc-80998, Santa Cruz Biotechnology, Inc., United States), anti-FLAG (F1804, Sigma-Aldrich, United States), anti-HA (#3724, clone C29F4, Cell Signaling, Netherlands) and anti-biotin-HRP (A0185, Sigma-Aldrich, United States). HRP conjugated anti-sheep (6150-05, SouthernBiotech, United States), anti-mouse (NA931V, GE Healthcare, United States) and anti-rabbit (NA934V, GE Healthcare) were used as secondary antibodies.
Peptides and Recombinant Proteins
Customized peptides were synthesized to >80% purity by Genscript Corp. (United States): Biotin-ahx-SDC2cyt: RMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA and biotin-ahx-scrambled (scram): RLEDKRPAQAKGKATMESFYKYDPRSAYGESK. Recombinant GST and N-terminal GST-tagged SDC2 (mouse) proteins were also made by Genscript Corp.
Transfection of HEK293 Cells
Human Embryonic Kidney 293 (HEK) cells (ATCC CRL-1573™, United States) were kept in Dulbecco’s modified Eagles’s medium (DMEM) (41965-039, Gibco, Life Technologies, Inc., United States) supplemented with 10% fetal bovine serum (FBS) and 1% penicillin/streptomyocin (PS) (P0781, Sigma-Aldrich) humidified at 37°C in 5% CO2. HEK293 cells were transfected with the CaCl2 method as previously described (Jordan et al., 1996; Mathiesen et al., 2019). Briefly, cells were cultured without PS 24 h before transfection. Plasmid DNA (8 μg) in 500 μL CaCl2 solution (248 mM) was mixed with 500 μL 2x HEPES buffer (50 mM HEPES, 280 mM NaCl, 1.5 mM Na2HPO4, pH 7.0), incubated at room temperature (RT) for 20–30 min (min) before drippled onto the cells. After 24 h cells were harvested in IP buffer [150 mM NaCl, 20 mM HEPES (pH 7.5), 1 mM EDTA, 1%Triton X-100] with cOmplete protease inhibitor cocktail (#05050489001, Roche, Switzerland). All genes were cloned with either a FLAG or HA tag in the pcDNA3.1 vector unless otherwise stated (Genscript Corp., United States). The DNA constructs were: DDX19A-FLAG human (NM_018332), NSF-FLAG human (NM_006178), PFDN2-FLAG human (NM_012394), PSMC5-FLAG human (NM_001199163), PSMD11-FLAG mouse (NM_178616), MYL12A/RLC-A-FLAG rat (NM_001135017), CAVIN2/SDPR-FLAG human (NM_004657), CTTN-FLAG human (NM_138565), EIF4E-FLAG human (NM_001968), JPH2-FLAG human (NM_020433.4), RRAD-FLAG human (NM_001128850), 3x FLAG-HSPB6 rat (NM_138887.1), FLAG-His6-PPP1CA rat (P62138) and HA-SDC2 human (NM_002998) (pCEP4 vector). AP2A2-FLAG human (NM_001242837.1) was cloned by Cyagen US Inc. (United States). The 11 interactors were selected based on a combination of their distribution in the pull down, IP-GST and IP-SDC2 AP-MS groups, distribution in the cardiac syndecan-2 interactome (Figure 4B) as well as availability from the Genscript clone collection.
Immunoprecipitation (IP) in Cell Lysates
Lysates were mixed with 2 μg anti-FLAG, anti-SDC2 or anti-GST (with recombinant GST-SDC2) and protein A/G-agarose beads (sc-2003, Santa Cruz Biotechnology) and rotating overnight (ON) at 4°C. After three times wash in IP buffer (150 mM NaCl, 20 mM HEPES, pH 7.5, 1 mM EDTA, 1%Triton X-100) with cOmplete protease inhibitor cocktail (#5050489001, Roche), samples were eluted by boiling in 2 × SDS loading buffer and analyzed by immunoblotting.
Immunoblotting
Samples were analyzed on 4–15% or 15% Criterion™ Tris-HCl precast gel (#3450028 and #3450021, Bio-Rad, United States) and blotted onto a PVDF membrane (#1704157, Bio-Rad). After blocking in either 5% non-fat dried milk or 1% casein in TBS-T [Tris-buffered saline with 1% Tween-20 (#1610781, Bio-Rad)] for 1 h at RT, membranes were incubated with primary antibodies for 1 h at RT or ON at 4°C. Following three times 5 min wash in TBS-T, membranes were incubated with HRP-conjugated secondary antibody for 1 h at RT, washed three times 5 min in TBS-T and signal developed using ECL Prime (RPN 2232, GE Healthcare). Reprobing was performed after stripping with Restore™ Western Blot Stripping Buffer (#21059, Thermo Scientific, United States).
Peptide Overlay
Syndecan-2 (rat, mouse, and human) and syndecan-4 (rat) were spot-synthesized as 20-mer peptides with 3 amino acids offset on a cellulose membrane by a Multiprep automated peptide synthesizer (INTAVIS Bioanalytical Instruments AG, Germany) (Frank and Overwin, 1996). The peptide array membranes were blocked for minimum 1 h in 1% casein in TBS-T at RT before incubation with anti-syndecan-2 ON at 4°C. Binding was detected by immunoblotting with anti-sheep-HRP and signal detected by ECL Prime.
Rat Neonatal FB and CM
The study conforms to the “Guide for the Care and Use of Laboratory Animals” (NIH publication No. 85-23, revised 2011, United States) and was preapproved by the Norwegian National Animal Research Committee (Permit of approval number IV1-17U). Lysates from primary cardiomyocytes and fibroblasts were prepared as previously described (Mathiesen et al., 2019) and thereafter analyzed by MS.
LV Lysate and Affinity Purification for MS
Frozen LV’s from Wistar 230-250 g male rats (Janvier Labs, France) were pulverized in liquid nitrogen in a mortar, transferred to lysis buffer [150 mM NaCl, 20 mM Hepes, pH 7.5, 1 mM EDTA, 0.5% Triton supplemented with complete protease inhibitor cocktail (Roche)] on ice and homogenized with a Polytron 1200 homogenizer in three series of 1 min. The suspensions were centrifuged at 100,000 × g for 60 min at 4°C and supernatants were stored at −80°C.
In pull down experiments with peptides, pooled LV lysates were mixed with 0.01 mM of the biotinylated SDC2cyt peptide or 0.02 mM of the biotinylated scrambled control peptide (to secure excess of negative control) and rotated ON at 4°C. LV lysates without any peptides was included as a second negative control (beads only). Streptavidin coated dynabeads (Dynabeads™ M-270 Streptavidin, #65305, Life Technologies, United States) were washed three times in PBS before they were added to the LV lysate with or without peptides and rotated for 40 min at RT. The beads were washed five times in PBS and captured proteins were eluted in 250 μL 25 mM biotin for 3 h at 60°C. Proteins were precipitated in 1 ml of 4 × ice-cold acetone added glycoblue at −20°C ON. The tubes were centrifuged and the pellets were air-dried before MS analysis.
For large scale IP, 10 μg/mg of anti-syndecan-2, anti-sheep IgG or anti-GST were coupled to magnetic dynabeads (Dynabeads™ Antibody Coupling Kit, #14311D, Thermo Fisher, United States) according to manufacturer’s protocol. The antibody coupled beads were incubated with the LV lysates with or without supplementation of GST or GST-SDC2 recombinant protein and rotated ON at 4°C. After three times wash in cold PBS and two times wash in cold water to remove salts (Mlynarcik et al., 2012), captured protein complexes were eluted in 0.1% TFA in freshly made 50% acetonitrile for 30 min while rotating at RT. The elution step was repeated once with fresh TFA before precipitation in 1 ml 4 × ice-cold acetone added glycoblue at −20°C. Samples were spun at max speed for 15 min and the pellets were air-dried before MS analysis.
Protein Identification and Label-Free Quantification by LC-MS/MS
The 2-D Clean Up-Kit (80-6484-51, GE healthcare) was used to precipitate proteins from the fibroblast and cardiomyocyte fractions. The precipitate was then dissolved in 40 μL 0.2% ProteaseMAX™ Surfactant, Trypsin Enhancer (Promega) in 50 mM NH4HCO3 before protein reduction, alkylation and in-solution trypsin digestion (Promega) ON at 37°C. Following digestion, centrifugation at 14,000 × g for 10 min, trypsin inactivation by adding 100 μl 1% TFA and another round of centrifugation at 14,000 × g for 10 min followed.
The air dired IP samples were resuspended in 20 μl 6 M Urea in 10 mM HEPES, pH 8 before reduction, alkylation and 4 h in-solution lysyl endopeptidase digestion (Wako) in room temperature. Samples were diluted four times before over night trypsin (Promega) digestion at room temperature. Following digestion, centrifugation at 14,000 × g for 10 min, trypsin inactivation by adding 100 μl 1% TFA and another round of centrifugation at 14,000 × g for 10 min followed.
Desalting and upconcentration of peptides was performed before MS by the STAGE-TIP method using a C18 resin disk (3M Empore). The peptides were eluted with 80 μl 80% ACN/0.1% FA, dried, and solubilized in 7 μL 0.1% FA for MS analysis. Each peptide mixture was analyzed by a nEASY-LC coupled to QExactive Plus (Thermo Electron, Bremen, Germany) as previously described (Mathiesen et al., 2019), except that a 50 cm column was used. Gradients of 60 and 120 min were used for the IPs and fractions, respectively. The resulting MS raw files were submitted to the MaxQuant software for protein identification and label-free quantification and Perseus software was used for the statistical analysis as described in detail previously (Mathiesen et al., 2019).
To allow quantitative comparisons and determine the significance between MS samples, LFQ intensities were loaded into Perseus (Version 1.4.0.20), log2 transformed and a t-test was performed (p < 0.05 was accepted as statistically significant). To be considered a MS partner, proteins had to be identified in IP-SDC2 and at least one of the other APs. Non-specific binders to the SDC2cyt peptide were sorted away through the two negative controls; scramble or beads only. Non-specific binders to GST-SDC2 were sorted away through the two negative controls; GST or beads only. Then the pools of proteins identified in the pull down and IP-GST were compared with the pool of proteins obtained from IP-SDC2 corrected against IP-IgG.
Generating the Cardiac Interactome Map
The 30 MS partners and 41 literature partners were grouped according to the GO annotation biological process extracted from hprd.org (Keshava Prasad et al., 2009) (Figure 4A). The MS partners and literature partners found in our AP-MS screens (this study) (Figure 2) made up the cardiac interactome and STRING database version 10.5 (Szklarczyk et al., 2017) was used to predict connections (Figure 4B). Data was extracted with the following setting: species: Homo sapiens (created more connections than Rattus norvegicus), confidence: medium, active interaction sources: Experiments, databases, and co-expression. The network stats were: number of nodes: 39, number of edges: 48, average node degree: 2.46, avg. local clustering coefficient: 0.395, expected number of edges: 27. PPI enrichment p-value: <0.000117. CAVIN4 has been shown to interact with CAVIN1 and -2 in the literature (Ogata et al., 2008, 2014) and was therefore added to the interactome. The literature partners CDC42, ITGB1, EZR, MMP2, MMP9, RAC1, and EPB41L1 were detected in only one AP-MS approach. However, since they were identified both in this and in another study (Table 2), their potential for being important for syndecan-2 in the heart was heightened, and they were therefore included in the STRING analysis.
Functional Annotation
The DAVID bioinformatics tool (Huang da et al., 2009a, b), version 6.8, was used for functional annotation. Through the DAVID tool enrichment in genetic disease-class database annotation, KEGG pathways, and PFAM (Finn et al., 2016) domains were analyzed. The SDC2 interactome gene list was imported as official gene names and Homo sapiens was used as both species and background and the following settings were used count (2) and EASE score (0.1) (Modified Fisher Exact p-value).
Statements
Data availability statement
The datasets generated in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found below: http://www.proteomexchange.org/, PXD018942.
Ethics statement
The animal study was reviewed and approved by Norwegian National Animal Research Committee.
Author contributions
SM and CC designed and conceived the experiments. SM wrote the manuscript under the guidance of CC and GC. SM performed the largescale AP. MS and TN performed the mass spectrometry analysis. MM performed the transfections. SM and ML performed the small scale IPs and epitope mapping. All authors read and approved the manuscript.
Funding
This study was supported by Nasjonalforeningen for folkehelsen, Stiftelsen Kristian Gerhard Jebsen, The Research Council of Norway, Olav Raagholt og Gerd Meidel Raagholts stiftelse for forskning (http://www.raagholtstiftelsen.no/), Anders Jahre’s Fund for the Promotion of Science and the South-Eastern Regional Health Authority, Fondsstiftelsen from Oslo University Hospital, Norway. Proteomics Core Facility was supported by the Core Facilities Program of the South-Eastern Norway Regional Health Authority.
Acknowledgments
We are grateful to Tone Asknes Lian and Anita Kaupang for technical assistance.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcell.2020.00792/full#supplementary-material
Abbreviations
- AP
affinity purification
- AP-MS
affinity purification coupled to mass spectrometry
- ECM
extra cellular matrix
- GST
glutathione S-transferase
- HRP
horseradish peroxidase
- IP
immunoprecipitation
- literature partner
syndecan-2 interaction partner previously described in the literature
- LV
left ventricle
- MS partner
syndecan-2 interaction partner identified in AP-MS in this study
- MS
mass spectrometry
- Scram
scrambled peptide
- SDC2
syndecan-2
- SDC2cyt
cytoplasmic domain of syndecan-2.
Footnotes
References
1
AboulaichN.OrtegrenU.VenerA. V.StralforsP. (2006). Association and insulin regulated translocation of hormone-sensitive lipase with PTRF.Biochem. Biophys. Res. Commun.350657–661. 10.1016/j.bbrc.2006.09.094
2
BalzaR. O.Jr.MisraR. P. (2006). Role of the serum response factor in regulating contractile apparatus gene expression and sarcomeric integrity in cardiomyocytes.J. Biol. Chem.2816498–6510. 10.1074/jbc.M509487200
3
BonettaL. (2010). Interactome under construction.Nature468:851. 10.1038/468851a
4
BoopathyG. T. K.KulkarniM.HoS. Y.BoeyA.ChuaE. W. M.BarathiV. A.et al (2017). Cavin-2 regulates the activity and stability of endothelial nitric-oxide synthase (eNOS) in angiogenesis.J. Biol. Chem.29217760–17776. 10.1074/jbc.M117.794743
5
ChakravartiR.AdamsJ. C. (2006). Comparative genomics of the syndecans defines an ancestral genomic context associated with matrilins in vertebrates.BMC Genomics7:83. 10.1186/1471-2164-7-83
6
ChenC. Y.LinC. W.ChangC. Y.JiangS. T.HsuehY. P. (2011). Sarm1, a negative regulator of innate immunity, interacts with syndecan-2 and regulates neuronal morphology.J. Cell Biol.193769–784. 10.1083/jcb.201008050
7
ChenE.HermansonS.EkkerS. C. (2004). Syndecan-2 is essential for angiogenic sprouting during zebrafish development.Blood1031710–1719. 10.1182/blood-2003-06-1783
8
ChenL.KlassC.WoodsA. (2004). Syndecan-2 regulates transforming growth factor-beta signaling.J. Biol. Chem.27915715–15718. 10.1074/jbc.C300430200
9
CheshenkoN.LiuW.SatlinL. M.HeroldB. C. (2007). Multiple receptor interactions trigger release of membrane and intracellular calcium stores critical for herpes simplex virus entry.Mol. Biol. Cell183119–3130. 10.1091/mbc.e07-01-0062
10
ChoiS.KimY.ParkH.HanI. O.ChungE.LeeS. Y.et al (2009). Syndecan-2 overexpression regulates adhesion and migration through cooperation with integrin alpha2.Biochem. Biophys. Res. Commun.384231–235. 10.1016/j.bbrc.2009.04.093
11
ChoiS.LeeE.KwonS.ParkH.YiJ. Y.KimS.et al (2005). Transmembrane domain-induced oligomerization is crucial for the functions of syndecan-2 and syndecan-4.J. Biol. Chem.28042573–42579. 10.1074/jbc.M509238200
12
ChoiY.KimH.ChungH.HwangJ. S.ShinJ. A.HanI. O.et al (2010). Syndecan-2 regulates cell migration in colon cancer cells through Tiam1-mediated Rac activation.Biochem. Biophys. Res. Commun.391921–925. 10.1016/j.bbrc.2009.11.165
13
ChoiY.KwonM. J.LimY.YunJ. H.LeeW.OhE. S. (2015). Trans-regulation of Syndecan Functions by Hetero-oligomerization.J. Biol. Chem.29016943–16953. 10.1074/jbc.M114.611798
14
ChorghadeS.SeimetzJ.EmmonsR.YangJ.BressonS. M.LisioM. D.et al (2017). Poly(A) tail length regulates PABPC1 expression to tune translation in the heart.eLife6:e24139. 10.7554/eLife.24139
15
ChristensenG.HerumK. M.LundeI. G. (2019). Sweet, yet underappreciated: proteoglycans and extracellular matrix remodeling in heart disease.Matrix Biol.75-76286–299. 10.1016/j.matbio.2018.01.001
16
ClarkE. S.WhighamA. S.YarbroughW. G.WeaverA. M. (2007). Cortactin is an essential regulator of matrix metalloproteinase secretion and extracellular matrix degradation in invadopodia.Cancer Res.674227–4235. 10.1158/0008-5472.can-06-3928
17
CohenA. R.WoodsD. F.MarfatiaS. M.WaltherZ.ChishtiA. H.AndersonJ. M. (1998). Human CASK/LIN-2 binds syndecan-2 and protein 4.1 and localizes to the basolateral membrane of epithelial cells.J. Cell Biol.142129–138. 10.1083/jcb.142.1.129
18
CohnJ. N.FerrariR.SharpeN. (2000). Cardiac remodeling–concepts and clinical implications: a consensus paper from an international forum on cardiac remodeling. Behalf of an International forum on cardiac remodeling.J. Am. Coll. Cardiol.35569–582. 10.1016/s0735-1097(99)00630-0
19
CouchmanJ. R. (2010). Transmembrane signaling proteoglycans.Annu. Rev. Cell Dev. Biol.2689–114. 10.1146/annurev-cellbio-100109-104126
20
CouchmanJ. R.GopalS.LimH. C.NorgaardS.MulthauptH. A. (2015). Fell-muir lecture: syndecans: from peripheral coreceptors to mainstream regulators of cell behaviour.Int. J. Exp. Pathol.961–10. 10.1111/iep.12112
21
DavidG.BaiX. M.Van der SchuerenB.MarynenP.CassimanJ. J.Van den BergheH. (1993). Spatial and temporal changes in the expression of fibroglycan (syndecan-2) during mouse embryonic development.Development119841–854.
22
DewsI. C.MackenzieK. R. (2007). Transmembrane domains of the syndecan family of growth factor coreceptors display a hierarchy of homotypic and heterotypic interactions.Proc. Natl. Acad. Sci. U.S.A.10420782–20787. 10.1073/pnas.0708909105
23
EssnerJ. J.ChenE.EkkerS. C. (2006). Syndecan-2.Int. J. Biochem. Cell Biol.38152–156. 10.1016/j.biocel.2005.08.012
24
EthellI. M.HagiharaK.MiuraY.IrieF.YamaguchiY. (2000). Synbindin, a novel syndecan-2-binding protein in neuronal dendritic spines.J. Cell Biol.15153–68. 10.1083/jcb.151.1.53
25
EthellI. M.IrieF.KaloM. S.CouchmanJ. R.PasqualeE. B.YamaguchiY. (2001). EphB/syndecan-2 signaling in dendritic spine morphogenesis.Neuron311001–1013. 10.1016/s0896-6273(01)00440-8
26
EthellI. M.YamaguchiY. (1999). Cell surface heparan sulfate proteoglycan syndecan-2 induces the maturation of dendritic spines in rat hippocampal neurons.J. Cell Biol.144575–586. 10.1083/jcb.144.3.575
27
FanningA. S.JamesonB. J.JesaitisL. A.AndersonJ. M. (1998). The tight junction protein ZO-1 establishes a link between the transmembrane protein occludin and the actin cytoskeleton.J. Biol. Chem.27329745–29753. 10.1074/jbc.273.45.29745
28
FearsC. Y.GladsonC. L.WoodsA. (2006). Syndecan-2 is expressed in the microvasculature of gliomas and regulates angiogenic processes in microvascular endothelial cells.J. Biol. Chem.28114533–14536. 10.1074/jbc.C600075200
29
FinnR. D.CoggillP.EberhardtR. Y.EddyS. R.MistryJ.MitchellA. L.et al (2016). The Pfam protein families database: towards a more sustainable future.Nucleic Acids Res.44D279–D285. 10.1093/nar/gkv1344
30
FinsenA. V.LundeI. G.SjaastadI.OstliE. K.LyngraM.JarstadmarkenH. O.et al (2011). Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway.PLoS One6:e28302. 10.1371/journal.pone.0028302
31
FrangogiannisN. G. (2019). Cardiac fibrosis: cell biological mechanisms, molecular pathways and therapeutic opportunities.Mol. Aspects Med.6570–99. 10.1016/j.mam.2018.07.001
32
Frangogiannis NikolaosG. (2010). Syndecan-1.Hypertension55233–235. 10.1161/HYPERTENSIONAHA.109.147256
33
FrankR.OverwinH. (1996). “SPOT synthesis,” in Epitope Mapping Protocols, ed.MorrisG. E. (Totowa, NJ: Humana Press), 149–169.
34
GalanteL. L.SchwarzbauerJ. E. (2007). Requirements for sulfate transport and the diastrophic dysplasia sulfate transporter in fibronectin matrix assembly.J. Cell Biol.179999–1009. 10.1083/jcb.200707150
35
GaoY.LiM.ChenW.SimonsM. (2000). Synectin, syndecan-4 cytoplasmic domain binding PDZ protein, inhibits cell migration.J. Cell Physiol.184373–379. 10.1002/1097-4652(200009)184:3<373::aid-jcp12>3.0.co;2-i
36
GondelaudF.Ricard-BlumS. (2019). Structures and interactions of syndecans.FEBS J.2862994–3007. 10.1111/febs.14828
37
González-MariscalL.BetanzosA.Ávila-FloresA. (2000). MAGUK proteins: structure and role in the tight junction.Semin. Cell Dev. Biol.11315–324. 10.1006/scdb.2000.0178
38
GranésF.BerndtC.RoyC.MangeatP.ReinaM.VilaróS. (2003). Identification of a novel Ezrin-binding site in syndecan-2 cytoplasmic domain.FEBS Lett.547212–216. 10.1016/s0014-5793(03)00712-9
39
GranesF.GarciaR.Casaroli-MaranoR. P.CastelS.RocamoraN.ReinaM.et al (1999). Syndecan-2 induces filopodia by active cdc42Hs.Exp. Cell Res.248439–456. 10.1006/excr.1999.4437
40
GranesF.UrenaJ. M.RocamoraN.VilaroS. (2000). Ezrin links syndecan-2 to the cytoskeleton.J. Cell Sci.113(Pt 7)1267–1276.
41
GrootjansJ. J.ZimmermannP.ReekmansG.SmetsA.DegeestG.DurrJ.et al (1997). Syntenin, a PDZ protein that binds syndecan cytoplasmic domains.Proc. Natl. Acad. Sci. U.S.A.9413683–13688. 10.1073/pnas.94.25.13683
42
HaldenY.RekA.AtzenhoferW.SzilakL.WabnigA.KunglA. J. (2004). Interleukin-8 binds to syndecan-2 on human endothelial cells.Biochem. J.377(Pt 2)533–538. 10.1042/bj20030729
43
HansenC. G.BrightN. A.HowardG.NicholsB. J. (2009). SDPR induces membrane curvature and functions in the formation of caveolae.Nat. Cell Biol.11807–814. 10.1038/ncb1887
44
HerumK. M.LundeI. G.SkrbicB.FlorholmenG.BehmenD.SjaastadI.et al (2013). Syndecan-4 signaling via NFAT regulates extracellular matrix production and cardiac myofibroblast differentiation in response to mechanical stress.J. Mol. Cell Cardiol.5473–81. 10.1016/j.yjmcc.2012.11.006
45
HerumK. M.LundeI. G.SkrbicB.LouchW. E.HasicA.BoyeS.et al (2015). Syndecan-4 is a key determinant of collagen cross-linking and passive myocardial stiffness in the pressure-overloaded heart.Cardiovasc. Res.106217–226. 10.1093/cvr/cvv002
46
HillM. M.BastianiM.LuetterforstR.KirkhamM.KirkhamA.NixonS. J.et al (2008). PTRF-Cavin, a conserved cytoplasmic protein required for caveola formation and function.Cell132113–124. 10.1016/j.cell.2007.11.042
47
HsuehY. P.RobertsA. M.VoltaM.ShengM.RobertsR. G. (2001). Bipartite interaction between neurofibromatosis type I protein (neurofibromin) and syndecan transmembrane heparan sulfate proteoglycans.J. Neurosci.213764–3770. 10.1523/jneurosci.21-11-03764.2001
48
HsuehY. P.YangF. C.KharaziaV.NaisbittS.CohenA. R.WeinbergR. J.et al (1998). Direct interaction of CASK/LIN-2 and syndecan heparan sulfate proteoglycan and their overlapping distribution in neuronal synapses.J. Cell Biol.142139–151. 10.1083/jcb.142.1.139
49
HuangJ. W.ChenC. L.ChuangN. N. (2005a). P120-GAP associated with syndecan-2 to function as an active switch signal for Src upon transformation with oncogenic ras.Biochem. Biophys. Res. Commun.329855–862. 10.1016/j.bbrc.2005.02.045
50
HuangJ. W.ChenC. L.ChuangN. N. (2005b). Trap RACK1 with Ras to mobilize Src signaling at syndecan-2/p120-GAP upon transformation with oncogenic ras.Biochem. Biophys. Res. Commun.3301087–1094. 10.1016/j.bbrc.2005.02.189
51
HuangJ. W.ChuangN. N. (2006). Shift syndecan-2 from RACK1 to caveolin-2 upon transformation with oncogenic ras.Biochem. Biophys. Res. Commun.350227–232. 10.1016/j.bbrc.2006.09.035
52
Huang daW.ShermanB. T.LempickiR. A. (2009a). Systematic and integrative analysis of large gene lists using DAVID bioinformatics resources.Nat. Protoc.444–57. 10.1038/nprot.2008.211
53
Huang daW.ShermanB. T.ZhengX.YangJ.ImamichiT.StephensR.et al (2009b). Extracting biological meaning from large gene lists with DAVID.Curr. Protoc. Bioinform. Chapter 13 Unit13.11. 10.1002/0471250953.bi1311s27
54
HuoL.WenW.WangR.KamC.XiaJ.FengW.et al (2011). Cdc42-dependent formation of the ZO-1/MRCKbeta complex at the leading edge controls cell migration.EMBO J.30665–678. 10.1038/emboj.2010.353
55
HuttlinE. L.TingL.BrucknerR. J.GebreabF.GygiM. P.SzpytJ.et al (2015). The BioPlex network: a systematic exploration of the human interactome.Cell162425–440. 10.1016/j.cell.2015.06.043
56
IveyM. J.TallquistM. D. (2016). Defining the cardiac fibroblast.Circ. J.802269–2276. 10.1253/circj.CJ-16-1003
57
JangB.JungH.ChungH.MoonB. I.OhE. S. (2016). Syndecan-2 enhances E-cadherin shedding and fibroblast-like morphological changes by inducing MMP-7 expression in colon cancer cells.Biochem. Biophys. Res. Commun.47747–53. 10.1016/j.bbrc.2016.06.019
58
JordanM.SchallhornA.WurmF. M. (1996). Transfecting mammalian cells: optimization of critical parameters affecting calcium-phosphate precipitate formation.Nucleic Acids Res.24596–601. 10.1093/nar/24.4.596
59
Keshava PrasadT. S.GoelR.KandasamyK.KeerthikumarS.KumarS.MathivananS.et al (2009). Human protein reference database—2009 update.Nucleic Acids Res.37(suppl. 1)D767–D772. 10.1093/nar/gkn892
60
KimC. W.GoldbergerO. A.GalloR. L.BernfieldM. (1994). Members of the syndecan family of heparan sulfate proteoglycans are expressed in distinct cell-, tissue-, and development-specific patterns.Mol. Biol. Cell5797–805. 10.1091/mbc.5.7.797
61
KinnunenT.KaksonenM.SaarinenJ.KalkkinenN.PengH. B.RauvalaH. (1998). Cortactin-Src kinase signaling pathway is involved in N-syndecan-dependent neurite outgrowth.J. Biol. Chem.27310702–10708. 10.1074/jbc.273.17.10702
62
KlassC. M.CouchmanJ. R.WoodsA. (2000). Control of extracellular matrix assembly by syndecan-2 proteoglycan.J. Cell Sci.113(Pt 3)493–506.
63
KocherH. M.SandleJ.MirzaT. A.LiN. F.HartI. R. (2009). Ezrin interacts with cortactin to form podosomal rosettes in pancreatic cancer cells.Gut58271–284. 10.1136/gut.2008.159871
64
KramerK. L.YostH. J. (2002). Ectodermal syndecan-2 mediates left-right axis formation in migrating mesoderm as a cell-nonautonomous Vg1 cofactor.Dev. Cell2115–124. 10.1016/s1534-5807(01)00107-1
65
KusanoY.OguriK.NagayasuY.MunesueS.IshiharaM.SaikiI.et al (2000). Participation of Syndecan 2 in the induction of stress fiber formation in cooperation with integrin α5β1: structural characteristics of heparan sulfate chains with avidity to COOH-terminal heparin-binding domain of fibronectin.Exp. Cell Res.256434–444. 10.1006/excr.2000.4802
66
LauA. W.ChouM. M. (2008). The adaptor complex AP-2 regulates post-endocytic trafficking through the non-clathrin Arf6-dependent endocytic pathway.J. Cell Sci.121:4008. 10.1242/jcs.033522
67
LeeH.KimY.ChoiY.ChoiS.HongE.OhE. S. (2011). Syndecan-2 cytoplasmic domain regulates colon cancer cell migration via interaction with syntenin-1.Biochem. Biophys. Res. Commun.409148–153. 10.1016/j.bbrc.2011.04.135
68
LeeY. H.ParkJ. H.CheonD. H.KimT.ParkY. E.OhE. S.et al (2017). Processing of syndecan-2 by matrix metalloproteinase-14 and effect of its cleavage on VEGF-induced tube formation of HUVECs.Biochem. J.4743719–3732. 10.1042/bcj20170340
69
LiY.YueP.DengX.UedaT.FukunagaR.KhuriF. R.et al (2010). Protein phosphatase 2A negatively regulates eukaryotic initiation factor 4E phosphorylation and eIF4F assembly through direct dephosphorylation of Mnk and eIF4E.Neoplasia12848–855. 10.1593/neo.10704
70
LimH. C.CouchmanJ. R. (2014). Syndecan-2 regulation of morphology in breast carcinoma cells is dependent on RhoGTPases.Biochim. Biophys. Acta18402482–2490. 10.1016/j.bbagen.2014.01.018
71
LimH. C.MulthauptH. A.CouchmanJ. R. (2015). Cell surface heparan sulfate proteoglycans control adhesion and invasion of breast carcinoma cells.Mol. Cancer14:15. 10.1186/s12943-014-0279-8
72
LiuL.PilchP. F. (2016). PTRF/Cavin-1 promotes efficient ribosomal RNA transcription in response to metabolic challenges.eLife5:e17508. 10.7554/eLife.17508
73
LubbersE. R.MohlerP. J. (2016). Roles and regulation of protein phosphatase 2A (PP2A) in the heart.J. Mol. Cell Cardiol.101127–133. 10.1016/j.yjmcc.2016.11.003
74
MathiesenS. B.LundeM.AronsenJ. M.RomaineA.KaupangA.MartinsenM.et al (2019). The cardiac syndecan-4 interactome reveals a role for syndecan-4 in nuclear translocation of muscle LIM protein (MLP).J. Biol. Chem.2948717–8731. 10.1074/jbc.RA118.006423
75
MattagajasinghS. N.HuangS.-C.HartensteinJ. S.BenzE. J. (2000). Characterization of the interaction between protein 4.1R and ZO-2: a possible link between the tight junction and the actin cytoskeleton.J. Biol. Chem.27530573–30585. 10.1074/jbc.M004578200
76
MaximovA.TangT. S.BezprozvannyI. (2003). Association of the type 1 inositol (1,4,5)-trisphosphate receptor with 4.1N protein in neurons.Mol. Cell Neurosci.22271–283. 10.1016/s1044-7431(02)00027-1
77
MlynarcikP.BencurovaE.MadarM.MuchaR.PulzovaL.HreskoS.et al (2012). Development of simple and rapid elution methods for proteins from various affinity beads for their direct MALDI-TOF downstream application.J. Proteomics754529–4535. 10.1016/j.jprot.2012.03.001
78
MytilinaiouM.NikitovicD.BerdiakiA.PapoutsidakisA.PapachristouD. J.TsatsakisA.et al (2017). IGF-I regulates HT1080 fibrosarcoma cell migration through a syndecan-2/Erk/ezrin signaling axis.Exp. Cell Res.3619–18. 10.1016/j.yexcr.2017.09.035
79
NassarZ. D.ParatM. O. (2015). Cavin family: new players in the biology of caveolae.Int. Rev. Cell Mol. Biol.320235–305. 10.1016/bs.ircmb.2015.07.009
80
OgataT.NaitoD.NakanishiN.HayashiY. K.TaniguchiT.MiyagawaK.et al (2014). MURC/Cavin-4 facilitates recruitment of ERK to caveolae and concentric cardiac hypertrophy induced by α1-adrenergic receptors.Proc. Natl. Acad. Sci. U.S.A.1113811–3816. 10.1073/pnas.1315359111
81
OgataT.UeyamaT.IsodonoK.TagawaM.TakeharaN.KawashimaT.et al (2008). MURC, a muscle-restricted coiled-coil protein that modulates the Rho/ROCK pathway, induces cardiac dysfunction and conduction disturbance.Mol. Cell Biol.283424–3436. 10.1128/mcb.02186-07
82
OhE. S.CouchmanJ. R. (2004). Syndecans-2 and -4; close cousins, but not identical twins.Mol. Cells17181–187.
83
OhE. S.CouchmanJ. R.WoodsA. (1997). Serine phosphorylation of syndecan-2 proteoglycan cytoplasmic domain.Arch. Biochem. Biophys.34467–74. 10.1006/abbi.1997.0180
84
Osmanagic-MyersS.RusS.WolframM.BrunnerD.GoldmannW. H.BonakdarN.et al (2015). Plectin reinforces vascular integrity by mediating crosstalk between the vimentin and the actin networks.J. Cell Sci.128:4138. 10.1242/jcs.172056
85
ParkI.HanC.JinS.LeeB.ChoiH.KwonJ. T.et al (2011). Myosin regulatory light chains are required to maintain the stability of myosin II and cellular integrity.Biochem. J.434:171. 10.1042/BJ20101473
86
PrasthoferT.EkB.EkmanP.OwensR.HookM.JohanssonS. (1995). Protein kinase C phosphorylates two of the four known syndecan cytoplasmic domains in vitro.Biochem. Mol. Biol. Int.36793–802.
87
RamanD.SaiJ.HawkinsO.RichmondA. (2014). Adaptor protein2 (AP2) orchestrates CXCR2-mediated cell migration.Traffic15451–469. 10.1111/tra.12154
88
RengaB.FrancisciD.D’AmoreC.SchiaroliE.MencarelliA.CiprianiS.et al (2012). The HIV matrix protein p17 subverts nuclear receptors expression and induces a STAT1-dependent proinflammatory phenotype in monocytes.PLoS One7:e35924. 10.1371/journal.pone.0035924
89
Rovira-ClaveX.Angulo-IbanezM.ReinaM.EspelE. (2014). The PDZ-binding domain of syndecan-2 inhibits LFA-1 high-affinity conformation.Cell Signal.261489–1499. 10.1016/j.cellsig.2014.03.012
90
RuizX. D.MlakarL. R.YamaguchiY.SuY.LarreginaA. T.PilewskiJ. M.et al (2012). Syndecan-2 is a novel target of insulin-like growth factor binding protein-3 and is over-expressed in fibrosis.PLoS One7:e43049. 10.1371/journal.pone.0043049
91
RyuH. Y.LeeJ.YangS.ParkH.ChoiS.JungK. C.et al (2009). Syndecan-2 functions as a docking receptor for pro-matrix metalloproteinase-7 in human colon cancer cells.J. Biol. Chem.28435692–35701. 10.1074/jbc.M109.054254
92
SahlanM.ZakoT.YohdaM. (2018). Prefoldin, a jellyfish-like molecular chaperone: functional cooperation with a group II chaperonin and beyond.Biophys. Rev.10339–345. 10.1007/s12551-018-0400-0
93
SalaniB.PassalacquaM.MaffioliS.BriatoreL.HamoudaneM.ContiniP.et al (2010). IGF-IR internalizes with Caveolin-1 and PTRF/Cavin in HaCat cells.PLoS One5:e14157. 10.1371/journal.pone.0014157
94
Schellings MarkW. M.VanhoutteD.van Almen GeertC.SwinnenM.Leenders JoostJ. G.KubbenN.et al (2010). Syndecan-1 amplifies Angiotensin II–induced cardiac fibrosis.Hypertension55249–256. 10.1161/HYPERTENSIONAHA.109.137885
95
SchnoorM.StradalT. E.RottnerK. (2018). Cortactin: cell functions of a multifaceted actin-binding protein.Trends Cell Biol.2879–98. 10.1016/j.tcb.2017.10.009
96
ShahbazianD.RouxP. P.MieuletV.CohenM. S.RaughtB.TauntonJ.et al (2006). The mTOR/PI3K and MAPK pathways converge on eIF4B to control its phosphorylation and activity.EMBO J.252781–2791. 10.1038/sj.emboj.7601166
97
ShepherdT. R.KlausS. M.LiuX.RamaswamyS.DeMaliK. A.FuentesE. J. (2010). The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.J. Mol. Biol.398730–746. 10.1016/j.jmb.2010.03.047
98
ShiY.GochuicoB. R.YuG.TangX.OsorioJ. C.FernandezI. E.et al (2013). Syndecan-2 exerts antifibrotic effects by promoting caveolin-1-mediated transforming growth factor-beta receptor I internalization and inhibiting transforming growth factor-beta1 signaling.Am. J. Respir. Crit. Care Med.188831–841. 10.1164/rccm.201303-0434OC
99
ShinJ.LeeW.LeeD.KooB.-K.HanI.LimY.et al (2001). Solution structure of the dimeric cytoplasmic domain of Syndecan-4.Biochemistry408471–8478. 10.1021/bi002750r
100
SiddiquiN.SonenbergN. (2015). Signalling to eIF4E in cancer.Biochem. Soc. Trans.43763–772. 10.1042/bst20150126
101
StrandM. E.HerumK. M.RanaZ. A.SkrbicB.AskevoldE. T.DahlC. P.et al (2013). Innate immune signaling induces expression and shedding of the heparan sulfate proteoglycan syndecan-4 in cardiac fibroblasts and myocytes, affecting inflammation in the pressure-overloaded heart.FEBS J.2802228–2247. 10.1111/febs.12161
102
SungB. H.ZhuX.KaverinaI.WeaverA. M. (2011). Cortactin controls cell motility and lamellipodial dynamics by regulating ECM secretion.Curr. Biol.211460–1469. 10.1016/j.cub.2011.06.065
103
SzklarczykD.MorrisJ. H.CookH.KuhnM.WyderS.SimonovicM.et al (2017). The STRING database in 2017: quality-controlled protein-protein association networks, made broadly accessible.Nucleic Acids Res.45D362–D368. 10.1093/nar/gkw937
104
TaniguchiT.MaruyamaN.OgataT.KasaharaT.NakanishiN.MiyagawaK.et al (2016). PTRF/Cavin-1 deficiency causes cardiac dysfunction accompanied by cardiomyocyte hypertrophy and cardiac fibrosis.PLoS One11:e0162513. 10.1371/journal.pone.0162513
105
TornavacaO.ChiaM.DuftonN.AlmagroL. O.ConwayD. E.RandiA. M.et al (2015). ZO-1 controls endothelial adherens junctions, cell–cell tension, angiogenesis, and barrier formation.J. Cell Biol.208821–838. 10.1083/jcb.201404140
106
TsoyiK.ChuS. G.Patino-JaramilloN. G.WilderJ.VillalbaJ.Doyle-EiseleM.et al (2018). Syndecan-2 attenuates radiation-induced pulmonary fibrosis and inhibits fibroblast activation by regulating PI3K/Akt/ROCK pathway via CD148.Am. J. Respir. Cell Mol. Biol.58208–215. 10.1165/rcmb.2017-0088OC
107
VanhoutteD.Schellings MarkW. M.GötteM.SwinnenM.HeriasV.Wild MartinK.et al (2007). Increased expression of Syndecan-1 protects against cardiac dilatation and dysfunction after myocardial infarction.Circulation115475–482. 10.1161/CIRCULATIONAHA.106.644609
108
WangH.LeavittL.RamaswamyR.RapraegerA. C. (2010). Interaction of syndecan and α6β4 integrin cytoplasmic domains: regulation of ErbB2-mediated integrin activation.J. Biol. Chem.28513569–13579. 10.1074/jbc.M110.102137
109
WhitefordJ. R.BehrendsV.KirbyH.Kusche-GullbergM.MuramatsuT.CouchmanJ. R. (2007). Syndecans promote integrin-mediated adhesion of mesenchymal cells in two distinct pathways.Exp. Cell Res.3133902–3913. 10.1016/j.yexcr.2007.08.002
110
WhitefordJ. R.XianX.ChaussadeC.VanhaesebroeckB.NoursharghS.CouchmanJ. R. (2011). Syndecan-2 is a novel ligand for the protein tyrosine phosphatase receptor CD148.Mol. Biol. Cell223609–3624. 10.1091/mbc.E11-02-0099
111
YooJ.JeongM. J.ChoH. J.OhE. S.HanM. Y. (2005). Dynamin II interacts with syndecan-4, a regulator of focal adhesion and stress-fiber formation.Biochem. Biophys. Res. Commun.328424–431. 10.1016/j.bbrc.2004.12.179
112
ZandonadiF. S.Castaneda Santa CruzE.KorvalaJ. (2019). New SDC function prediction based on protein-protein interaction using bioinformatics tools.Comput. Biol. Chem.83:107087. 10.1016/j.compbiolchem.2019.107087
113
ZhaoN.LiuH.LillyB. (2012). Reciprocal regulation of syndecan-2 and Notch signaling in vascular smooth muscle cells.J. Biol. Chem.28716111–16120. 10.1074/jbc.M111.322107
114
ZimmermannP.ZhangZ.DegeestG.MortierE.LeenaertsI.CoomansC.et al (2005). Syndecan recycling is controlled by syntenin-PIP2 interaction and Arf6.Dev. Cell9377–388. 10.1016/j.devcel.2005.07.011
Summary
Keywords
syndecan-2, syndecan, proteoglycans, interactome, cardiac, heart, CAVIN, junctophilin
Citation
Mathiesen SB, Lunde M, Stensland M, Martinsen M, Nyman TA, Christensen G and Carlson CR (2020) The Cardiac Syndecan-2 Interactome. Front. Cell Dev. Biol. 8:792. doi: 10.3389/fcell.2020.00792
Received
08 May 2020
Accepted
28 July 2020
Published
28 August 2020
Volume
8 - 2020
Edited by
Jeremy Turnbull, University of Liverpool, United Kingdom
Reviewed by
Jun Zhou, German Cancer Research Center (DKFZ), Germany; Sandeep Gopal, Monash University, Australia; James R. Whiteford, Queen Mary University of London, United Kingdom
Updates
Copyright
© 2020 Mathiesen, Lunde, Stensland, Martinsen, Nyman, Christensen and Carlson.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Cathrine Rein Carlson, c.r.carlson@medisin.uio.no
This article was submitted to Signaling, a section of the journal Frontiers in Cell and Developmental Biology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.