Abstract
Our understanding of how antibodies are generated and function could help develop effective vaccines and antibody-based therapeutics against viruses such as HIV-1, SARS coronavirus (SARS CoV), and Hendra and Nipah viruses (henipaviruses). Although broadly neutralizing antibodies (bnAbs) against the HIV-1 were observed in patients, elicitation of such bnAbs remains a major challenge when compared to other viral targets. We previously hypothesized that HIV-1 could have evolved a strategy to evade the immune system due to absent or very weak binding of germline antibodies to the conserved epitopes that may not be sufficient to initiate and/or maintain an effective immune response. To further explore our hypothesis, we used the 454 sequence analysis of a large naïve library of human IgM antibodies which had been used for selecting antibodies against SARS CoV receptor-binding domain (RBD), and soluble G proteins (sG) of henipaviruses. We found that the human IgM repertoires from the 454 sequencing have diverse germline usages, recombination patterns, junction diversity, and a lower extent of somatic mutation. In this study, we identified antibody maturation intermediates that are related to bnAbs against the HIV-1 and other viruses as observed in normal individuals, and compared their genetic diversity and somatic mutation level along with available structural and functional data. Further computational analysis will provide framework for understanding the underlying genetic and molecular determinants related to maturation pathways of antiviral bnAbs that could be useful for applying novel approaches to the design of effective vaccine immunogens and antibody-based therapeutics.
Introduction
Broadly neutralizing antibodies (bnAbs) against the HIV-1 are relatively rarely observed in patients; however, discovering HIV-1 vaccine candidates to elicit such bnAbs remains a challenge due to the extensive genetic sequence variability and complex immune evasion strategies of the HIV-1 (Burton, 2002; Johnson and Desrosiers, 2002; Haynes and Montefiori, 2006; Prabakaran et al., 2007). Among the different factors thwarting the induction of bnAbs, we previously found that all known HIV-1 bnAbs are highly divergent from germline antibodies; germline antibodies of bnAbs could not bind to the epitopes of respective mature antibodies, which led to a hypothesis that HIV-1 may have evolved to use the “holes” (absence of or weak binding to germline-lineaged bnAbs) in the human germline B cell receptor repertoire (Xiao et al., 2009). Consistent with our earlier hypothesis, we did not find any specific binders against the HIV-1 envelope glycoproteins (Envs) but only identified binders against the SARS CoV receptor-binding domain (RBD), and soluble Hendra virus G protein (sG) when combinatorial phage display libraries mimicking human antibody repertoire constructing from human IgM libraries had been used for panning experiments (Chen et al., 2012). These findings had indicated that the major problem could be related to a high level of somatic mutations required for bnAbs to accurately target the conserved structures on the HIV-1 Envs.
In this article, we have used high-throughput 454 sequencing of a large naïve library of human IgM antibodies to explore antibody repertoire landscape for finding germline usages, somatic mutations, intermediates, and phylogenetic relationships between the intermediates and corresponding antiviral-related bnAbs including the HIV-1, SARS CoV, and henipaviruses. This study helped to identify germline predecessors of bnAbs observed in normal individuals, and find maturation pathways of antiviral bnAbs. Indeed, most of the known HIV-1 bnAbs are highly divergent from their closest respective germlines as well as their intermediates as they undergo somatic mutations required for their neutralization function. The results corroborate that the HIV-1 may use a strategy to eliminate strong binding of germline antibodies due to the absence of closer anti-HIV antibody intermediates as an escape mechanism from adaptive immune responses, and finding of closer intermediates of bnAbs from rare individuals might help designing the effective vaccines against the HIV-1 and other viral diseases.
Materials and methods
PCR amplification and high-throughput 454 sequencing
To amplify IgM antibody sequences, cDNA was prepared from peripheral blood B cells of 10 healthy donors as received under the Research Donor Program of Frederick National Laboratory for Cancer Research, USA, which we previously used to construct a naïve human Fab phage display library for selecting antibodies against SARS CoV and henipaviruses. The complete set of primers used in the PCR amplification of IgM-derived heavy and light chains were described in detail elsewhere (Zhu and Dimitrov, 2009). For 454 sequencing, primer combinations used to amplify cDNA in separate reactions included the Roche A and B adaptor sequences along with target amplification sequence for heavy and light chain variable domains. The gene fragments were amplified in 20 cycles of PCR using the High Fidelity PCR Master from Roche. More detailed description of 454 sequencing can be found in our recent articles (Prabakaran et al., 2011, 2012). The standard Roche 454 GS Titanium shotgun library protocol was adapted as found in the Roche sequencing technical bulletin.
Databases and tools
For quality control of antibody sequences, we trimmed the 454 sequence data and retained only sequences of length more than 300 nucleotides (nt), covering the entire antibody variable domains consisting of the three complementarity determining regions (CDR) along with framework regions (FR). We used IMGT/HighV-QUEST (Alamyar et al., 2012), a high-throughput version for deep sequencing NGS data analysis resource for the immunogenetic analysis. The output results from the IMGT/HighV-QUEST analysis in CSV files were stored at PostgreSQL database, and Structured Query Language (SQL) was used to retrieve the data for the further analysis. Heatmap generation and statistical calculations involving distributions of antibody HCDR3 lengths and mutations were carried out using SAS JMP10® statistical software (SAS Institute, Cary, NC).
Computational analyses of antibody sequences
Translated heavy and light chain variable sequences from the 454 sequencing that shared the IGHV genes of selected antiviral antibodies and associated immunogenetics data including the details of germlines, HCDR3 lengths, and mutations were retrieved from the database by using SQL. Sequence identities between the 454 sequence data and germlines were calculated based on the pairwise alignment using local BLAST as implemented in BioEdit v7.0.9 (Hall, 1999). Phylogenetic analysis was carried out using the Archaeopteryx software (Han and Zmasek, 2009).
Results
Germline gene usages of antiviral bnAbs
To analyze germline origin of antiviral antibodies against the HIV-1, SARS CoV, and henipaviruses as expressed in the human IgM repertoire, we performed 454 sequencing of a non-immune library which was previously constructed from peripheral blood B cells of 10 healthy donors and used to select antibodies against SARS CoV and henipaviruses (Prabakaran et al., 2006; Zhu et al., 2006). A total of 113,139 sequences were obtained from which 91,528 sequences were found as unique with each had >300 nt in length. The total number of unique amino acid (aa) sequences for each V-gene subgroup in heavy and light chains that were found functionally productive as determined by IMGT/HighV-QUEST (Alamyar et al., 2012) are shown in Figures 1A,B, respectively. The read coverage or gene frequencies observed in the study suggested for biased germline usages and were comparable to the previous studies (Glanville et al., 2009; Prabakaran et al., 2012) but way far less than the theoretical diversity attainable by antibodies attributing to several factors such as library sampling, primer efficiency, and sequencing errors and limitations. Nevertheless, we selected known bnAbs against the viral targets including the HIV-1, SARS CoV, and henipaviruses (Table 1), and created sequence data sets related to those bnAbs from the 454 analysis as depicted in Figures 1C,D showing the germline usage frequencies of IGHV genes in the VH domains, IGKV, and IGLV genes in the Vκ and Vλ domains, respectively. We found that while all antiviral-related germlines were expressed in human IgM repertoire, some preferential germline usages were noted, for example, HV1-69 gene in IGHV subgroups and KV3-20/LV2-14 genes in IGKV/IGLV subgroups were overrepresented (Figures 1C,D).
Figure 1
Table 1
| bnAb | Viral Env target | PDB code | IGHV gene | IGKV/IGLV gene | Number of aa mutations (Identity/Similarity in percent)a | HCDR3 aa sequence (length)b | |
|---|---|---|---|---|---|---|---|
| VH | VL | ||||||
| b12 | gp120 CD4bs | 2NY7 | V1-3*01 | KV3-20*01 | 20 (80/88) | 21 (78/70) | ARVGPYSWDDSPQDNYYMDV (20) |
| 2G12 | gp120 glycans | 1OP5 | V3-21*01 | KV1-5*03 | 31 (68/85) | 15 (83/91) | ARKGSDRLSDNDPFDA (16) |
| X5 | gp120 CD4i | 2B4C | V1-69*01 | KV3-20*01 | 18 (83/94) | 8 (92/95) | ARDFGPDWEDGDSYDGSGRGFFDF (24) |
| VRC01 | gp120 CD4bs | 3NGB | V1-2*02 | KV3-11*01 | 41 (58/74) | 28 (68/75) | TRGKNCDYNWDFEH (14) |
| PG9 | gp120 V1/V2 | 3U2S | V3-33*05 | LV2-14*01 | 19 (81/87) | 15 (85/90) | VREAGGPDYRNGYNYYDFYDGYYNYHYMDV (30) |
| CH01 | gp120 V1/V2 | 3TCL | V3-20*01 | KV3-20*01 | 28 (71/86) | 16 (83/90) | ARGTDYTIDDAGIHYQGSGTFWYFDL (26) |
| PGT128 | gp120 glycans | 3TV3 | V4-39*07 | LV2-8*01 | 29 (65/81) | 18 (77/87) | ARFGGEVLRYTDWPKPAWVDL (21) |
| 2F5 | gp41 MPER | 1TJG | V2-5*10 | KV1-13*02 | 14 (85/91) | 14 (85/96) | AHRRGPTTLFGVPIARGPVNAMDV (24) |
| 4E10 | gp41 MPER | 1TZG | V1-69*10 | KV3-20*01 | 17 (83/95) | 12 (88/93) | AREGTTGWGWLGKPIGAFAH (20) |
| m66 | gp41 MPER | ND | V5-51*01 | KV1-39*01 | 10 (90/96) | 10 (90/94) | ARQNHYGSGSYFYRTAYYYAMDV (23) |
| m102 | Henipa sG | ND | V1-69*10 | KV3-20*01 | 6 (94/99) | 9 (91/96) | ARGWGREQLAPHPSQYYYYYYGMDV (25) |
| m396 | SARS RBD | 2DD8 | V1-69*05 | LV3-21*03 | 5 (95/95) | 2 (98/99) | ARDTVMGGMDV (11) |
Antiviral bnAbs against the HIV-1, SARS CoV and Henipaviruses, and their related sequence, structure, and immunogenetics data.
Number of heavy chain (VH) aa mutations were determined by IMGT/V-QUEST and confined to the V region only (excluding HCDR3 and Framework 4); Identity and similarity between aa sequences of bnAb and its germline counterpart were based on pairwise alignment using the Needleman-Wunsch algorithm.
HCDR3, heavy chain complementarity determining region 3, lengths follow the CDR-IMGT definition. bnAb, broadly neutralizing antibody; CD4bs, CD4 binding site; CD4i, CD4-induced; V1/V2, variable loops V1 and V2; MPER, membrane proximal epitope region; sG, soluble G glycoprotein; RBD, receptor binding domain; PDB, Protein Data Bank; ND, not determined; IGHV, IGKV and IGLV genes are V-REGIONS from VH, V-KAPPA and V-LAMBDA domains respectively; aa, amino acids.
HCDR3 length distributions, somatic VH mutations and unique VDJ frequencies
The role of heavy chains of antiviral antibodies in antigen recognition is found to be associated with longer HCDR3s and extensive VH mutations (Table 1). Most of the bnAbs have longer HCDR3s with aa lengths ranging from 20 to 30, except for 2G12, VRC01 and m396. All of the VH genes of anti-HIV-1 antibodies have a high degree of somatic mutations when compared to non-HIV-1 antiviral bnAbs. We analyzed HCDR3 length distributions and VH mutations preexisting in germline-lineaged precursor antiviral antibodies from the IGHV genes of IgM repertoires from which bnAbs were generated. The box plots display the distributions of HCDR3 lengths and VH mutations, Figures 2A,B, respectively, which indicates a high level HCDR3 length diversity and lesser extent of somatic mutations compared to bnAbs (Table 1).
Figure 2
To assess the VDJ repertoire usage among different antiviral related IGHV genes, we computed the frequencies of VDJ recombination patterns as observed in the VH genes expressed in human IgM repertoire involving those IGHV genes of antiviral antibodies. The heatmap is shown in the Figure 3 depicting the most (red) and least (blue) abundant VDJ types existing in the germline-lineaged repertoire for the corresponding IGHV genes used in association with different IGHD and IGHJ genes. The IGHV genes V1-69 and V1-2 were frequently found to recombine with IGHJ genes J4 and J6, and IGHD genes D3 and D6.
Figure 3
Identification of intermediate antiviral bnAbs and germline-linage analysis
The intermediate antibodies corresponding to bnAbs against the HIV-1, SARS CoV, and henipaviruses were found by analyzing the human IgM repertoire, and such intermediates with the closest similarities to the matured antiviral bnAbs were selected for germline-linage analysis by using phylogenetic method. IGHV germline gene alleles of bnAbs were obtained from the IMGT database. The mid-point phylogenetic neighbor-joining tree showing the evolutionary relationships of different antiviral antibodies with their corresponding germlines and intermediates is given in Figure 4. We observed that some of the anti-HIV-1 antibodies (2G12, CH01, and VRC01) were found at distal nodes in the phylogenetic tree indicating high divergence from their corresponding germline and intermediate counterparts. In contrast, bnAbs against SARS CoV, and henipaviruses, m396 and m102, were found closer to their intermediates.
Figure 4
Analysis of intermediates of anti-HIV-1 bnAb b12 and mapping of somatic VH mutations to the complex structure
We found 169 unique IGHV sequences from the V1-3 gene family as intermediates of bnAb b12 by using the 454 sequence analysis of a human IgM library. Phylogenetic analysis of those intermediates revealed two major groups, one group consisting of germline related antibodies and the other having potential intermediates closer to the bnAb b12. We then constructed a phylogenetic sub-tree selecting only the potential intermediates and the V1-3*01 germline along with bnAb 12. The tree was rooted at the known germline V1-3*01 of bnAb b12, and phylogram showed evolutionary relationship among the different intermediates (Figure 5A). One of the intermediates, G3JY1, had the maximum of 72% sequence identity (82% sequence similarity) at aa level to the bnAb b12 (Figure 5B). However, the HCDR3 length of that intermediate was found to be 17 aa long, which is 3 aa shorter than that of b12 antibody. To find the closest HCDR3 to that of b12, we scanned 28,925 unique HCDR3 sequences from the entire IgM 454 sequence data. We identified a HCDR3 with the same length (20 aa) and 50% sequence identity to that of b12 (Figure 5C), which was found to be the most similar to the HCDR3 of b12 but the IGHV gene associated with that HCDR3 was found to be V4-b. We used the HIV-1 gp120-b12 complex structure and mapped the VH somatic mutations, which showed the overlapping of three mutated residues of b12 (N36 from HCDR1, Y59 from HCDR2, and W111.1 from HCDR3) that contribute to the most of binding interactions with the gp120 as previously observed (Zhou et al., 2007) (Figure 5D).
Figure 5
Discussion
In this study, we have described the 454 sequence analysis of a large naïve library of human IgM antibodies, and carried out immunogenetic analysis to study the origin, diversity, and maturation of selected known bnAbs against the HIV-1, SARS CoV RBD, and henipaviruses sG proteins. We have found intermediates of antiviral related bnAbs, of which most of those against the HIV-1 were highly diverged from their mature forms of bnAbs as compared to other viral targets, SARS CoV, and henipaviruses.
Although antibodies are generated through various mechanisms involving VDJ recombination, junctional modification, and hypermutations, the V-genes sculpt the most of the antigen-combining sites, CDR1 and CDR2, and support frameworks for the CDR3. We found that antiviral antibodies targeting different Env binding regions of the HIV-1 and other viruses utilized different germline V-genes as the origins (Table 1). We noted that, among antiviral-related bnAbs, the V1-69 gene usage was dominated in the heavy chains while V3-20 and V2-14 genes of kappa and lambda were used with the highest frequencies in the light chains of human IgM repertoire (Figure 1). Accordingly, four of the VH genes of bnAbs (4E10, X5, m102, and m396) originated from the V1-69, and three of them paired with the kappa V3-20 gene. One possible reason for dominance in the usage of those germline genes could be reflecting from the relatively higher frequencies of distributions observed in the expressed IgM repertoire (Figures 1A,B). The HV3 gene was used in the three of the HIV-1 bnAbs, 2G12, PG9, and CH01. The structural data for most of the bnAbs selected in this analysis were known and the heavy chains of these bnAbs were dominantly used. The increased number of VH mutations and longer HCDR3s are characteristics for the HVI-1 bnAbs when compared to other antiviral bnAbs (Breden et al., 2011). We analyzed the distribution of HCDR3 lengths and extent of somatic VH mutations in the human IgM repertoire to compare with that of antiviral-related bnAbs (Figure 2). The results showed that the longer HCDR3s and low level of somatic VH mutations as compared to the HIV-1 bnAbs existed in the intermediates as found from the 454 sequencing. The somatic diversity through VDJ recombination involving antiviral-related V-genes in the IgM repertoire was found high; the most abundant VDJ combination consisted of the HV1-69 gene with certain D and J genes as depicted in gray and red (Figure 3), which might be the reason for the preferential usage of that HV1-69 in many other viral diseases (Sui et al., 2009).
Further, bnAbs against the SARS CoV and henipaviruses shared the heavy chain V-gene germline, HV1-69, with two of the HIV-1 bnAbs, 4E10, and X5. All of these four bnAbs were less divergent from their V-germlines and intermediates, when compared to other HIV-1 bnAbs, and formed a single cluster at a mid-point rooted phylogenetic tree (Figure 4). The gp41 membrane-proximal epitope region (MPER) binding site bnAbs, 2F5, and m66, were moderately divergent from their V-germlines and intermediates and formed distinct clusters. The V-gene of VRC01 bnAb was the most divergent from its respective germline as well as the closest intermediate, and was placed at a distal branch of HV1 subgroup of bnAbs. For the mid-point rooted phylogenetic analysis, we included the closest intermediates only; however, favored maturation pathways could involve other intermediates too. We created the germline-rooted phylogenetic tree as a use-case for the bnAb b12 (Figure 5A) and analyzed the maturation pathway along different V-gene intermediates from HV1-3 gene family. The closest b12 intermediate, designated as G3JY1, had three mutations each at HCDR1 and HCDR2 compared to the germline, and were found similar though not identical to that of mature b12 (Figure 5B). Interestingly, we also identified a HCDR3 with the same length (20 aa) and 50% sequence identity to that of b12 (Figure 5C), which was found to be the most similar to the HCDR3 of b12 but the IGHV gene associated with that HCDR3 was found to be V4-b. This might suggest for the possible maturation mechanism of bnAbs which could be involving the VH replacement (Chen et al., 1995). These two mutated residues (N36 from HCDR1 and Y59 from HCDR2) from the V-gene and a Trp residue from the D-gene (W111.1 from HCDR3) contributed to the most of binding interactions with the gp120 (Figure 5D) (Zhou et al., 2007).
In summary, the 454 sequence analysis of a large naïve human antibody repertoire corresponding to the selected antiviral-related bnAbs revealed the germline V-gene usage, VDJ rearrangement, HCDR3 length diversity, and somatic mutations of potential intermediate antibodies of HIV-1 and other viruses such as SARS CoV and henipaviruses. Thus, B cell germline-lineage analysis using the 454 sequence data from different sources could help finding appropriate antibody intermediates, pathways, and mechanisms useful in the development of bnAbs and vaccines against the HIV-1 and other viral diseases.
Conflict of interest statement
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Statements
Acknowledgments
We thank the Laboratory of Molecular Technology of SAIC-Frederick Inc. for providing Roche 454 sequencing service. We are grateful to Eltaf Alamyar and to the IMGT® team for providing access to IMGT/HighV-QUEST. We thank Ms. Maria G. Singarayan for constructing the PostgreSQL database and JAVA applications and helping with SQL. This research was supported by the Intramural Research Program of the NIH, National Cancer Institute, Center for Cancer Research, and by Federal funds from the NIH, National Cancer Institute, under Contract No. NO1-CO-12400. The content of this publication does not necessarily reflect the views or policies of the Department of Health and Human Services, nor does the mention of trade names, commercial products, or organizations imply endorsement by the US Government.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
References
1
AlamyarE.GiudicelliV.LiS.DurouxP.LefrancM.-P. (2012). IMGT/HighV-QUEST: the IMGT web portal for immunoglobulin (IG) or antibody and T cell receptor (TR) analysis from NGS high throughput and deep sequencing. Immunome Res. 8, 1–15.
2
BredenF.LepikC.LongoN. S.MonteroM.LipskyP. E.ScottJ. K. (2011). Comparison of antibody repertoires produced by HIV-1 infection, other chronic and acute infections, and systemic autoimmune disease. PloS ONE6:e16857. 10.1371/journal.pone.0016857
3
BurtonD. R. (2002). Antibodies, viruses and vaccines. Nat. Rev. Immunol. 2, 706–713. 10.1038/nri891
4
ChenC.NagyZ.PrakE. L.WeigertM. (1995). Immunoglobulin heavy chain gene replacement: a mechanism of receptor editing. Immunity3, 747–755.
5
ChenW.StreakerE. D.RussD. E.FengY.PrabakaranP.DimitrovD. S. (2012). Characterization of germline antibody libraries from human umbilical cord blood and selection of monoclonal antibodies to viral envelope glycoproteins: implications for mechanisms of immune evasion and design of vaccine immunogens. Biochem. Biophys. Res. Commun. 417, 1164–1169. 10.1016/j.bbrc.2011.12.089
6
GlanvilleJ.ZhaiW.BerkaJ.TelmanD.HuertaG.MehtaG. R.NiI.MeiL.SundarP. D.DayG. M.CoxD.RajpalA.PonsJ. (2009). Precise determination of the diversity of a combinatorial antibody library gives insight into the human immunoglobulin repertoire. Proc. Natl. Acad. Sci. U.S.A. 106, 20216–20221. 10.1073/pnas.0909775106
7
HallT. A. (1999). BioEdit: a user-friendly biological sequence alignment editor and analysis program for Windows 95/98/NT. Nucl. Acids. Symp. Ser. 41, 95–98.
8
HanM. V.ZmasekC. M. (2009). phyloXML: XML for evolutionary biology and comparative genomics. BMC Bioinformatics10, 356. 10.1186/1471-2105-10-356
9
HaynesB. F.MontefioriD. C. (2006). Aiming to induce broadly reactive neutralizing antibody responses with HIV-1 vaccine candidates. Expert. Rev. Vaccines5, 579–595.
10
JohnsonW. E.DesrosiersR. C. (2002). Viral persistance: HIV's strategies of immune system evasion. Annu. Rev. Med. 53, 499–518. 10.1146/annurev.med.53.082901.104053
11
PrabakaranP.ChenW.SingarayanM. G.StewartC. C.StreakerE.FengY.DimitrovD. S. (2012). Expressed antibody repertoires in human cord blood cells: 454 sequencing and IMGT/HighV-QUEST analysis of germline gene usage, junctional diversity, and somatic mutations. Immunogenetics64, 337–350. 10.1007/s00251-011-0595-8
12
PrabakaranP.DimitrovA. S.FoutsT. R.DimitrovD. S. (2007). Structure and function of the HIV envelope glycoprotein as entry mediator, vaccine immunogen, and target for inhibitors. Adv. Pharmacol. 55, 33–97. 10.1016/S1054-3589(07)55002-7
13
PrabakaranP.GanJ.FengY.ZhuZ.ChoudhryV.XiaoX.JiX.DimitrovD. S. (2006). Structure of severe acute respiratory syndrome coronavirus receptor-binding domain complexed with neutralizing antibody. J. Biol. Chem. 281, 15829–15836. 10.1074/jbc.M600697200
14
PrabakaranP.StreakerE.ChenW.DimitrovD. S. (2011). 454 antibody sequencing – error characterization and correction. BMC Res. Notes4, 1–7. 10.1186/1756-0500-4-404
15
SuiJ.HwangW. C.PerezS.WeiG.AirdD.ChenL. M.SantelliE.StecB.CadwellG.AliM.WanH.MurakamiA.YammanuruA.HanT.CoxN. J.BankstonL. A.DonisR. O.LiddingtonR. C.MarascoW. A. (2009). Structural and functional bases for broad-spectrum neutralization of avian and human influenza A viruses. Nat. Struct. Mol. Biol. 16, 265–273. 10.1586/eri.09.48
16
XiaoX.ChenW.FengY.ZhuZ.PrabakaranP.WangY.ZhangM. Y.LongoN. S.DimitrovD. S. (2009). Germline-like predecessors of broadly neutralizing antibodies lack measurable binding to HIV-1 envelope glycoproteins: implications for evasion of immune responses and design of vaccine immunogens. Biochem. Biophys. Res. Commun. 390, 404–409. 10.1016/j.bbrc.2009.09.029
17
ZhouT.XuL.DeyB.HessellA. J.Van RykD.XiangS. H.YangX.ZhangM. Y.ZwickM. B.ArthosJ.BurtonD. R.DimitrovD. S.SodroskiJ.WyattR.NabelG. J.KwongP. D. (2007). Structural definition of a conserved neutralization epitope on HIV-1 gp120. Nature445, 732–737. 10.1038/nature05580
18
ZhuZ.DimitrovA. S.BossartK. N.CrameriG.BishopK. A.ChoudhryV.MungallB. A.FengY. R.ChoudharyA.ZhangM. Y.FengY.WangL. F.XiaoX.EatonB. T.BroderC. C.DimitrovD. S. (2006). Potent neutralization of Hendra and Nipah viruses by human monoclonal antibodies. J. Virol. 80, 891–899. 10.1128/JVI.80.2.891-899.2006
19
ZhuZ.DimitrovD. S. (2009). Construction of a large naive human phage-displayed Fab library through one-step cloning. Methods Mol. Biol. 525, 129–142. xv. 10.1007/978-1-59745-554-1_6
Summary
Keywords
HIV-1, vaccine, monoclonal antibody, IgM, immunogen, 454 sequencing
Citation
Prabakaran P, Zhu Z, Chen W, Gong R, Feng Y, Streaker E and Dimitrov DS (2012) Origin, diversity, and maturation of human antiviral antibodies analyzed by high-throughput sequencing. Front. Microbio. 3:277. doi: 10.3389/fmicb.2012.00277
Received
30 May 2012
Accepted
17 July 2012
Published
02 August 2012
Volume
3 - 2012
Edited by
Hironori Sato, National Institute of Infectious Diseases, Japan
Reviewed by
Takamasa Takeuchi, National Institute of Infectious Diseases, Japan; Shuzo Matsushita, Kumamoto University, Japan
Copyright
© 2012 Prabakaran, Zhu, Chen, Gong, Feng, Streaker and Dimitrov.
This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits use, distribution and reproduction in other forums, provided the original authors and source are credited and subject to any copyright notices concerning any third-party graphics etc.
*Correspondence: Ponraj Prabakaran, CCR Nanobiology Program, Protein Interactions Group, Frederick National Laboratory for Cancer Research, National Institutes of Health (NIH), Bldg 469, Rm 140, Frederick, MD 21702, USA. e-mail: prabakaran.ponraj@nih.gov
This article was submitted to Frontiers in Virology, a specialty of Frontiers in Microbiology.
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.