REVIEW article

Front. Microbiol., 13 April 2021

Sec. Microbial Immunology

Volume 12 - 2021 | https://doi.org/10.3389/fmicb.2021.643639

Fungal Toxins and Host Immune Responses

  • Centre for Host-Microbiome Interactions, Faculty of Dentistry, Oral & Craniofacial Sciences, King’s College London, London, United Kingdom

Fungi are ubiquitous organisms that thrive in diverse natural environments including soils, plants, animals, and the human body. In response to warmth, humidity, and moisture, certain fungi which grow on crops and harvested foodstuffs can produce mycotoxins; secondary metabolites which when ingested have a deleterious impact on health. Ongoing research indicates that some mycotoxins and, more recently, peptide toxins are also produced during active fungal infection in humans and experimental models. A combination of innate and adaptive immune recognition allows the host to eliminate invading pathogens from the body. However, imbalances in immune homeostasis often facilitate microbial infection. Despite the wide-ranging effects of fungal toxins on health, our understanding of toxin-mediated modulation of immune responses is incomplete. This review will explore the current understanding of fungal toxins and how they contribute to the modulation of host immunity.

Introduction

Mycotoxins are natural secondary metabolites produced by fungi which grow on a variety of agricultural products including cereals, grains, nuts, spices, apples, dried fruits, and coffee beans (Ukwuru et al., 2017). It is estimated that 20–25% of food crops worldwide contain mycotoxin contamination (Eskola et al., 2020) while mycotoxins and mycotoxin-producing fungi are frequently isolated from construction materials and air samples from water-damaged buildings (Tuomi et al., 2000).

The majority of mycotoxins are synthesised by enzymes present in biosynthetic gene clusters whose first enzyme is a polyketide synthase or a non-ribosomal peptide synthetase (or a mixture of both), with the exception of candidalysin and mucoricin [peptide and protein toxins encoded by ECE1 and RLT1 genes, respectively (Gallo et al., 2013; Moyes et al., 2016; Soliman et al., 2021)]. The gut is typically the first point of contact between ingested mycotoxins and the host. The gastrointestinal mucosa (GIM) is a single layer of epithelial cells which are physically connected to one another by desmosomes, tight junctions and adherens junctions. The GIM is colonised by a diverse range of bacteria, archaea, and eukarya which play a critical role in the maintenance of general health. While the protective barrier of the GIM serves to restrict the movement of microbes and toxic substances from the gastrointestinal lumen into the systemic compartment, compromised barrier function and alterations in the composition of the resident microbiota may predispose to disease. The deleterious impact of mycotoxin-induced alterations on intestinal barrier function are reviewed in Gao et al. (2020a).

Mycotoxins can influence the gastrointestinal microbiota directly through antimicrobial activity and through secondary mechanisms involving the release of antimicrobial compounds from mycotoxin-damaged host cells. Numerous studies have investigated the impact of mycotoxins on host microbiota in vivo (Guerre, 2020). Conversely, the microbiota can also influence the bioavailability of ingested mycotoxins and their associated metabolites. Mycotoxins can be detoxified through biotransformation (Li et al., 2020) and physically sequestered by direct adsorption onto microbial cell walls which impairs their absorption across the gut. However, it is also worth noting that the process of biotransformation may also generate compounds that are potentially toxic. One notable example of this phenomenon is the bioactivation of “masked” mycotoxins. Plants protect themselves from mycotoxins in a process which typically involves the conversion of mycotoxins into compounds with reduced toxicity (referred to as “masked” mycotoxins) which remain stored in plant tissue. Should plant material containing masked mycotoxins be ingested, host processes and/or the biological activity of the resident microbiota can liberate functional mycotoxins (and related metabolites) which may have detrimental consequences (Berthiller et al., 2013; Gratz, 2017; Gratz et al., 2017).

The predominant routes of exposure to mycotoxins are ingestion and inhalation. However, recent research indicates that some mycotoxins and peptide/protein toxins are associated with fungal infection and contribute to pathogenicity. Fungal diseases are a major cause of morbidity and mortality in the global population and account for an estimated 1.5 million deaths per year (Brown et al., 2012). Compromised immunity and iatrogenic procedures such as gastrointestinal surgery and immunosuppressive therapy are risk factors for the development of life-threatening systemic infections. The saprophytic mould Aspergillus fumigatus produces gliotoxin which is detectable in the lungs of patients with invasive aspergillosis (IA; Lewis et al., 2005) while the production of candidalysin by Candida albicans contributes to mucosal and systemic disease in a range of experimental models (Naglik et al., 2019).

Innate and adaptive immunity are critical for the control and elimination of infecting microbes. The mucosal barriers of the body, together with immune cells, serve to protect underlying tissues from pathogenic insult and play an active role in microbial recognition and defence. Mucosal surfaces activate and orchestrate cellular responses to microbial infection through the production of cytokines and alarmins which drive the recruitment of specialised innate and adaptive immune cells including macrophages, neutrophils, dendritic cells and T cells to combat invading microbes. However, the majority of mycotoxins have a deleterious effect on the structural integrity of mucosal barriers and are capable of suppressing cellular immunity. Accordingly, toxin-mediated alterations in innate and adaptive host defences may increase susceptibility to infection by pathobionts present in the resident microbiota. This review will explore the impact of mycotoxins, peptide, and protein toxins on the modulation of host immune defence.

Gliotoxin

Gliotoxin ((3R,6S,10aR)-6-hydroxy-3-(hydroxymethyl)-2-methyl −2,3,6,10-tetrahydro-5aH-3,10a-epidithiopyrazino[1,2-a]indole -1,4-dione: Figure 1A) is a member of the epipolythiodioxopiperazine (ETP) class of toxins. Numerous studies have suggested that the toxicity of ETP toxins and gliotoxin in particular may be, in part, underpinned by redox cycling of the disulphide bridge which can generate damaging reactive oxygen species (ROS) and drive the formation of mixed disulphide bonds with host proteins (Chai and Waring, 2000). Although gliotoxin was first characterised in the fungal genus Gliocladium (Weindling and Emerson, 1936; Weindling, 1941), the fungus most closely associated with gliotoxin is A. fumigatus, which causes a range of life-threatening respiratory and systemic infections in patients with compromised immunity. Gliotoxin is detectable in the serum of patients with IA and in the lungs and serum of mice with experimentally induced IA (Lewis et al., 2005) suggesting an association with active infection.

FIGURE 1
www.frontiersin.org

Figure 1. Chemical structure of common mycotoxins. (A) Gliotoxin (C13H14N2O4S2) is a member of the epipolythiodioxopiperazine family of mycotoxins and is produced by Aspergillus fumigatus. (B) Aflatoxin B1 (C17H12O6) produced by A. flavus and A. parasiticus. (C) Ochratoxin A (C20H18CINO6) is a phenylalanine derivative produced by several species of the genera Aspergillus and Penicillium. (D) Fumonisin B1 (C34H59NO15) is characterised by diester and triol functional groups and is produced by species of the genus Fusarium. The trichothecenes family include: (E) The type A trichothecene T-2 (C24H34O9) and (F) The type B trichothecene Deoxynivalenol (C15H20O6). T-2 and Deoxynivalenol are produced by numerous genera of fungi including Fusarium, Stachybotrys, and Trichoderma. (G) Patulin (C7H6O4) is produced by species of the genera Aspergillus and Penicillium. (H) Zearalenone (C18H22O5) is produced by species of the genera Fusarium and Gibberella.

Epithelial Cells and Gliotoxin

The germination of A. fumigatus conidia and subsequent invasion into the respiratory epithelium is a critical step which promotes infection. Gliotoxin promotes cytoskeletal remodelling in human alveolar epithelial cells in vitro which facilitates the internalisation of A. fumigatus conidia (Jia et al., 2014; Zhang et al., 2019). Fungal burdens present in the lung tissue of immunosuppressed mice infected with an A. fumigatus gliPΔ mutant unable to produce gliotoxin were significantly reduced compared with wild-type fungus, and the invasive capacity of the gliPΔ mutant was partially restored following the addition of exogenous gliotoxin which correlated with increased mortality (Jia et al., 2014; Zhang et al., 2019). Murine embryonic fibroblasts exposed to 1 μM gliotoxin in vitro undergo apoptosis in a Bcl-2 homologous antagonist/killer (Bak) dependent manner (Pardo et al., 2006), while immunosuppressed Bak–/– mice that received an intranasal inoculation of gliotoxin-producing A. fumigatus were more resistant to infection compared with wild-type controls, highlighting the role of Bak as critical factor involved in gliotoxin-mediated cell death (Pardo et al., 2006). The application of gliotoxin or exhausted culture medium from wild-type A. fumigatus but not a gliotoxin-defective mutant induces apoptosis in human bronchial epithelial cells, and in murine fibroblasts and alveolar epithelial cells in a c-Jun N-terminal kinase (JNK) pathway-dependent manner (Geissler et al., 2013).

Macrophages and Gliotoxin

Gliotoxin induces apoptosis and cytoskeletal changes that affect macrophage function. Macrophages exposed to 0.3–3 μM gliotoxin in vitro undergo DNA fragmentation and apoptosis within 5 h (Waring et al., 1988; Suen et al., 2001). The phagocytic ability of macrophages is significantly diminished through the specific targeting of phosphoinositides. Phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) is an important component involved in cytoskeletal remodelling in macrophages during phagocytosis (Levin et al., 2015). Gliotoxin (1.53 μM) induces the dissociation of PtdIns(3,4,5)P3 from primary human and murine RAW 264.7 macrophage plasma membranes which promoted cytoskeletal reorganisation, inhibition of lamellipodia formation, and phagocytosis of zymosan (Schlam et al., 2016).

Cytokines are key molecules in the coordination of immune responses and gliotoxin has been shown to affect cytokine expression and release from macrophages. Gliotoxin (0–4.6 μM) modulates the secretion of interleukin (IL)-6, IL-10, and tumour necrosis factor (TNF)-α from lipopolysaccharide (LPS)-stimulated human MM6 monocytes in vitro (Johannessen et al., 2005) while concentrations as low as 107 nM induce apoptosis (Stanzani et al., 2005). Further evidence for the inhibition of cytokine responses is provided by studies in which LPS-stimulated rat macrophages treated with 0.3–3 μM gliotoxin exhibited a reduction in the level of TNF-α secretion in vitro (Fitzpatrick et al., 2000).

Recent research has highlighted a critical role for macrophages in toxin surveillance and the maintenance of barrier function in the distal colon. Murine colonocytes are protected from the toxicity of gliotoxin, T-2 toxin and candidalysin by a population of CD11chigh subepithelial macrophages which form specialised “balloon-like” protrusions (BLPs) in response to local fungi, and use them to interact with the distal colonic epithelium where they limit the absorption of toxic materials (Chikina et al., 2020). Strikingly, in mice that are depleted for these macrophages, the distal colonic epithelium continues to absorb toxin-containing fluids and undergoes apoptosis concomitant with a loss of barrier integrity. These observations suggest that the BLPs enable colonic epithelial cells to differentiate between harmless and harmful substances and identify CD11chigh subepithelial macrophages as central mediators of colonic barrier function and local responses to fungal toxins in vivo (Chikina et al., 2020).

Neutrophils and Gliotoxin

Neutrophils play a major role in the control of fungal infection. Human neutrophils treated with concentrations (92–306 nM) of gliotoxin found in the blood of patients with IA were unable to phagocytose zymosan or serum-opsonised zymosan and exhibited cytoskeletal re-organisation (Coméra et al., 2007). Similarly, isolated polymorphonuclear leukocytes exposed to 107 nM gliotoxin exhibited reduced production of ROS within 30 min (Orciuolo et al., 2007).

The production of neutrophil extracellular traps (NETs) occurs in response to the presence of invading fungi that are too large to be phagocytosed, and the NADPH oxidative burst promotes the formation of NETs in an in vivo model of pulmonary aspergillosis (Almyroudis et al., 2013, Röhm et al., 2014). Gliotoxin has been shown to inhibit assembly of the NADPH oxidase in human neutrophils (Tsunawaki et al., 2004).

In vivo, immunosuppressed neutropenic mice infected with an A. fumigatus ΔgliZ mutant unable to produce gliotoxin exhibited a non-significant improvement in survival after seven days when compared with wild-type controls (Bok et al., 2006). Additionally, a significant increase in the survival of neutropenic mice was observed following disruption of the A. fumigatus transcriptional regulator LaeA, which was associated with decreased production of gliotoxin and an increased susceptibility to phagocytosis (Bok et al., 2005). No difference in survival was observed between groups of neutropenic mice infected with wild-type A. fumigatus conidia or a ΔgliP mutant unable to produce gliotoxin (Kupfahl et al., 2006). In contrast, immunosuppressed, non-neutropenic mice infected with the same strains exhibited significantly improved survival (Sugui et al., 2007). Indeed, a ΔgliP mutant unable to produce gliotoxin exhibited attenuated virulence in non-neutropenic murine models of invasive pulmonary aspergillosis, but exhibited normal virulence in models rendered neutropenic (Spikes et al., 2008). These observations suggest that non-neutropenic mice are more susceptible to the effects of gliotoxin in a model of IA and highlight neutrophils as a primary target of the toxin.

Dendritic Cells and Gliotoxin

Dendritic cells are capable of innate recognition of pathogens and also present antigens to naive T cells during adaptive immunity. Gliotoxin (0.1 μM) induced caspase-3 activation and apoptosis in CD83+ monocyte-derived dendritic cells while concentrations between 0.15 and 1.5 μM inhibited human T cell function in vitro (Stanzani et al., 2005).

Nuclear Factor kappa-B and Gliotoxin

Nuclear factor kappa-B (NF-κB) signalling plays a role in numerous aspects of innate immunity including immune cell survival and the production of pro-inflammatory M1 macrophages (Ward et al., 1999; Cowburn et al., 2004; François et al., 2005; Wang et al., 2014). Multiple studies have demonstrated that gliotoxin targets NF-κB signalling to promote immune suppression.

Treatment of Jurkat T cells with 306 nM gliotoxin abolished NF-κB signalling by preventing the degradation of the regulatory subunit IκB-α (Pahl et al., 1996). NF-κB is also implicated in gliotoxin-induced apoptosis of eosinophils. Eosinophils that received TNF-α and 306 nM gliotoxin stabilised IκB-α, resulting in NF-κB inhibition, a significant increase in apoptosis and a decrease in the production of IL-8 (Fujihara et al., 2002). The multiple impacts of gliotoxin on host immune responses are summarised in Figure 2.

FIGURE 2
www.frontiersin.org

Figure 2. Modulation of host immunity by mycotoxins, peptide and protein toxins. Fungal toxins are represented by colours: 1. Gliotoxin (red), 2. Aflatoxin (pink), 3. Fumonisin (light blue), 4. Ochratoxin (orange), 5. T-2 (green), 6. Deoxynivalenol (brown), 7. Patulin (dark blue), 8. Zearalenone (grey), 9. Candidalysin (purple), 10. Mucoricin (black). Arrows beneath immune cells denote promotion or reduction of indicated processes. Numbers in superscript identify processes affected by specific toxins. Pro- and anti-inflammatory cytokines are indicated by spheres and arrows (stimulation) and blunted arrows (inhibition).

Aflatoxins

Aflatoxins are potent, coumarin ring-containing carcinogens derived from polyketides. There are least 18 different members comprised of aflatoxins and their derivatives (Benkerroum, 2020b) but the most widely studied of these are B1, B2, G1, and G2. Aflatoxin B1 ((6aR,9aS)-2,3,6a,9a-tetrahydro-4-methoxy-1H,11H-cyclopenta[c]furo[3′,2′:4,5]furo[2,3-h][1]benzopyran-1,11-dione: Figure 1B) was first isolated in 1961 and takes its name from Aspergillus flavus (Blount, 1961; Schroeder and Boller, 1973; Saito et al., 1989; Geiser et al., 2000). More recent research has demonstrated that aflatoxins are produced by numerous Aspergillus species (Goto et al., 1996; Geiser et al., 2000; Klich et al., 2000; Peterson et al., 2001).

Aflatoxin B1 is widely considered to be the most toxic of the aflatoxins. Aflatoxin B1 and B2 are produced by A. flavus and are thus often found as co-contaminants. The toxicity of aflatoxin B1 is caused predominantly through the production of the highly unstable intermediate metabolite aflatoxin B1 exo-8,9 epoxide (AFBO). AFBO induces cytotoxicity by reacting with host macromolecules including nucleic acids, proteins, and phospholipids (Benkerroum, 2020a). Intriguingly, AFBO is not an intermediate derived from the metabolism of aflatoxin B2, hinting at an explanation for the reduced toxicity of aflatoxin B2 compared to B1 (Benkerroum, 2020a).

Aflatoxins cause a wide range of toxicoses and predominantly target the liver, resulting in cirrhosis and hepatocellular carcinoma (Newberne and Butler, 1969; Shank et al., 1972; Peers, 1973; Mekuria et al., 2020). Indeed, the mean concentration of free aflatoxin B1 in the serum of patients with hepatocellular carcinoma was 0.2 nM compared with 0.06 nM in healthy controls (Aydin et al., 2015; Ferri et al., 2017). The presence of aflatoxin-albumin adducts is an often-used biomarker of exposure and adduct concentrations ranging between pg and ng/mL have been detected in African and Asian individuals (Allen et al., 1992; Diallo et al., 1995; Wang et al., 1996; Power et al., 2002). Aflatoxin albumin adducts have also been detected in the bronchoalveolar lavage (BAL) and serum of food-grain workers which correlated with the presence of Aspergillus and respiratory symptoms (Malik et al., 2014) while levels ranging between 4.8–12.5 ng/mg and 0.32–0.8 ng/mg were detected in BAL and serum, respectively from patients with chronic lung disease (Ali et al., 2013), suggesting that aflatoxins may be produced by Aspergillus during active infection. The presence of aflatoxin B1-albumin adducts in the blood plasma of Ghanaian villagers correlated with a significantly lower percentage of activated T cells and lower numbers of activated natural killer cells compared to unexposed individuals (Jiang et al., 2005). Treatment of hepatic cells with 40 μM aflatoxin B1 activates the epidermal growth factor receptor (EGFR) which leads to downstream activation of PI3K-AKT/mTOR and induced autophagy (Xu et al., 2020). However, whether aflatoxin-mediated activation of EGFR occurs in immune cells has yet to be determined.

Epithelial Cells and Aflatoxin

Aflatoxins have a significant effect on the integrity of epithelial barriers. Aflatoxin M1 is a hydroxylated metabolite of aflatoxin B1 which is detectable in a variety of dairy products (Bahrami et al., 2016). Differentiated gastrointestinal epithelial cells exhibit significant reductions in trans-epithelial electrical resistance (TEER) following exposure to aflatoxin B1 (100 μM) and M1 (0.12–12 μM) which correlated with a reduction in the expression of tight junction proteins and decreased viability (Romero et al., 2016; Gao et al., 2017). The effects of aflatoxin (and other fungal toxins) on barrier integrity are summarised in Figure 3.

FIGURE 3
www.frontiersin.org

Figure 3. Effect of mycotoxins and protein toxins on barrier integrity. Fungal toxins that influence epithelial barrier integrity are represented by colours: 1. Aflatoxin (pink), 2. Ochratoxin (orange), 3. Deoxynivalenol (brown), 4. Patulin (blue), 5. Zearalenone (grey). 6. Mucoricin (purple). Mycotoxins impair epithelial barrier integrity by altering the production of tight junction proteins (Claudins, Occludin and Zonula occludens-1) by epithelial cells. Arrows denote the promotion or reduction of indicated processes. Numbers in superscript identify processes affected by specific toxins. Protein phosphorylation is indicated (P). Mycotoxins also stimulate pro-inflammatory responses at mucosal surfaces and impair barrier integrity in a tight junction-independent manner by reducing cell viability and proliferation.

Monocytes, Macrophages, and Aflatoxin

Human monocytes exposed to aflatoxin B1 exhibit a significant reduction in the ability to phagocytose and kill Candida albicans in vitro (Cusumano et al., 1996), while aflatoxin M1 (25 and 50 μg/kg body weight) administered to mice over a 28 day period caused a reduction in the phagocytosis of Escherichia coli by monocytes (Shirani et al., 2018).

The production of nitric oxide (NO) by immune cells inhibits the growth of invading microbes and regulates inflammatory innate immune responses (Bogdan et al., 2000). CD14-mediated recognition of LPS by macrophages drives the production of NO which induces cytotoxic effects in numerous pathogens. Application of aflatoxin B1 (0–50 μM) to murine peritoneal macrophages prior to LPS stimulation suppressed the expression of CD14 and reduced the production of NO (Moon and Pyo, 2000). Aflatoxin B1, B2 and their metabolic products aflatoxin M1 and M2 have similar effects on NO production. Treatment of murine macrophages with 30 μM of these molecules caused a modest but significant (∼5–40%) reduction in NO production.

Interestingly, when macrophages are exposed to a combination of 15 μM aflatoxin B1 and M1, or aflatoxin B2 and M2, a synergistic reduction in NO production occurs which was more pronounced when compared to aflatoxin M1 or M2 alone (Bianco et al., 2012). These observations suggest that aflatoxins and their metabolic products may work co-operatively to suppress macrophage function.

Aflatoxin B1 does not promote macrophage apoptosis but rather induces cell cycle arrest. J774A.1 murine macrophages treated with 50 μM aflatoxin B1 for 24 h induced a significant switch from G0/G1 phase to S phase (Bianco et al., 2012). While apoptosis is not induced by aflatoxin B1, an autophagic response and release of macrophage extracellular traps (METs) was observed in a ROS-dependent manner (An et al., 2017). Finally, aflatoxin B1, B2, and G2 supressed the ability of primary rat peritoneal macrophages to phagocytose and kill C. albicans in vitro (Cusumano et al., 1990).

Neutrophils and Aflatoxin

Human neutrophils treated with 32 nM aflatoxin B1 exhibited a depletion of intracellular ATP and a non-significant increase in apoptosis (Mehrzad et al., 2020), while treatment of polymorphonuclear leukocytes with 160 nM aflatoxin B1 induced a significant reduction in ROS production and chemotactic ability compared to controls (Ubagai et al., 2008). Studies also demonstrate a reduction in the chemotactic responses of neutrophils isolated from the blood of piglets, and a reduction in phagocytosis and intracellular killing of Staphylococcus aureus and E. coli in neutrophils isolated from dairy cows (Silvotti et al., 1997; Mehrzad et al., 2011).

Dendritic Cells and Aflatoxin

Human monocyte-derived dendritic cells treated with 32 nM aflatoxin B1 upregulate the expression of toll-like receptor (TLR) 2/4 and the secretion of IL-1β and IL-6 within 2 h (Mohammadi et al., 2014). In contrast, porcine monocyte-derived dendritic cells treated with 32 nM aflatoxin B1 for 12 h exhibited impaired phagocytosis and reduced expression of co-stimulatory CD40 although the secretion of IL-1β, IL-8, IL-10, and TNF-α remained unchanged. After 24 h of exposure an impairment in the ability to induce T cell proliferation was observed (Mehrzad et al., 2014). The effects of aflatoxin on host immune responses are summarised in Figure 2.

Ochratoxin

The ochratoxins contain a 3,4-dihydro-3-methylisocoumarin moiety coupled to β-phenylalanine. While three ochratoxins are known to exist (A, B, and C), ochratoxin A (N-{[(3R)-5-chloro-8-hydroxy-3-methyl-1-oxo-3,4-dihydro-1H-isochromen-7-yl]carbonyl}-Lphenylalanine: Figure 1C) is the most prevalent. Ochratoxin A was discovered in Aspergillus ochraceus in 1965 (van der Merwe et al., 1965) and is produced by numerous Aspergillus and Penicillium species (Abarca et al., 1994; Bayman et al., 2002; Cabañes et al., 2010). Ochratoxins are associated with nephrotoxicity in humans and in animal models (Boorman et al., 1992; Betbeder et al., 1995; Maaroufi et al., 1995) and exert broad immunotoxicity on the mammalian immune system (Thurston et al., 1986; Richard, 1991). Exposure of piglets to sub-chronic levels (0.05 mg/kg in feed) of ochratoxin A for 30 days caused a reduction in NF-κB gene expression in duodenum and in the expression of several cytokines including IL-8, IL-17A, and IL-18 in duodenum and colon (Marin et al., 2017).

Epithelial Barriers and Ochratoxin

Ochratoxin A has a significant effect on the integrity of the gastrointestinal barrier. Caco-2 monolayers treated with 100 μM ochratoxin A exhibited a time-dependent reduction in TEER between 4 and 24 h which correlated with an absence of claudin-2 (McLaughlin et al., 2004). Similarly, application of 2, 4, and 8 μM ochratoxin A to porcine intestinal epithelial cells stimulated apoptosis in a dose-dependent manner (Wang et al., 2017).

Macrophages and Ochratoxin

Mice that received intraperitoneal administration (3 and 6 mg/kg body weight per day) of ochratoxin A for up to 15 days produced monocytes with an impaired ability to phagocytose E. coli (Müller et al., 1995), while daily oral administration (1.5 mg/kg body weight) over 17 weeks impaired the chemotactic activity of peritoneal macrophages and production of IL-1 and TNF-α (Dhuley, 1997).

Bovine macrophages treated with 9 μM ochratoxin A for 6 and 24 h differentially expressed genes involved in oxidative stress responses and apoptosis (Brennan et al., 2017). In contrast however, a recent in vitro study conducted on porcine alveolar macrophages revealed a temporal, biphasic response to 2.5 μM ochratoxin A. At 24 h post-treatment, expression of IL-6 and TNF-α was significantly upregulated and the majority of macrophages were pro-inflammatory CD80+ M1 cells. By 72 h post-treatment, macrophage viability was significantly reduced, IL-6 and TNF-α expression returned to baseline levels and a significant switch in macrophage polarisation to a CD208+ anti-inflammatory M2 phenotype was observed (Su et al., 2019).

Neutrophils and Ochratoxin

Mice that received a single oral dose (10 mg/kg body weight) of ochratoxin A exhibited increased oxidative damage of parenchymal organs and neutrophil infiltration into the duodenum after 24 h (Ferrante et al., 2006). Notably however, the phagocytic ability of neutrophils was significantly reduced after 17 days (Müller et al., 1995), suggesting that cellular function was impaired. Application of ochratoxin A to human neutrophils in vitro stimulated a dose-dependent activation of the oxidative burst response from 2 h, an increase in the level of intracellular calcium from 4 h and adenosine triphosphate depletion and necrosis from 8 and 20 h, respectively (Kupski et al., 2016), while 25 μM treatment impaired chemotactic and NO responses (Richetti et al., 2005).

Inflammatory Disease and Ochratoxin

Despite evidence showing that ochratoxins have an immuno-suppressive effect, pro-inflammatory responses were observed following gastric intubation of 49.5 nM ochratoxin A which promoted the progression of rheumatoid arthritis (RA) in vivo (Jahreis et al., 2017). An increase in the prevalence and clinical severity of RA was observed in a collagen-induced murine model which correlated with increased production of IL-1β and IL-6 in inflamed joints and IFN-γ and IL-17 in splenocytes. Furthermore, increased production of IL-1β, IL-6, and TNF-α from activated murine macrophages was observed in response to 2.5–250 nM ochratoxin A and facilitated the differentiation of naïve T cells into Th1 cells in vitro (Jahreis et al., 2017). The modulatory influence of ochratoxins on host immune responses are summarised in Figure 2.

Fumonisin

The fumonisins are polyketides which are structurally similar to sphingosine. Fumonisin B1 ((2S,2′S)-2,2′-{[(5S,6R,7R,9R,11S,16R,18S,19S)-19-Amino-11, 16, 18-trihydroxy-5,9-dimethylicosane-6,7-diyl]bis[oxy(2-oxoethane-2, 1-diyl)]}disuccinic acid: Figure 1D) was discovered in 1988 and is produced by numerous species of Fusarium including Fusarium oxysporum. Fumonisins and fumonisin-producing fungi have broad immunotoxic effects on livestock in vitro and in vivo including reduced number, viability and phagocytic ability of macrophages, blockade of dendritic cell maturation and antigen presentation, diminished antigen specific T cell responses and a reduction in the size of spleen and thymus (Marijanovic et al., 1991; Qureshi and Hagler, 1992; Chatterjee et al., 1995; Qureshi et al., 1995; Pierron et al., 2016).

Macrophages and Fumonisin

Fumonisins exert a broad inhibitory effect on the function of livestock macrophages. Swine alveolar macrophages exposed to different concentrations of fumonisin B1 exhibited DNA laddering (7 and 35 μM) consistent with apoptosis, impaired phagocytosis (69 nM and 0.7 μM) and a reduction in the level of IL-1β and TNF-α gene expression (2.7 and 14 μM) in vitro (Liu et al., 2002). Similarly, a reduction in IL-1β, IL-6, and IL-8 gene expression was observed in the spleen of piglets that received dietary (6 mg/kg) fumonisin B1 over 5 weeks (Grenier et al., 2011). Chicken peritoneal macrophages exhibited reduced phagocytic capacity, cytoplasmic blebbing, nuclear disintegration, and significant cell death in response to fumonisin B1 in vitro (Qureshi and Hagler, 1992).

Dendritic Cells and Fumonisin

Piglets that received an oral dose of fumosinin B1 (1 mg/kg body weight) for 10 days and were subsequently exposed to purified F-4 fimbriae from enterotoxigenic E. coli exhibited prolonged intestinal infection, reduced intestinal expression of IL-12p40 and an impairment in the function of intestinal antigen presenting cells. Moreover, dendritic cells treated with fumosinin B1 were impaired in their ability to activate T cells in vitro (Devriendt et al., 2010). Collectively, these data suggest that Fumonisin B1 dampens the immune response to pathogenic enteric bacteria through the modulation of immune cell activity (Devriendt et al., 2010). The impact of fumonisins on host immune responses are summarised in Figure 2.

T-2 Toxin

T-2 toxin (Figure 1E) is a type A member of the trichothecene family of mycotoxins produced by many of the same fungi that also produce deoxynivalenol (Fusarium, Isaria, Microcyclospora, Myrothecium, Peltaster, Spicellum, Stachybotrys, Trichoderma, and Trichothecium) (Venkatasubbaiah et al., 1995; Kikuchi et al., 2004; McCormick et al., 2011; Surup et al., 2014). T-2 toxin is a potent inhibitor of protein synthesis and is associated with conditions including alimentary toxic aleukia and Kashin-Beck disease (Bony et al., 2007; Wan et al., 2015; Li et al., 2016).

Macrophages and T-2 Toxin

Porcine alveolar macrophages treated with 30 nM T-2 toxin for 16 h exhibited a significant increase in apoptosis concomitant with decreased mitochondrial membrane potential (Seeboth et al., 2012). Moreover, pre-treatment of the same cells with 3 nM T-2 toxin for 1 h followed by exposure to TLR 2, 4, and 2/6 agonists for 16 h induced a significant reduction in TLR2, TLR4, and TLR2/6 mRNA expression, and reduced production of IL-1β and NO compared with non-pre-treated controls (Seeboth et al., 2012).

Treatment of human macrophages with 10 nM T-2 toxin significantly reduced the oxidative burst response and phagocytosis of fluorescent microspheres, while pre-treatment with 10 nM T-2 toxin followed by LPS stimulation caused a significant reduction in the secretion of TNF-α compared with non-pre-treated controls (Hymery et al., 2009). These observations suggest that T-2 toxin may diminish the hosts ability to recognise and respond to pathogens which may increase susceptibility to infection.

Dendritic Cells, Monocytes, and T-2 Toxin

Dendritic cells are critical conduits that link innate and adaptive immunity. Treatment of immature human monocyte-derived dendritic cells with 1 μM T-2 toxin in vitro reduced viability by 90% after 24 h, while dendritic cells pre-treated with LPS and 10 nM T-2 toxin exhibited a marked reduction in the expression of the dendritic cell maturation marker CD86 and reduced secretion of IL-10 and IL-12 when compared with LPS stimulation alone (Hymery et al., 2006).

Human primary monocytes are sensitive to significantly lower concentrations of T-2 toxin than differentiated macrophages or dendritic cells. Monocytes treated with 0.1 nM T-2 toxin for 24 h exhibited a significant decrease in viability compared to controls, while approximately 10-fold higher concentrations were required to significantly reduce the viability of macrophages and dendritic cells (Hymery et al., 2006, 2009; Seeboth et al., 2012). As well as cytotoxic effects, cellular differentiation is also negatively affected by T-2 toxin. Human primary monocytes cultured with T-2 toxin (0.1–10 nM) and granulocyte macrophage-colony stimulating factor (GM-CSF) significantly reduced the expression of CD71 (a marker of macrophage differentiation) compared to cells cultured with GM-CSF alone (Hymery et al., 2009). The differentiation of monocytes into dendritic cells can be monitored by quantification of CD14 (monocyte marker) and CD1a (dendritic cell marker). Human primary monocytes cultured with GM-CSF and IL-4 were 85% CD1a+ after 48 h, while 80% of monocytes similarly cultured in the presence of 10 nM T-2 toxin remained CD14+ (Hymery et al., 2009). The impact of T-2 toxin on host immune responses is summarised in Figure 2.

Deoxynivalenol

Deoxynivalenol ((3α,7α)-3,7,15-trihydroxy-12,13-epoxytrichothe -9-en-8-one: Figure 1F) is a type B member of the trichothecene family of mycotoxins and has been isolated from numerous genera of fungi including Fusarium, Isaria, Microcyclospora, Myrothecium, Peltaster, Spicellum, Stachybotrys, Trichoderma, and Trichothecium (Venkatasubbaiah et al., 1995; Kikuchi et al., 2004; McCormick et al., 2011; Surup et al., 2014). Like T-2 toxin, deoxynivalenol is also a potent inhibitor of eukaryotic protein synthesis and although it is considered to be a less potent toxin than T-2, it exerts significant toxicity on humans and animals and has the greater effect on innate immunity. Acute symptoms following ingestion include: diarrhoea, vomiting, nausea, and gastroenteritis earning deoxynivalenol the name of “vomitoxin” (Forsyth et al., 1977; Friend et al., 1982; Prelusky and Trenholm, 1993; Luo, 1994; Iverson et al., 1995).

Gut Epithelium, Inflammatory Bowel Disease, and Deoxynivalenol

Like many mycotoxins, deoxynivalenol causes disruption to intestinal barriers. Deoxynivalenol-induced activation of p44/42 ERK signalling inhibited the expression of claudin-4 in IPEC-1 intestinal epithelial cells, resulting in the loss of gastrointestinal barrier integrity (Pinton et al., 2010). In addition to perturbation of the gut mucosal barrier deoxynivalenol also induces phenotypes associated with inflammatory bowel disease in vitro and in vivo. IPEC-1 cells treated with 10 μM deoxynivalenol induced significant expression of the pro-inflammatory cytokines IL-8, IL-1α, IL-1β, and TNF-α by 4 h which correlated with the activation of genes associated with a pathogenic, pro-inflammatory Th17 response (IL-21, IL-22, IL-23) (Cano et al., 2013). Furthermore, a rat model of DSS-induced colitis exposed to 8 mg/kg of deoxynivalenol in their diet for 4 weeks induced a more rapid and severe onset of colitis than controls and induced significant increases in pro-inflammatory markers (myeloperoxidase, CXCL-1, and IL-1β) (Payros et al., 2020). These observations suggest that deoxynivalenol may be a risk factor in the onset of inflammatory bowel disease and may involve Th17 responses.

Macrophages and Deoxynivalenol

Though the trichothecenes are potent inhibitors of protein synthesis, deoxynivalenol is capable of stabilising mRNA transcripts that encode pro-inflammatory cytokines through the interaction of HuR/ELAVL1 RNA binding protein with the 3′ untranslated region of mRNA (Wong et al., 2001; Choi et al., 2009). Indeed, treatment of LPS-stimulated RAW276.4 macrophages with 0.84 μM deoxynivalenol for 6 h upregulated the expression of IL-1β, IL-6, and TNF-α (He et al., 2013).

Cyclooxygenase-2 (COX-2) is a rate limiting enzyme that catalyses the production of prostaglandins and thromboxane A2, both of which play a key role in the inflammatory response (Vane et al., 1998; Smith et al., 2000). Expression of COX-2, IL-8, and TNF-α mRNA in response to deoxynivalenol is driven by ERK and p38 signalling, and in part mediates the expression of IL-6 and IL-1β with mRNA stability also promoted by p38 (Moon and Pestka, 2002; Chung et al., 2003; Islam et al., 2006). As well as the induction of pro-inflammatory responses, deoxynivalenol also induces caspase-3 activation in a dose-dependent manner in J7741.A murine macrophages, suggestive of apoptosis (Marzocco et al., 2009). Independent inhibition of ERK and p38 signalling confirmed that these factors also play a role in apoptotic cell death induced by deoxynivalenol (Yang et al., 2000; Marzocco et al., 2009).

Neutrophils, in vivo Models, and Deoxynivalenol

Deoxynivalenol reduces chemotaxis, IL-8 secretion and phagocytic functionality of LPS-stimulated porcine neutrophils which correlated with p38 phosphorylation, caspase-3 activation and apoptosis (Gauthier et al., 2013). Mice that received an oral gavage of deoxynivalenol (5–25 mg/kg body weight) robustly induced the expression of genes encoding IL-1β, IL-6, TNF-α, and Th1/2 cytokines in spleen tissue 2 h post treatment (Zhou et al., 1997). A single oral dose (12.5 mg/kg body weight) of deoxynivalenol administered to mice induced significant production of IL-1β, IL-6, and TNF-α mRNA at 3-6 h which correlated with JNK, ERK1/2, and p38 phosphorylation (Zhou et al., 2003).

NF-κB and Deoxynivalenol

Nuclear factor kappa-B is a target of deoxynivalenol, however, there are conflicting reports regarding its effect. Mice given a single oral dose of deoxynivalenol (25 mg/kg body weight) induced nuclear translocation of p50 and c-Rel NF-κB subunits in spleen tissue (Zhou et al., 2003). Conversely, RAW264.7 macrophages treated with 0.2–3.3 μM deoxynivalenol and stimulated with LPS for 6 h exhibited significant reductions in NF-κB luciferase reporter activity while higher concentrations 1.7–3.3 μM inhibited IκBα phosphorylation which correlated with MyD88 inhibition (Sugiyama et al., 2016). The effects of deoxynivalenol on host immune responses are summarised in Figure 2.

Patulin

Patulin (4-hydroxy-4H-furo[3,2-c]pyran-2(6H)-one: Figure 1G) is a polyketide most commonly produced by the fungal genera Penicillium and Aspergillus (Frisvad, 2018). Patulin is produced in a 10-step biosynthetic pathway that is controlled by 15 genes (Puel et al., 2010; Li et al., 2019). Mice that received an intraperitoneal injection of patulin (1 mg/kg body weight) exhibited a significant increase in the level of ROS in hepatic tissue (Song et al., 2014; Guerra-Moreno and Hanna, 2017; Sun et al., 2018) while 2 μM patulin induced autophagy in HepG2 liver cells in vitro (Sun et al., 2018), suggesting that patulin may have a detrimental impact on liver function in addition to immunotoxicity.

Epithelial Cells and Patulin

Intestinal barriers are a major target of patulin. Caco-2 intestinal epithelial cells exposed to 50 μM patulin for 1-24 h exhibited reductions in TEER, cell viability and reduced expression of zonula occludens-1 (ZO-1) and myosin light chain-2 (MLC2), but not occludin, claudin-1 or claudin-3 (Assunção et al., 2016). Similar treatment conditions induced a reduction in ZO-1 and claudin-4 protein at cell-cell junctions after 24 h, while the interaction between ZO-1 and claudin-4 was abrogated after 72 h (Kawauchiya et al., 2011), suggesting that barrier integrity is negatively affected by patulin.

Caco-2 cells treated with 50 μM patulin for 6 h exhibited a marked reduction in the expression of density-enhanced phosphatase-1 (DEP-1), and the peroxisome proliferator-activated receptor gamma (PPARγ) transcription factor (Katsuyama et al., 2014). Knockdown of DEP-1 expression stimulated claudin-4 phosphorylation, a reduction in ZO-1 and the degradation of epithelial tight junctions (Katsuyama et al., 2014), suggesting that DEP-1 and PPARγ may be targeted by patulin to reduce gastrointestinal barrier function.

Macrophages and Patulin

Bovine macrophages reduced the expression of genes encoding IL-23, IL-10 and TGF-β in response to 0.3 μM patulin treatment and exhibited impaired ability to phagocytose mCherry-labelled Mycobacterium avium ssp. Paratuberculosis (Oh et al., 2015). Murine peritoneal macrophages exposed to 0.65–13 μM patulin for 2 h also displayed an impairment in phagocytosis of Saccharomyces cerevisiae, reduced production of lysozyme and fungal killing (Bourdiol et al., 1990). Moreover, rats that received 0.1 mg/kg (body weight) of patulin per day displayed mitochondrial abnormalities after 60 days and an increase in the production of apoptotic bodies after 90 days (Özsoy et al., 2008). LPS-stimulated J774A.1 murine macrophages treated with 0.0065–6.5 pM patulin exhibited reduced secretion of IL-6 and TNF-α in vitro (Loftus et al., 2016), while LPS-dependent production of IL-6 and NO was blocked in RAW264.7 macrophages in response to 5–100 μM patulin and cell viability was markedly reduced at concentrations above 50 μM in vitro (Tsai et al., 2016). Furthermore, the induction of NOD-, LRR-, and pyrin domain-containing protein 3 (NLRP3) and pro-IL-1β in LPS-primed J774.1 macrophages was reduced by patulin, suggesting that inflammasome responses are also negatively affected (Tsai et al., 2016).

Glutathione and Innate Immune Suppression by Patulin

Patulin-induced modulation of intracellular glutathione (GSH) plays a major role in immunosuppression. Patulin depletes intracellular pools of GSH in CD3 and CD28 antibody-activated human peripheral blood mononuclear cells which correlated with a reduction in cytokine secretion. Indeed, treatment with 81 nM patulin was sufficient to reduce secretion of IFN-γ and IL-10, while a higher concentration (0.65 μM) was required to reduce the secretion of IL-4 and IL-13 (Luft et al., 2008). TLR ligand-induced secretion of IL-6 from murine RAW264.7 and primary peritoneal macrophages was blocked by pre-treatment with 1 μM patulin and rescued by the addition of GSH (Tsai et al., 2016).

The immunotoxicity of patulin is in part due to the induction of mitochondrial dysfunction which is dependent upon GSH depletion. The application of 1 μM patulin to rat hepatocytes was sufficient to induce rapid depletion of GSH (within 20 min), while 1 mM patulin induced the production of ROS, depolarisation of the mitochondrial membrane, an increase in the level of intracellular calcium and intracellular acidification (Barhoumi and Burghardt, 1996). Similarly, 1 μM patulin induced mitochondrial translocation of p62 (autophagy marker) and mitophagy in murine RAW264.7 macrophages (Tsai et al., 2016). The suppressive effects of patulin on host immune responses are summarised in Figure 2.

Zearalenone

Zearalenone ((3S,11E)-14,16-dihydroxy-3-methyl-3,4,5,6,9,10-hexahydro-1H-2-benzoxacyclotetradecine-1,7(8H)-dione: Figure 1H) is produced by numerous species of Fusarium fungi (Hestbjerg et al., 2002; Kim et al., 2005; EFSA, 2013). Zearalenone and its metabolic products are non-steroidal oestrogenic mycotoxins that bind to oestrogen receptors, thereby influencing the proliferation of oestrogen-dependent cells in vitro. Oestrogen-dependent MCF-7 breast cancer cells treated with zearalenone or its derivatives α-zearalenol or β-zearalenol at concentrations between 6.25 and 12.5 μM undergo significant cellular proliferation compared with untreated controls (Tatay et al., 2018). In addition to this agonist response, zearalenone also exerts broad-ranging toxicity on host cells through a variety of mechanisms discussed below.

Epithelial Cells, Macrophages, and Zearalenone

In vitro studies of kidney and colonic epithelial cells demonstrate that concentrations of zearalenone between 1 and 60 μM are sufficient to reduce cellular proliferation, inhibit DNA, RNA and protein synthesis by 50% and induce lipid peroxidation (Ghédira-Chékir et al., 1999; Abid-Essefi et al., 2004; Kouadio et al., 2005). The production of apoptotic bodies occurs at similar concentrations (Abid-Essefi et al., 2003), suggesting that programmed cell death is induced.

Porcine jejunum enterocytes treated with 25 μM zearalenone for 24 h upregulated the production of caspase-1, pro-IL-1β, and pro-IL-18 mRNA transcripts while an increase in ROS production and reduction in mitochondrial membrane potential and cell viability was observed after 48 h (Fan et al., 2017, 2018).

Mice that received an oral gavage of zearalenone (20 mg/kg body weight) once daily for one week displayed alterations in the structure of the intestinal mucosa while the expression of β-defensin, mucin-1, mucin-2, IL-1β, TNF-α, and secretory immunoglobulin A were significantly increased (Wang et al., 2018). These observations suggest that zearalenone reduces the viability of cells involved in the maintenance of intestinal barrier function while stimulating a pro-inflammatory response. Mice given 4.5 mg/kg bodyweight of zearalenone for 1 week expressed IL-1β, IL-18, and MPO mRNA transcripts and NLRP3 protein in colonic tissue and exhibited colitis-like symptoms (Fan et al., 2018).

In contrast to epithelial cells, relatively little is known about the biological activity of zearalenone on macrophages. However, murine RAW 264.7 macrophages stimulated with LPS for 16 h were observed to upregulate the expression of genes encoding IL-1β, IL-6, and TNF-α in response to 100 nM zearalenone in vitro (Pestka and Zhou, 2006).

Immunotoxicity of Zearalenone Metabolites

Once ingested, zearalenone can be metabolised into several different compounds, each with differing levels of immunotoxicity. Although biotransformation of zearalenone occurs predominantly in the liver, human intestinal epithelial cells can also metabolise zearalenone into α-zearalenol and β-zearalenol in vitro (Videmann et al., 2008) and both of these metabolites are detectable in human urine after 24 h following oral administration of zearalenone (Mirocha et al., 1981). Both α-zearalenol and β-zearalenol caused a reduction in IL-8 secretion and cell viability in primary porcine neutrophils that was more potent than that induced by zearalenone (Marin et al., 2010), suggesting that the products of zearalenone metabolism may exert a greater influence on host immunity. The immunomodulatory effects of zearalenone are summarised in Figure 2.

Combinatorial Exposure to Mycotoxins

Multiple mycotoxins can be produced from a single species of fungi, and it is not uncommon for foodstuffs to be simultaneously contaminated with multiple species of mycotoxin-producing fungi. Indeed, combinations of mycotoxins are detectable in contaminated food (Alshannaq and Yu, 2017; Jin et al., 2021; Xiong et al., 2021). Accordingly, it is feasible that the ingestion of contaminated foodstuff may result in exposure to multiple toxins which may exacerbate immunotoxicity.

Intestinal epithelial cells respond to a combination of aflatoxin M1 and ochratoxin A (12 and 10 μM, respectively) by upregulating the expression of genes encoding IL-1α, IL-1β, IL-6, TNF-α, and IFN-α when compared with aflatoxin M1 alone (Gao et al., 2020b), while a combination of the same mycotoxins (12 and 20 μM, respectively) reduces the expression of claudin-3, claudin-4, occludin and ZO-1 when compared to individual treatment (Gao et al., 2017). In contrast, porcine intestinal enterocytes treated for 48 h with a combination of deoxynivalenol and fumonisin B1 (0.5 and 20 μM, respectively), zearalenone and fumonisin B1 (10 and 20 μM, respectively), or a mixture comprising all three toxins exhibited reduced cellular viability in vitro. Importantly, the concentration of each individual toxin was non-cytotoxic, suggesting that exposure to mycotoxins at seemingly non-toxic concentrations can exert toxicity when combined (Wan et al., 2013).

Swine alveolar macrophages treated with a combination of ochratoxin A and aflatoxin B1 (1 and 0.5 μM, respectively) for 48 h displayed a reduction in the level of intracellular GSH and phagocytic index (Hou et al., 2018).

Bovine macrophages treated with a combination of ochratoxin A (8.9 μM) and patulin (0.32 μM) downregulated the expression of genes encoding DNA methyltransferase 3a (DNMT-3a) and histone deacetylase 3 (HDAC-3), suggesting that combinatorial exposure may modulate epigenetic processes (Oh et al., 2013).

Peptide Toxins: Candidalysin

Candida albicans is a common commensal of the human microbiota which can become pathogenic when host immunity is compromised. Candidalysin (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK) is a peptide toxin generated from its parent protein (Ece1p) via enzymatic processing by fungal kexins and secreted from the invasive hyphal morphology of C. albicans (Moyes et al., 2016; Richardson et al., 2018a; Naglik et al., 2019). Candidalysin is amphipathic, adopts an α-helical structure, and permeabilises artificial membranes through pore-formation, thus damaging host cells (Moyes et al., 2016).

Epithelial Cells and Candidalysin

In oral and vaginal epithelial cells, 15–70 μM candidalysin induces the release of lactate dehydrogenase and other alarmins (Moyes et al., 2016; Richardson et al., 2018b; Ho et al., 2020), which are characteristics of cell damage and membrane destabilisation. Candidalysin (1.5–70 μM) activates epithelial immunity via two distinct mitogen-activated protein kinase (MAPK) signalling pathways; p38 and ERK1/2 (Moyes et al., 2010, 2016), with ERK1/2 being driven by activation of the EGFR (Ho et al., 2019). This leads to cytokine release, particularly G-CSF, GM-CSF, and IL-6, which is predominantly directed by the activator protein-1 (AP-1) transcription factor c-Fos and regulated by the MAPK phosphatase MKP1 (Ho et al., 2019). MAPK-dependent release of cytokines and damage-induced release of IL-1 family members (e.g., IL-1α/β) induces downstream innate immune cellular responses, including neutrophil recruitment and innate Type-17 immunity (comprising γδ-T cells and “natural” CD4+TCRαβ+ T cells). These cells are critical for protection against mucosal candidiasis in both murine models and in human antifungal immunity (Verma et al., 2017). Notably, immune responses against C. albicans are not mediated by conventional activators of fungal immunity such as Dectin-1/CARD9 (Bishu et al., 2014) but predominantly by EGFR (Ho et al., 2019). A model of how candidalysin activates host immunity is presented in Figure 2.

The role of candidalysin during C. albicans gut infections is unclear. In vitro data indicate that C. albicans may translocate across the gut barrier using a combination of processes, including active penetration and cellular damage that may lead to loss of epithelial integrity (Allert et al., 2018). The current view is that candidalysin-induced epithelial damage is only required for C. albicans translocation via the transcellular route but not the paracellular route. In vivo studies are required to fully determine the role of candidalysin in gut infections.

Macrophages, Dendritic Cells, and Candidalysin

Candida albicans forms hyphae once phagocytosed by macrophages, which results in inflammasome activation, cell lysis, and escape. Inflammasome activation requires a priming step and an inflammasome-activating step (Latz et al., 2013). In mouse and human primary monocyte-derived macrophages and dendritic cells, candidalysin (5–50 μM) was able to provide the signal to activate the NLRP3 inflammasome, resulting in caspase-1-dependent maturation and secretion of IL-1β (Kasper et al., 2018; Rogiers et al., 2019). As such, candidalysin was shown to promote systemic infection in an intravenous murine model of disseminated candidiasis (Swidergall et al., 2019).

Microglial Cells and Candidalysin

Within the central nervous system, the C-type lectin receptor/Syk adaptor CARD9 facilitates protective antifungal immunity through neutrophil recruitment (Drummond et al., 2015). Candidalysin (3–20 μM) was recently shown to induce chemokine (C-X-C motif) ligand-1 (CXCL1) and IL-1β secretion from CARD9+ microglial cells in a p38/c-Fos dependent manner, which recruit CXCR2-expressing neutrophils to the brain to control C. albicans infection (Drummond et al., 2019).

Protein Toxins: Mucoricin

Mucormycosis is an often lethal infection in immunocompromised individuals caused by fungi in the order mucorales. Recent research has identified a 17 kDa ricin-like protein toxin called mucoricin [encoded by RLT1 (Ricin-Like Toxin-1)] which plays a critical role in the pathogenicity of Rhizopus delemar hyphae (Soliman et al., 2021). Treatment of primary alveolar epithelial cells with 29.4 μM mucoricin in vitro caused significant cellular damage after 3 h, while mice that received an intravenous inoclulation of 5.9 μM mucoricin every second day exhibited a 65% reduction in survival after 5 days compared to controls (Soliman et al., 2021). Histological examination of organs collected from tretaed mice revealed necrosis, haemorrhage and inflitration of immune cells in lung and liver tissue. Notably, RNAi knockdown of mucoricin expression was observed to attenuate the pathogenicity of Rhizopus delemar in vivo. Mucoricin uses N-glycosylase activity to inhibit protein synthesis, a process which is followed by RNA depurination (Soliman et al., 2021). Intruigingly, orthologues of RLT1 have been identified in other fungi and bacteria (Soliman et al., 2021), suggesting that mucoricin-like proteins may be more widespread in nature. The modulation of host immune responses by mucoricin is summarised in Figure 2.

Conclusion

The biological impact of mycotoxins, peptide and protein toxins on health is significant. Gliotoxin, aflatoxins and candidalysin have been detected in patients with active fungal infections and in experimental models of disease. Furthermore, toxins which are not associated with active infection per se can nevertheless be acquired by ingestion, which can cause acute toxicosis. A common theme that emerges from experimental investigations is the breakdown of mucosal barriers, induction of cell death and the suppression of immune cell function in response to toxin exposure, which may increase host susceptibility to microbial infection. The numerous influences exerted by fungal toxins on host immune defence are summarised in Table 1. While the majority of in vitro mycotoxin studies and those performed in animal models in vivo use a range of toxin concentrations in which specific biological responses are observed, more work is required to establish the relevance of such concentration ranges in the context of acute toxicity and low-level chronic exposure in humans. Further research will undoubtedly increase our understanding of the influences exerted by fungal toxins on health and disease.

TABLE 1
www.frontiersin.org

Table 1. Modulation of host defences by mycotoxins, peptide, and protein toxins.

Author Contributions

RB wrote the initial draft. EP created figures and figure legends. All authors contributed to manuscript editing.

Funding

This work was supported by grants from the Wellcome Trust (214229_Z_18_Z), Biotechnology & Biological Sciences Research Council (BB/N014677/1), National Institutes of Health (R37-DE022550), the NIH Research at Guys and St. Thomas’s NHS Foundation Trust and the King’s College London Biomedical Research Centre (IS-BRC-1215-20006), and a Faculty of Dentistry, Oral & Craniofacial Sciences (FoDOCS) Ph.D. studentship.

Conflict of Interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

Abarca, M. L., Bragulat, M. R., Castella, G., and Cabanes, F. J. (1994). Ochratoxin a production by strains of Aspergillus niger var. niger. Appl. Environ. Microbiol. 60, 2650–2652. doi: 10.1128/aem.60.7.2650-2652.1994

PubMed Abstract | CrossRef Full Text | Google Scholar

Abid-Essefi, S., Baudrimont, I., Hassen, W., Ouanes, Z., Mobio, T. A., Anane, R., et al. (2003). DNA fragmentation, apoptosis and cell cycle arrest induced by zearalenone in cultured DOK, vero and caco-2 cells: prevention by Vitamin E. Toxicology 192, 237–248. doi: 10.1016/S0300-483X(03)00329-9

CrossRef Full Text | Google Scholar

Abid-Essefi, S., Ouanes, Z., Hassen, W., Baudrimont, I., Creppy, E., and Bacha, H. (2004). Cytotoxicity, inhibition of DNA and protein syntheses and oxidative damage in cultured cells exposed to Zearalenone. Toxicol. Vitro 18, 467–474. doi: 10.1016/j.tiv.2003.12.011

PubMed Abstract | CrossRef Full Text | Google Scholar

Ali, S., Malik, A., Shahid, M., and Bhargava, R. (2013). Pulmonary aspergillosis and aflatoxins in chronic lung diseases. Mycopathologia 176, 287–294. doi: 10.1007/s11046-013-9690-8

PubMed Abstract | CrossRef Full Text | Google Scholar

Allen, S. J., Wild, C. P., Wheeler, J. G., Riley, E. M., Montesano, R., Bennett, S., et al. (1992). Aflatoxin exposure, malaria and hepatitis B infection in rural gambian children. Trans. R. Soc. Trop. Med. Hygiene 86, 426–430. doi: 10.1016/0035-9203(92)90253-9

CrossRef Full Text | Google Scholar

Allert, S., Förster, T. M., Svensson, C. M., Richardson, J. P., Pawlik, T., Hebecker, B., et al. (2018). Candida albicans-induced epithelial damage mediates translocation through intestinal barriers. MBio 9, e915–e918. doi: 10.1128/mBio.00915-18

PubMed Abstract | CrossRef Full Text | Google Scholar

Almyroudis, N. G., Grimm, M. J., Davidson, B. A., Röhm, M., Urban, C. F., and Segal, B. H. (2013). NETosis and NADPH Oxidase: at the intersection of host defense, inflammation, and injury. Front. Immunol. 4:45. doi: 10.3389/fimmu.2013.00045

PubMed Abstract | CrossRef Full Text | Google Scholar

Alshannaq, A., and Yu, J. H. (2017). Occurrence, toxicity, and analysis of major mycotoxins in food. Int. J. Environ. Res. Public Health 14:632. doi: 10.3390/ijerph14060632

PubMed Abstract | CrossRef Full Text | Google Scholar

An, Y., Shi, X., Tang, X., Wang, Y., Shen, F., Zhang, Q., et al. (2017). Aflatoxin B1 Induces reactive oxygen species-mediated autophagy and extracellular trap formation in macrophages. Front. Cell. Infect. Microbiol. 7:53. doi: 10.3389/fcimb.2017.00053

PubMed Abstract | CrossRef Full Text | Google Scholar

Assunção, R., Alvito, P., Kleiveland, C. R., and Lea, T. E. (2016). Characterization of In vitro effects of patulin on intestinal epithelial and immune cells. Toxicol. Lett. 251, 47–56. doi: 10.1016/j.toxlet.2016.04.007

PubMed Abstract | CrossRef Full Text | Google Scholar

Aydin, M., Aydin, S., Bacanli, M., and Başaran, N. (2015). Aflatoxin levels in chronic hepatitis B patients with cirrhosis or hepatocellular carcinoma in balikesir, Turkey. J. Viral Hepatitis 22, 926–935. doi: 10.1111/jvh.12410

PubMed Abstract | CrossRef Full Text | Google Scholar

Bahrami, R., Shahbazi, Y., and Nikousefat, Z. (2016). Aflatoxin M1 in milk and traditional dairy products from west part of iran: occurrence and seasonal variation with an emphasis on risk assessment of human exposure. Food Control 62, 250–256. doi: 10.1016/j.foodcont.2015.10.039

CrossRef Full Text | Google Scholar

Barhoumi, R., and Burghardt, R. C. (1996). Kinetic analysis of the chronology of patulin-and gossypol-lnduced cytotoxicity in vitro. Fundimental Appl. Toxicol. 30, 290–297.

Google Scholar

Bayman, P., Baker, J. L., Doster, M. A., Michailides, T. J., and Mahoney, N. E. (2002). Ochratoxin production by the Aspergillus ochraceus group and Aspergillus alliaceus. Appl. Environ. Microbiol. 68, 2326–2329. doi: 10.1128/AEM.68.5.2326-2329.2002

PubMed Abstract | CrossRef Full Text | Google Scholar

Benkerroum, N. (2020a). Aflatoxins: producing−molds, structure, health issues and incidence in southeast Asian and Sub−saharan African countries. Int. J. Environ. Res. Public Health 17:1215. doi: 10.3390/ijerph17041215

PubMed Abstract | CrossRef Full Text | Google Scholar

Benkerroum, N. (2020b). Chronic and acute toxicities of aflatoxins: mechanisms of action. Int. J. Environ. Res. Public Health 17, 1–28. doi: 10.3390/ijerph17020423

PubMed Abstract | CrossRef Full Text | Google Scholar

Berthiller, F., Crews, C., Dall’Asta, C., De Saeger, S., Haesaert, G., Karlovsky, P., et al. (2013). Masked mycotoxins: a review. Mol. Nutr. Food Res. 57, 165–186. doi: 10.1002/mnfr.201100764

PubMed Abstract | CrossRef Full Text | Google Scholar

Betbeder, A. M., Creppy, E. E., and El May, M. (1995). Ochratoxin a in human blood in relation to nephropathy in tunisia. Hum. Exp. Toxicol. 14, 609–614. doi: 10.1177/096032719501400710

PubMed Abstract | CrossRef Full Text | Google Scholar

Bianco, G., Russo, R., Marzocco, S., Velotto, S., Autore, G., and Severino, L. (2012). Modulation of macrophage activity by aflatoxins B1 and B2 and their metabolites aflatoxins M1 and M2. Toxicon 59, 644–650. doi: 10.1016/j.toxicon.2012.02.010

PubMed Abstract | CrossRef Full Text | Google Scholar

Bishu, S., Hernández-Santos, N., Simpson-Abelson, M. R., Huppler, A. R., Conti, H. R., Ghilardi, N., et al. (2014). The adaptor CARD9 is required for adaptive but not innate immunity to oral mucosal Candida albicans infections. Infect. Immun. 82, 1173–1180. doi: 10.1128/IAI.01335-13

PubMed Abstract | CrossRef Full Text | Google Scholar

Blount, W. P. (1961). Turkey ‘X’ disease. Journal of British Turkey Federation, 9, 52–61.

Google Scholar

Bogdan, C., Röllinghoff, M., and Diefenbach, A. (2000). The role of nitric oxide in innate immunity. Immunol. Rev. 173, 17–26. doi: 10.1034/j.1600-065X.2000.917307.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Bok, J. W., Balajee, S. A., Marr, K. A., Andes, D., Nielsen, K. F., Frisvad, J. C., et al. (2005). LaeA, a regulator of morphogenetic fungal virulence factors. Eukaryotic Cell 4, 1574–1582. doi: 10.1128/EC.4.9.1574-1582.2005

PubMed Abstract | CrossRef Full Text | Google Scholar

Bok, J. W., Chung, D., Balajee, S. A., Marr, K. A., Andes, D., Nielsen, K. F., et al. (2006). GliZ, a transcriptional regulator of gliotoxin biosynthesis, contributes to aspergillus fumigatus virulence. Infect. Immun. 74, 6761–6768. doi: 10.1128/IAI.00780-06

PubMed Abstract | CrossRef Full Text | Google Scholar

Bony, S., Olivier-Loiseau, L., Carcelen, M., and Devaux, A. (2007). Genotoxic potential associated with low levels of the fusarium mycotoxins nivalenol and fusarenon X in a human intestinal cell line. Toxicol. Vitro 21, 457–465. doi: 10.1016/j.tiv.2006.10.014

PubMed Abstract | CrossRef Full Text | Google Scholar

Boorman, G. A., McDonald, M. R., Imoto, S., and Persing, R. (1992). Renal lesions induced by ochratoxin a exposure in the F344 rat. Toxicol. Pathol. 20, 236–245. doi: 10.1177/019262339202000210

PubMed Abstract | CrossRef Full Text | Google Scholar

Bourdiol, D., Escoula, L., and Salvayre, R. (1990). Effect of patulin on microbicidal activity of mouse peritoneal macrophages. Food Chem. Toxicol. 28, 29–33. doi: 10.1016/0278-6915(90)90132-7

CrossRef Full Text | Google Scholar

Brennan, K. M., Oh, S. Y., Yiannikouris, A., Graugnard, D. E., and Karrow, N. A. (2017). Differential gene expression analysis of bovine macrophages after exposure to the Penicillium mycotoxins citrinin and/or ochratoxin a. Toxins (Basel) 9:366. doi: 10.3390/toxins9110366

PubMed Abstract | CrossRef Full Text | Google Scholar

Brown, G. D., Denning, D. W., Gow, N. A. R., Levitz, S. M., Netea, M. G., and White, T. C. (2012). Hidden killers: human fungal infections. Sci. Transl. Med. 4:165rv13. doi: 10.1126/scitranslmed.3004404

PubMed Abstract | CrossRef Full Text | Google Scholar

Cabañes, F. J., Bragulat, M. R., and Castellá, G. (2010). Ochratoxin a producing species in the genus Penicillium. Toxins 2, 1111–1120. doi: 10.3390/toxins2051111

PubMed Abstract | CrossRef Full Text | Google Scholar

Caloni, F., Cortinovis, C., Pizzo, F., and De Angelis, I. (2012). Transport of aflatoxin M1 in human intestinal Caco-2/TC7 cells. Front. Pharmacol. 3:111. doi: 10.3389/fphar.2012.00111

PubMed Abstract | CrossRef Full Text | Google Scholar

Cano, P. M., Seeboth, J., Meurens, F., Cognie, J., Abrami, R. I, Oswald, P., et al. (2013). Deoxynivalenol as a new factor in the persistence of intestinal inflammatory diseases: an emerging hypothesis through possible modulation of Th17-mediated response. PLoS One 8:e53647. doi: 10.1371/journal.pone.0053647

PubMed Abstract | CrossRef Full Text | Google Scholar

Chai, C. L. L., and Waring, P. (2000). Redox sensitive epidithiodioxopiperazines in biological mechanisms of Toxicity. Redox Rep. 5, 257–264. doi: 10.1179/135100000101535799

PubMed Abstract | CrossRef Full Text | Google Scholar

Chatterjee, D., Mukherjee, S. K., and Dey, A. (1995). Nuclear disintegration in chicken peritoneal macrophages exposed to fumonisin B1 from Indian Maize. Lett. Appl. Microbiol. 20, 184–185. doi: 10.1111/j.1472-765X.1995.tb00422.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Chikina, A. S., Nadalin, F., Maurin, M., San-Roman, M., Thomas-Bonafos, T., Li, X. V., et al. (2020). Macrophages maintain epithelium integrity by limiting fungal product absorption. Cell 183, 411–428.e16. doi: 10.1016/j.cell.2020.08.048

PubMed Abstract | CrossRef Full Text | Google Scholar

Choi, H. J., Yang, H., Park, S. H., and Moon, Y. (2009). HuR/ELAVL1 RNA binding protein modulates interleukin-8 induction by muco-active ribotoxin deoxynivalenol. Toxicol. Appl. Pharmacol. 240, 46–54. doi: 10.1016/j.taap.2009.06.023

PubMed Abstract | CrossRef Full Text | Google Scholar

Chung, Y. J., Zhou, H. R., and Pestka, J. J. (2003). Transcriptional and posttranscriptional roles for P38 mitogen-activated protein kinase in upregulation of TNF-α expression by deoxynivalenol (Vomitoxin). Toxicol. Appl. Pharmacol. 193, 188–201. doi: 10.1016/S0041-008X(03)00299-0

CrossRef Full Text | Google Scholar

Coméra, C., André, K., Laffitte, J., Collet, X., Galtier, P., and Maridonneau-Parini, I. (2007). Gliotoxin from Aspergillus fumigatus affects phagocytosis and the organization of the actin cytoskeleton by distinct signalling pathways in human neutrophils. Microbes Infect. 9, 47–54. doi: 10.1016/j.micinf.2006.10.009

PubMed Abstract | CrossRef Full Text | Google Scholar

Cowburn, A. S., Deighton, J., Walmsley, S. R., and Chilvers, E. R. (2004). The survival effect of TNF-α in human neutrophils is mediated via NF-K B-dependent IL-8 release. Eur. J. Immunol. 34, 1733–1743. doi: 10.1002/eji.200425091

PubMed Abstract | CrossRef Full Text | Google Scholar

Cusumano, V., Costa, G. B., and Seminara, S. (1990). Effect of aflatoxins on rat peritoneal macrophages downloaded from. Appl. Environ. Microbiol. 56, 3482–3484.

Google Scholar

Cusumano, V., Rossano, F., Merendino, R. A., Arena, A., Costa, G. B., Mancuso, G., et al. (1996). Immunobiological activities of mould products: functional impairment of human monocytes exposed to aflatoxin B1. Res. Microbiol. 147, 385–391. doi: 10.1016/0923-2508(96)84713-9

CrossRef Full Text | Google Scholar

Devriendt, B., Gallois, M., Verdonck, F., Wache, Y., Bimczok, D. I, Oswald, P., et al. (2010). “The food contaminant fumonisin B1 reduces the maturation of porcine CD11R1+ intestinal dendritic cells, resulting in a reduced efficiency of oral immunisation and a prolonged intestinal ETEC infection,” in Proceedings of the Dendritic Cells in Fundamental and Clinical Immunology, 11th International Symposium, Abstracts, (Lugano).

Google Scholar

Dhuley, J. N. (1997). Effect of some indian herbs on macrophage functions in ochratoxin a treated mice. J. Ethnopharmacol. 58, 15–20. doi: 10.1016/S0378-8741(97)00072-X

CrossRef Full Text | Google Scholar

Diallo, M. S., Sylla, A., Sidibé, K., Sylla, B. S., Trepo, C. R., and Wild, C. P. (1995). Prevalence of exposure to aflatoxin and hepatitis B and C Viruses in Guinea, West Africa. Nat. Toxins 3, 6–9. doi: 10.1002/nt.2620030103

PubMed Abstract | CrossRef Full Text | Google Scholar

Drummond, R. A., Collar, A. L., Swamydas, M., Rodriguez, C. A., Lim, J. K., Mendez, L. M., et al. (2015). CARD9-dependent neutrophil recruitment protects against fungal invasion of the central nervous system. PLoS Pathogens 11:e1005293. doi: 10.1371/journal.ppat.1005293

PubMed Abstract | CrossRef Full Text | Google Scholar

Drummond, R. A., Swamydas, M., Oikonomou, V., Zhai, B. I, Dambuza, M., Schaefer, B. C., et al. (2019). CARD9 + microglia promote antifungal immunity via IL-1β- and CXCL1-mediated neutrophil recruitment. Nat. Immunol. 20, 559–570. doi: 10.1038/s41590-019-0377-2

PubMed Abstract | CrossRef Full Text | Google Scholar

EFSA (2013). Scientific opinion on the hazard assessment of endocrine disruptors: scientific criteria for identification of endocrine disruptors and appropriateness of existing test methods for assessing effects mediated by these substances on human health and the environment1. EFSA J. 11:3132. doi: 10.2903/j.efsa.2013.3132

PubMed Abstract | CrossRef Full Text | Google Scholar

Eskola, M., Kos, G., Elliott, C. T., Hajšlová, J., Mayar, S., and Krska, R. (2020). Worldwide contamination of food-crops with mycotoxins: validity of the Widely Cited ‘FAO Estimate’ of 25%. Crit. Rev. Food Sci. Nutr. 60, 2773–2789. doi: 10.1080/10408398.2019.1658570

PubMed Abstract | CrossRef Full Text | Google Scholar

Fan, W., Lv, Y., Ren, S., Shao, M., Shen, T., Huang, K., et al. (2018). Zearalenone (ZEA)-induced intestinal inflammation is mediated by the NLRP3 inflammasome. Chemosphere 190, 272–279. doi: 10.1016/j.chemosphere.2017.09.145

PubMed Abstract | CrossRef Full Text | Google Scholar

Fan, W., Shen, T., Ding, Q., Lv, Y., Li, L., Huang, K., et al. (2017). Zearalenone induces ROS-mediated mitochondrial damage in porcine IPEC-J2 cells. J. Biochem. Mol. Toxicol. 31:e21944. doi: 10.1002/jbt.21944

PubMed Abstract | CrossRef Full Text | Google Scholar

Ferrante, M. C., Bilancione, M., Raso, G. M., Esposito, E., Iacono, A., Zaccaroni, A., et al. (2006). Expression of COX-2 and Hsp72 in peritoneal macrophages after an acute ochratoxin a treatment in mice. Life Sci. 79, 1242–1247. doi: 10.1016/j.lfs.2006.03.031

PubMed Abstract | CrossRef Full Text | Google Scholar

Ferri, F., Brera, C., De Santis, B., Fedrizzi, G., Bacci, T., Bedogni, L., et al. (2017). Survey on urinary levels of aflatoxins in professionally exposed workers. Toxins 9:117. doi: 10.3390/toxins9040117

PubMed Abstract | CrossRef Full Text | Google Scholar

Fitzpatrick, L. R., Wang, J., and Le, T. (2000). In Vitro and In Vivo Effects of gliotoxin, a fungal metabolite: efficacy against dextran sodium sulfate-induced colitis in rats. Dig. Dis. Sci. 45, 2327–2336. doi: 10.1023/A:1005630723111

CrossRef Full Text | Google Scholar

Forsyth, D. M., Yoshizawa, T., Morooka, N., and Tuite, J. (1977). Emetic and refusal activity of deoxynivalenol to swine. Appl. Environ. Microbiol. 34, 547–552. doi: 10.1128/aem.34.5.547-552.1977

PubMed Abstract | CrossRef Full Text | Google Scholar

François, S., Benna, J. E., Dang, P. M. C., Pedruzzi, E., Gougerot-Pocidalo, M. A., and Elbim, C. (2005). Inhibition of neutrophil apoptosis by TLR agonists in whole blood: involvement of the phosphoinositide 3-kinase/Akt and NF-K B signaling pathways, leading to increased levels of Mcl-1, A1, and phosphorylated bad. J. Immunol. 174, 3633–3642. doi: 10.4049/jimmunol.174.6.3633

PubMed Abstract | CrossRef Full Text | Google Scholar

Friend, D. W., Trenholm, H. L., Elliot, J. I., Hartin, K. E., and Thompson, B. K. (1982). Effect of feeding vomitoxin-contaminated wheat to pigs. Can. J. Anim. Sci. 62, 1211–1222. doi: 10.4141/cjas82-141

CrossRef Full Text | Google Scholar

Frisvad, J. C. (2018). A critical review of producers of small lactone mycotoxins: patulin, penicillic acid and moniliformin. World Mycotoxin J. 11, 73–100. doi: 10.3920/WMJ2017.2294

PubMed Abstract | CrossRef Full Text | Google Scholar

Fujihara, S., Ward, C., Dransfield, I., Hay, R. T., Uings, J. I, Hayes, B., et al. (2002). Inhibition of nuclear factor-K B activation un-masks the ability of TNF-α to induce human eosinophil apoptosis. Eur. J. Immunol. 32, 457–466.

Google Scholar

Gallo, A., Ferrara, M., and Perrone, G. (2013). Phylogenetic study of polyketide synthases and nonribosomal peptide synthetases involved in the biosynthesis of mycotoxins. Toxins 5, 717–742. doi: 10.3390/toxins5040717

PubMed Abstract | CrossRef Full Text | Google Scholar

Gao, Y., Li, S., Wang, J., Luo, C., Zhao, S., and Zheng, N. (2017). Modulation of intestinal epithelial permeability in differentiated caco-2 cells exposed to aflatoxin M1 and ochratoxin a individually or collectively. Toxins 10:13. doi: 10.3390/toxins10010013

PubMed Abstract | CrossRef Full Text | Google Scholar

Gao, Y., Meng, L., Liu, H., Wang, J., and Zheng, N. (2020a). The compromised intestinal barrier induced by mycotoxins. Toxins 12:619. doi: 10.3390/toxins12100619

PubMed Abstract | CrossRef Full Text | Google Scholar

Gao, Y., Ye, Q., Bao, X., Huang, X., Wang, J., and Zheng, N. (2020b). Transcriptomic and proteomic profiling reveals the intestinal immunotoxicity induced by aflatoxin M1 and ochratoxin A. Toxicon 180, 49–61. doi: 10.1016/j.toxicon.2020.03.008

PubMed Abstract | CrossRef Full Text | Google Scholar

Gauthier, T., Waché, Y., Laffitte, J., Taranu, I., Saeedikouzehkonani, N., Mori, Y., et al. (2013). Deoxynivalenol impairs the immune functions of neutrophils. Mol. Nutr. Food Res. 57, 1026–1036. doi: 10.1002/mnfr.201200755

PubMed Abstract | CrossRef Full Text | Google Scholar

Geiser, D. M., Dorner, J. W., Horn, B. W., and Taylor, J. W. (2000). The phylogenetics of mycotoxin and sclerotium production in Aspergillus flavus and Aspergillus oryzae. Fungal Genet. Biol. 31, 169–179. doi: 10.1006/fgbi.2000.1215

PubMed Abstract | CrossRef Full Text | Google Scholar

Geissler, A., Haun, F., Frank, D. O., Wieland, K., Simon, M. M., Idzko, M., et al. (2013). Apoptosis induced by the fungal pathogen gliotoxin requires a triple phosphorylation of bim by JNK. Cell Death Differ. 20, 1317–1329. doi: 10.1038/cdd.2013.78

PubMed Abstract | CrossRef Full Text | Google Scholar

Ghédira-Chékir, L., Maaroufi, K., Creppy, E. E., and Bacha, H. (1999). Cytotoxic and genotoxic effects of zearalenone: prevention by Vitamin E. J. Toxicol. Toxin Rev. 18, 355–368. doi: 10.3109/15569549909009263

CrossRef Full Text | Google Scholar

Goto, T., Wicklow, D. T., and Ito, Y. (1996). Aflatoxin and cyclopiazonic acid production by a sclerotium-producing Aspergillus Tamarii strain. Appl. Environ. Microbiol. 62, 4036–4038. doi: 10.1128/aem.62.11.4036-4038.1996

PubMed Abstract | CrossRef Full Text | Google Scholar

Gratz, S. W. (2017). Do plant-bound masked mycotoxins contribute to toxicity? Toxins 9:85. doi: 10.3390/toxins9030085

PubMed Abstract | CrossRef Full Text | Google Scholar

Gratz, S. W., Dinesh, R., Yoshinari, T., Holtrop, G., Richardson, A. J., Duncan, G., et al. (2017). Masked trichothecene and zearalenone mycotoxins withstand digestion and absorption in the upper GI tract but are efficiently hydrolyzed by human gut microbiota In Vitro. Mol. Nutr. Food Res. 61, 680–690. doi: 10.1002/mnfr.201600680

PubMed Abstract | CrossRef Full Text | Google Scholar

Grenier, B., Loureiro-Bracarense, A. P., Lucioli, J., Pacheco, G. D., Cossalter, A. M., Moll, W. D., et al. (2011). Individual and combined effects of subclinical doses of deoxynivalenol and fumonisins in piglets. Mol. Nutr. Food Res. 55, 761–771. doi: 10.1002/mnfr.201000402

PubMed Abstract | CrossRef Full Text | Google Scholar

Guerra-Moreno, A., and Hanna, J. (2017). Induction of proteotoxic stress by the mycotoxin patulin. Toxicol. Lett. 276, 85–91. doi: 10.1016/j.toxlet.2017.05.015

PubMed Abstract | CrossRef Full Text | Google Scholar

Guerre, P. (2020). Mycotoxin and gut microbiota interactions. Toxins 12:769. doi: 10.3390/toxins12120769

PubMed Abstract | CrossRef Full Text | Google Scholar

He, K., Pan, X., Zhou, H. R., and Pestka, J. J. (2013). Modulation of inflammatory gene expression by the ribotoxin deoxynivalenol involves coordinate regulation of the transcriptome and translatome. Toxicol. Sci. 131, 153–163. doi: 10.1093/toxsci/kfs266

PubMed Abstract | CrossRef Full Text | Google Scholar

Hestbjerg, H., Nielsen, K. F., Thrane, U., and Elmholt, S. (2002). Production of Trichothecenes and other secondary metabolites by Fusarium culmorum and Fusarium equiseti on Common laboratory media and a soil organic matter agar: an ecological interpretation. J. Agric. Food Chem. 50, 7593–7599. doi: 10.1021/jf020432o

PubMed Abstract | CrossRef Full Text | Google Scholar

Ho, J., Wickramasinghe, D. N., Nikou, S. A., Hube, B., Richardson, J. P., and Naglik, J. R. (2020). Candidalysin is a potent trigger of alarmin and antimicrobial peptide release in epithelial cells. Cells 9:699. doi: 10.3390/cells9030699

PubMed Abstract | CrossRef Full Text | Google Scholar

Ho, J., Yang, X., Nikou, S. A., Kichik, N., Donkin, A., Ponde, N. O., et al. (2019). Candidalysin activates innate epithelial immune responses via epidermal growth factor receptor. Nat. Commun. 10:2297. doi: 10.1038/s41467-019-09915-2

PubMed Abstract | CrossRef Full Text | Google Scholar

Hou, L., Gan, F., Zhou, X., Zhou, Y., Qian, G., Liu, Z., et al. (2018). Immunotoxicity of ochratoxin a and aflatoxin B1 in combination is associated with the nuclear factor kappa B signaling pathway in 3D4/21?cells. Chemosphere 199, 718–727. doi: 10.1016/j.chemosphere.2018.02.009

PubMed Abstract | CrossRef Full Text | Google Scholar

Hymery, N., Léon, K., Carpentier, F. G., Jung, J. L., and Parent-Massin, D. (2009). T-2 toxin inhibits the differentiation of human monocytes into dendritic cells and macrophages. Toxicol. Vitro 23, 509–519. doi: 10.1016/j.tiv.2009.01.003

PubMed Abstract | CrossRef Full Text | Google Scholar

Hymery, N., Sibiril, Y., and Parent-Massin, D. (2006). In vitro effects of trichothecenes on human dendritic cells. Toxicol. Vitro 20, 899–909. doi: 10.1016/j.tiv.2006.01.015

PubMed Abstract | CrossRef Full Text | Google Scholar

Islam, Z., Gray, J. S., and Pestka, J. J. (2006). P38 mitogen-activated protein kinase mediates IL-8 induction by the ribotoxin deoxynivalenol in human monocytes. Toxicol. Appl. Pharmacol. 213, 235–244. doi: 10.1016/j.taap.2005.11.001

PubMed Abstract | CrossRef Full Text | Google Scholar

Iverson, F., Armstrong, C., Nera, E., Truelove, J., Fernie, S., Scott, P., et al. (1995). Chronic feeding study of deoxynivalenol in B6C3F1 male and female mice. Teratog. Carcinog. Mutagen. 15, 283–306. doi: 10.1002/tcm.1770150606

CrossRef Full Text | Google Scholar

Jahreis, S., Kuhn, S., Madaj, A. M., Bauer, M. and Polte, T. (2017). Mold metabolites drive rheumatoid arthritis in mice via promotion of IFN-gamma- and IL-17-producing T cells. Food Chem. Toxicol. 109, 405–413. doi: 10.1016/j.fct.2017.09.027

PubMed Abstract | CrossRef Full Text | Google Scholar

Jia, X., Chen, F., Pan, W., Yu, R., Tian, S., Han, G., et al. (2014). Gliotoxin promotes aspergillus fumigatus internalization into type II human pneumocyte A549 cells by inducing host phospholipase D activation. Microbes Infect. 16, 491–501. doi: 10.1016/j.micinf.2014.03.001

PubMed Abstract | CrossRef Full Text | Google Scholar

Jiang, Y., Jolly, P. E., Ellis, W. O., Wang, J. S., Phillips, T. D., and Williams, J. H. (2005). Aflatoxin B1 albumin adduct levels and cellular immune status in ghanaians. Int. Immunol. 17, 807–814. doi: 10.1093/intimm/dxh262

PubMed Abstract | CrossRef Full Text | Google Scholar

Jin, Y., Chen, Q., Luo, S., He, L., Fan, R., Zhang, S., et al. (2021). Dual near-infrared fluorescence-based lateral flow immunosensor for the detection of zearalenone and deoxynivalenol in maize. Food Chem. 336:127718. doi: 10.1016/j.foodchem.2020.127718

PubMed Abstract | CrossRef Full Text | Google Scholar

Johannessen, L. N., Nilsen, A. M., and Løvik, M. (2005). The mycotoxins citrinin and gliotoxin differentially affect production of the pro-inflammatory cytokines tumour necrosis factor-α and interleukin-6, and the anti-inflammatory cytokine interleukin-10. Clin. Exp. Allergy 35, 782–789. doi: 10.1111/j.1365-2222.2005.02249.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Kasper, L., König, A., Koenig, P. A., Gresnigt, M. S., Westman, J., Drummond, R. A., et al. (2018). the fungal peptide toxin Candidalysin activates the NLRP3 inflammasome and causes cytolysis in mononuclear phagocytes. Nat. Commun. 9:4260. doi: 10.1038/s41467-018-06607-1

PubMed Abstract | CrossRef Full Text | Google Scholar

Katsuyama, A., Konno, T., Shimoyama, S., and Kikuchi, H. (2014). The mycotoxin patulin decreases expression of density-enhanced phosphatase-1 by down-regulating PPARγ in human colon cancer cells. Tohoku J. Exp. Med. 233, 265–274. doi: 10.1620/tjem.233.265

PubMed Abstract | CrossRef Full Text | Google Scholar

Kawauchiya, T., Takumi, R., Kudo, Y., Takamori, A., Sasagawa, T., Takahashi, K., et al. (2011). Correlation between the destruction of tight junction by patulin treatment and increase of phosphorylation of ZO-1 in Caco-2 human colon cancer cells. Toxicol. Lett. 205, 196–202. doi: 10.1016/j.toxlet.2011.06.006

PubMed Abstract | CrossRef Full Text | Google Scholar

Kikuchi, H., Miyagawa, Y., Sahashi, Y., Inatomi, S., Haganuma, A., Nakahata, N., et al. (2004). Novel Spirocyclic Trichothecanes, Spirotenuipesine A and B, isolated from Entomopathogenic Fungus, Paecilomyces tenuipes. J. Org. Chem. 69, 352–356. doi: 10.1021/jo035137x

PubMed Abstract | CrossRef Full Text | Google Scholar

Kim, Y. T., Lee, Y. R., Jin, J., Han, K. H., Kim, H., Kim, J. C., et al. (2005). Two different polyketide synthase genes are required for synthesis of Zearalenone in Gibberella zeae. Mol. Microbiol. 58, 1102–1113. doi: 10.1111/j.1365-2958.2005.04884.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Klich, M., Mullaney, E., Daly, C., and Cary, J. W. (2000). Molecular and physiological aspects of aflatoxin and sterigmatocystin biosynthesis by Aspergillus tamarii and A. ochraceoroseus. Appl. Microbiol. Biotechnol. 53, 605–609. doi: 10.1007/s002530051664

PubMed Abstract | CrossRef Full Text | Google Scholar

Kouadio, J. H., Mobio, T. A., Baudrimont, I., Moukha, S., Dano, S. D., and Creppy, E. E. (2005). Comparative study of cytotoxicity and oxidative stress induced by Deoxynivalenol, Zearalenone or Fumonisin B1 in human intestinal cell line Caco-2. Toxicology 213, 56–65. doi: 10.1016/j.tox.2005.05.010

PubMed Abstract | CrossRef Full Text | Google Scholar

Kupfahl, C., Heinekamp, T., Geginat, G., Ruppert, T., Härtl, A., Hof, H., et al. (2006). Deletion of the GliP gene of Aspergillus fumigatus results in loss of gliotoxin production but has no effect on virulence of the fungus in a low-dose mouse infection model. Mol. Microbiol. 62, 292–302. doi: 10.1111/j.1365-2958.2006.05373.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Kupski, L., Freitas, M., Ribeiro, D., Furlong, E. B., and Fernandes, E. (2016). Ochratoxin A activates neutrophils and kills these cells through necrosis, an effect eliminated through its conversion into Ochratoxin α. Toxicology 368–369. doi: 10.1016/j.tox.2016.09.001

PubMed Abstract | CrossRef Full Text | Google Scholar

Latz, E., Xiao, T. S., and Stutz, A. (2013). Activation and regulation of the inflammasomes. Nat. Rev. Immunol. 13, 397–411. doi: 10.1038/nri3452

PubMed Abstract | CrossRef Full Text | Google Scholar

Levin, R., Grinstein, S., and Schlam, D. (2015). Phosphoinositides in phagocytosis and macropinocytosis. Biochim. Biophys. Acta Mol. Cell Biol. Lipids 1851, 805–823. doi: 10.1016/j.bbalip.2014.09.005

PubMed Abstract | CrossRef Full Text | Google Scholar

Lewis, R. E., Wiederhold, N. P., Chi, J., Han, X. Y., Komanduri, K. V., Kontoyiannis, D. P., et al. (2005). Detection of gliotoxin in experimental and human aspergillosis. Infect. Immun. 73, 635–637. doi: 10.1128/IAI.73.1.635-637.2005

PubMed Abstract | CrossRef Full Text | Google Scholar

Li, B., Chen, Y., Zong, Y., Shang, Y., Zhang, Z., Xu, X., et al. (2019). Dissection of patulin biosynthesis, spatial control and regulation mechanism in Penicillium expansum. Environ. Microbiol. 21, 1124–1139. doi: 10.1111/1462-2920.14542

PubMed Abstract | CrossRef Full Text | Google Scholar

Li, D., Han, J., Guo, X., Qu, C., Yu, F., and Wu, X. (2016). The effects of T-2 toxin on the prevalence and development of Kashin-Beck disease in China: a meta-analysis and systematic review. Toxicol. Res. 5, 731–751. doi: 10.1039/c5tx00377f

PubMed Abstract | CrossRef Full Text | Google Scholar

Li, P., Su, R., Yin, R., Lai, D., Wang, M., Liu, Y., et al. (2020). Detoxification of mycotoxins through biotransformation. Toxins 12:121. doi: 10.3390/toxins12020121

PubMed Abstract | CrossRef Full Text | Google Scholar

Liu, B. H., Yu, F. Y., Chan, M. H., and Yang, Y. L. (2002). The effects of mycotoxins, fumonisin B1 and aflatoxin B1, on primary swine alveolar macrophages. Toxicol. Appl. Pharmacol. 180, 197–204. doi: 10.1006/taap.2002.9406

PubMed Abstract | CrossRef Full Text | Google Scholar

Loftus, J., Kijanka, G., O’Kennedy, R., and Loscher, C. E. (2016). Patulin, deoxynivalenol, zearalenone and T-2 toxin affect viability and modulate cytokine secretion in J774A.1 murine macrophages. Int. J. Chem. 8:22. doi: 10.5539/ijc.v8n2p22

CrossRef Full Text | Google Scholar

Luft, P., Oostingh, G. J., Gruijthuijsen, Y., Horejs-Hoeck, J., Lehmann, I., and Duschl, A. (2008). Patulin influences the expression of Th1/Th2 cytokines by activated peripheral blood mononuclear cells and T cells through depletion of intracellular glutathione. Environ. Toxicol. 23, 84–95. doi: 10.1002/tox.20309

PubMed Abstract | CrossRef Full Text | Google Scholar

Luo, X. (1994). “Food poisoning caused by fusarium toxins,” in Proceedings of The 2nd Asian Conference on Food Safety, (Bangkok: International Life Science Institute).

Google Scholar

Maaroufi, K., Achour, A., Betbeder, A. M., Hammami, M., Ellouz, F., Creppy, E. E., et al. (1995). Foodstuffs and human blood contamination by the mycotoxin ochratoxin A: correlation with chronic interstitial nephropathy in Tunisia. Arch. Toxicol. 69, 552–558. doi: 10.1007/s002040050211

PubMed Abstract | CrossRef Full Text | Google Scholar

Malik, A., Ali, S., Shahid, M., and Bhargava, R. (2014). Occupational exposure to Aspergillus and aflatoxins among food-grain workers in India. Int. J. Occup. Environ. Health 20, 189–193. doi: 10.1179/2049396714Y.0000000055

PubMed Abstract | CrossRef Full Text | Google Scholar

Marijanovic, D. R., Holt, P., Norred, W. P., Bacon, C. W., Voss, K. A., Stancel, P. C., et al. (1991). Immunosuppressive effects of Fusarium moniliforme corn cultures in chickens. Poult. Sci. 70, 1895–1901. doi: 10.3382/ps.0701895

PubMed Abstract | CrossRef Full Text | Google Scholar

Marin, D. E., Pistol, G. C., Gras, M. A., Palade, M. L., and Taranu, I. (2017). Comparative effect of ochratoxin a on inflammation and oxidative stress parameters in gut and kidney of piglets. Regul. Toxicol. Pharmacol. 89, 224–231. doi: 10.1016/j.yrtph.2017.07.031

PubMed Abstract | CrossRef Full Text | Google Scholar

Marin, D. E., Taranu, I., Burlacu, R., and Tudor, D. S. (2010). Effects of zearalenone and its derivatives on the innate immune response of Swine. Toxicon 56, 956–963. doi: 10.1016/j.toxicon.2010.06.020

PubMed Abstract | CrossRef Full Text | Google Scholar

Marzocco, S., Russo, R., Bianco, G., Autore, G., and Severino, L. (2009). Pro-apoptotic effects of nivalenol and deoxynivalenol trichothecenes in J774A.1 murine macrophages. Toxicol. Lett. 189, 21–26. doi: 10.1016/j.toxlet.2009.04.024

PubMed Abstract | CrossRef Full Text | Google Scholar

McCormick, S. P., Stanley, A. M., Stover, N. A., and Alexander, N. J. (2011). Trichothecenes: from simple to complex mycotoxins. Toxins 3, 802–814. doi: 10.3390/toxins3070802

PubMed Abstract | CrossRef Full Text | Google Scholar

McLaughlin, J., Padfield, P. J., Burt, J. P., and O’Neill, C. A. (2004). Ochratoxin a increases permeability through tight junctions by removal of specific claudin isoforms. Am. J. Physiol. Cell Physiol. 287, C1412–C1417. doi: 10.1152/ajpcell.00007.2004

PubMed Abstract | CrossRef Full Text | Google Scholar

Mehrzad, J., Devriendt, B., Baert, K., and Cox, E. (2014). Aflatoxin B1 Interferes with the antigen-presenting capacity of porcine dendritic cells. Toxicol. Vitro 28, 531–537. doi: 10.1016/j.tiv.2013.11.015

PubMed Abstract | CrossRef Full Text | Google Scholar

Mehrzad, J., Fazel, F., Pouyamehr, N., Hosseinkhani, S., and Dehghani, H. (2020). Naturally occurring level of aflatoxin b1 injures human, canine and bovine leukocytes through ATP depletion and caspase activation. Int. J. Toxicol. 39, 30–38. doi: 10.1177/1091581819892613

PubMed Abstract | CrossRef Full Text | Google Scholar

Mehrzad, J., Klein, G., Kamphues, J., Wolf, P., Grabowski, N., and Schuberth, H. J. (2011). In vitro effects of very low levels of aflatoxin B1 on free radicals production and bactericidal activity of bovine blood neutrophils. Vet. Immunol. Immunopathol. 141, 16–25. doi: 10.1016/j.vetimm.2011.01.010

PubMed Abstract | CrossRef Full Text | Google Scholar

Mekuria, A. N., Routledge, M. N., Gong, Y. Y., and Sisay, M. (2020). Aflatoxins as a risk factor for liver cirrhosis: a systematic review and meta-analysis. BMC Pharmacol. Toxicol. 21:39. doi: 10.1186/s40360-020-00420-7

PubMed Abstract | CrossRef Full Text | Google Scholar

Mirocha, C. J., Pathre, S. V., and Robison, T. S. (1981). Comparative metabolism of zearalenone and transmission into bovine milk. Food Cosmet. Toxicol. 19, 25–30. doi: 10.1016/0015-6264(81)90299-6

CrossRef Full Text | Google Scholar

Mohammadi, A., Mehrzad, J., Mahmoudi, M., and Schneider, M. (2014). Environmentally relevant level of aflatoxin B1 dysregulates human dendritic cells through signaling on key toll-like receptors. Int. J. Toxicol. 33, 175–186. doi: 10.1177/1091581814526890

PubMed Abstract | CrossRef Full Text | Google Scholar

Moon, E. Y., and Pyo, S. (2000). Aflatoxin B1 inhibits CD14-mediated nitric oxide production in murine peritoneal macrophages. Int. J. Immunopharmacol. 22, 237–246. doi: 10.1016/S0192-0561(99)00081-8

CrossRef Full Text | Google Scholar

Moon, Y., and Pestka, J. J. (2002). Vomitoxin-induced cyclooxygenase-2 gene expression in macrophages mediated by activation of ERK and P38 but Not JNK mitogen-activated protein kinases. Toxicol. Sci. 69, 373–382. doi: 10.1093/toxsci/69.2.373

PubMed Abstract | CrossRef Full Text | Google Scholar

Moyes, D. L., Runglall, M., Murciano, C., Shen, C., Nayar, D., Thavaraj, S., et al. (2010). A biphasic innate immune MAPK response discriminates between the yeast and hyphal forms of candida albicans in epithelial cells. Cell Host Microbe 8, 225–235. doi: 10.1016/j.chom.2010.08.002

PubMed Abstract | CrossRef Full Text | Google Scholar

Moyes, D. L., Wilson, D., Richardson, J. P., Mogavero, S., Tang, S. X., Wernecke, J., et al. (2016). Candidalysin is a fungal peptide toxin critical for mucosal infection. Nature 532, 64–68. doi: 10.1038/nature17625

PubMed Abstract | CrossRef Full Text | Google Scholar

Mullbacher, A., and Eichner, R. D. (1984). Immunosuppression in vitro by a metabolite of a human pathogenic fungus. Proc. Natl. Acad. Sci. U.S.A. 81, 3835–3837. doi: 10.1073/pnas.81.12.3835

PubMed Abstract | CrossRef Full Text | Google Scholar

Müller, G., Kielstein, P., Köhler, H., Berndt, A., and Rosner, H. (1995). Studies of the influence of ochratoxin a on immune and defence reactions in the mouse model. Mycoses 38, 85–91. doi: 10.1111/j.1439-0507.1995.tb00013.x

PubMed Abstract | CrossRef Full Text | Google Scholar

Naglik, J. R., Gaffen, S. L., and Hube, B. (2019). Candidalysin: discovery and function in candida albicans infections. Curr. Opin. Microbiol. 52, 100–109. doi: 10.1016/j.mib.2019.06.002

PubMed Abstract | CrossRef Full Text | Google Scholar

Newberne, P. M., and Butler, W. H. (1969). Acute and chronic effects of aflatoxin on the liver of domestic and laboratory animals: a review. Cancer Res. 29, 230–250.

Google Scholar

Oh, S. Y., Balch, C. G., Cliff, R. L., Sharma, B. S., Boermans, H. J., Swamy, H. V., et al. (2013). Exposure to penicillium mycotoxins alters gene expression of enzymes involved in the epigenetic regulation of bovine macrophages (BoMacs). Mycotoxin Res. 29, 235–243. doi: 10.1007/s12550-013-0174-y

PubMed Abstract | CrossRef Full Text | Google Scholar

Oh, S. Y., Mead, P. J., Sharma, B. S., Quinton, V. M., Boermans, H. J., Smith, T. K., et al. (2015). Effect of penicillium mycotoxins on the cytokine gene expression, reactive oxygen species production, and phagocytosis of bovine macrophage (BoMacs) function. Toxicol. Vitro 30(1 Pt B), 446–453. doi: 10.1016/j.tiv.2015.09.017

PubMed Abstract | CrossRef Full Text | Google Scholar

Orciuolo, E., Stanzani, M., Canestraro, M., Galimberti, S., Carulli, G., Lewis, R., et al. (2007). Effects of Aspergillus fumigatus gliotoxin and methylprednisolone on human neutrophils: implications for the pathogenesis of invasive Aspergillosis. J. Leukocyte Biol. 82, 839–848. doi: 10.1189/jlb.0207090

PubMed Abstract | CrossRef Full Text | Google Scholar

Özsoy, N., Selmanoğlu, G., Koçkaya, E. A., Gül, N., and Cebesoy, S. (2008). Effect of patulin on the interdigitating dendritic cells (IDCs) of rat thymus. Cell Biochem. Funct. 26, 192–196. doi: 10.1002/cbf.1431

PubMed Abstract | CrossRef Full Text | Google Scholar

Pahl, H. L., Krauss, B., Schulze-Osthoff, K., Decker, T., Traenckner, E. B., Vogt, M., et al. (1996). The immunosuppressive fungal metabolite gliotoxin specifically inhibits transcription factor NF-K B. J. Exp. Med. 183, 1829–1840. doi: 10.1084/jem.183.4.1829

PubMed Abstract | CrossRef Full Text | Google Scholar

Pardo, J., Urban, C., Galvez, E. M., Ekert, P. G., Müller, U., Kwon-Chung, J., et al. (2006). The mitochondrial protein bak is pivotal for gliotoxin-induced apoptosis and a critical host factor of Aspergillus fumigatus virulence in mice. J. Cell Biol. 174, 509–519. doi: 10.1083/jcb.200604044

PubMed Abstract | CrossRef Full Text | Google Scholar

Payros, D., Ménard, S., Laffitte, J., Neves, M., Tremblay-Franco, M., Luo, S., et al. (2020). The food contaminant, deoxynivalenol, modulates the thelper/treg balance and increases inflammatory bowel diseases. Arch. Toxicol. 94, 3173–3184. doi: 10.1007/s00204-020-02817-z

PubMed Abstract | CrossRef Full Text | Google Scholar

Peers, F. G. (1973). Dietary aflatoxins and liver cancer—a population based study in Kenya. Br. J. Cancer 27, 473–484. doi: 10.1038/bjc.1973.60

PubMed Abstract | CrossRef Full Text | Google Scholar

Pestka, J., and Zhou, H. R. (2006). Toll-like receptor priming sensitizes macrophages to proinflammatory cytokine gene induction by deoxynivalenol and other toxicants. Toxicol. Sci. 92, 445–455. doi: 10.1093/toxsci/kfl012

PubMed Abstract | CrossRef Full Text | Google Scholar

Peterson, S. W., Ito, Y., Horn, B. W., and Goto, T. (2001). aspergillus bombycis, a new aflatoxigenic species and genetic variation in its sibling species, a. nomius. Mycologia 93, 689–703. doi: 10.2307/3761823

CrossRef Full Text | Google Scholar

Pierron, A., Alassane-Kpembi, I., and Oswald, I. P. (2016). Impact of mycotoxin on immune response and consequences for pig health. Anim. Nutr. 2, 63–68. doi: 10.1016/j.aninu.2016.03.001

PubMed Abstract | CrossRef Full Text | Google Scholar

Pinton, P., Braicu, C., Nougayrede, J. P., Laffitte, J., Taranu, I., and Oswald, I. P. (2010). Deoxynivalenol impairs porcine intestinal barrier function and decreases the protein expression of claudin-4 through a mitogen-activated protein kinase-dependent mechanism. J. Nutr. 140, 1956–1962. doi: 10.3945/jn.110.123919

PubMed Abstract | CrossRef Full Text | Google Scholar

Power, M., Sharma, A. K., Lees, K. R., and Smithard, D. G. (2002). Dietary aflatoxin exposure and impaired growth in young children from benin and togo: cross sectional study. Bmj 325, 1089a–1089a. doi: 10.1136/bmj.325.7372.1089/a

CrossRef Full Text | Google Scholar

Prelusky, D. B., and Trenholm, H. L. (1993). The efficacy of various classes of anti−emetics in preventing deoxynivalenol−induced vomiting in swine. Nat. Toxins 1, 296–302. doi: 10.1002/nt.2620010508

PubMed Abstract | CrossRef Full Text | Google Scholar

Puel, O., Galtier, P., and Oswald, I. P. (2010). Biosynthesis and toxicological effects of patulin. Toxins 2, 613–631. doi: 10.3390/toxins2040613

PubMed Abstract | CrossRef Full Text | Google Scholar

Qureshi, M. A., Garlich, J. D., Hagler, W. M. Jr., and Weinstock, D. (1995). Fusarium proliferatum culture material alters several production and immune performance parameters in white leghorn chickens. Immunopharmacol. Immunotoxicol. 17, 791–804. doi: 10.3109/08923979509037197

PubMed Abstract | CrossRef Full Text | Google Scholar

Qureshi, M. A., and Hagler, W. M. (1992). Effect of fumonisin-b1 exposure on chicken macrophage functions in vitro. Poult. Sci. 71, 104–112. doi: 10.3382/ps.0710104

PubMed Abstract | CrossRef Full Text | Google Scholar

Richard, J. L. (1991). “Mycotoxins as immunomodulators in animal systems,” in Mycotoxins, Cancer and Health, eds G. A. Bray and D. H. Ryan (Baton Rouge, LA: Pennington Center Nutrition Series, Louisiana State University Press).

Google Scholar

Richardson, J. P., Mogavero, S., Moyes, D. L., Blagojevic, M., Krüger, T., Verma, A. H., et al. (2018a). Processing of Candida albicans Ece1p Is critical for Candidalysin maturation and fungal virulence. MBio 9, e02178-17. doi: 10.1128/mBio.02178-17

PubMed Abstract | CrossRef Full Text | Google Scholar

Richardson, J. P., Willems, H. M. E., Moyes, D. L., Shoaie, S., Barker, K. S., Tan, S. L., et al. (2018b). candidalysin drives epithelial signaling, neutrophil recruitment, and immunopathology at the vaginal mucosa. Infect. Immun. 86, e00645-17. doi: 10.1128/IAI.00645-17

PubMed Abstract | CrossRef Full Text | Google Scholar

Richetti, A., Cavallaro, A., Ainis, T., and Fimiani, V. (2005). Effect of mycotoxins on some activities of isolated human neutrophils. Immunopharmacol. Immunotoxicol. 27, 433–446. doi: 10.1080/08923970500241071

PubMed Abstract | CrossRef Full Text | Google Scholar

Röhm, M., Grimm, M. J., D’Auria, A. C., Almyroudis, N. G., Segal, B. H., and Urban, C. F. (2014). NADPH oxidase promotes neutrophil extracellular trap formation in pulmonary aspergillosis. Infect. Immun. 82, 1766–1777. doi: 10.1128/IAI.00096-14

PubMed Abstract | CrossRef Full Text | Google Scholar

Rogiers, O., Frising, U. C., Kucharíková, S., Jabra-Rizk, M. A., van Loo, G., and Dijck, P. Van, et al. (2019). Candidalysin crucially contributes to Nlrp3 inflammasome activation by Candida albicans Hyphae. MBio 10, e2221–e2218. doi: 10.1128/mBio.02221-18

PubMed Abstract | CrossRef Full Text | Google Scholar

Romero, A., Ares, I., Ramos, E., Castellano, V., Martínez, M., Martínez-Larrañaga, M. R., et al. (2016). Mycotoxins modify the barrier function of caco-2 cells through differential gene expression of specific claudin isoforms: protective effect of illite mineral clay. Toxicology 353–354, 21–33. doi: 10.1016/j.tox.2016.05.003

PubMed Abstract | CrossRef Full Text | Google Scholar

Saito, M., Tsuruta, O., Siriacha, P., Kawasugi, S., and Manabe, M. (1989). Atypical strains of Aspergillus flavus isolated in maize fields aflatoxin-producing ability and distribution in Thailand. JPN Int. Res. Center Agric. Sci. 23, 151–154.

Google Scholar

Schlam, D., Canton, J., Carreño, M., Kopinski, H., Freeman, S. A., Grinstein, S., et al. (2016). Gliotoxin suppresses macrophage immune function by subverting phosphatidylinositol 3,4,5-trisphosphate homeostasis. MBio 7:e02242. doi: 10.1128/mBio.02242-15

PubMed Abstract | CrossRef Full Text | Google Scholar

Schroeder, H. W., and Boller, R. A. (1973). Aflatoxin production of species and strains of the Aspergillus flavus group isolated from field crops. Appl. Microbiol. 25, 885–889. doi: 10.1128/aem.25.6.885-889.1973

CrossRef Full Text | Google Scholar

Seeboth, J., Solinhac, R., Oswald, I. P., and Guzylack-Piriou, L. (2012). The fungal T-2 toxin alters the activation of primary macrophages induced by TLR-agonists resulting in a decrease of the inflammatory response in the pig. Vet. Res. 43:35. doi: 10.1186/1297-9716-43-35

PubMed Abstract | CrossRef Full Text | Google Scholar

Shank, R. C., Bhamarapravati, N., Gordon, J. E., and Wogan, G. N. (1972). Dietary aflatoxins and human liver cancer. IV. Incidence of Primary Liver Cancer in Two Municipal Populations of Thailand. Food Cosmet. Toxicol. 10, 171–179. doi: 10.1016/S0015-6264(72)80195-0

CrossRef Full Text | Google Scholar

Shirani, K., Zanjani, B. R., Mahmoudi, M., Jafarian, A. H., Hassani, F. V., Giesy, J. P., et al. (2018). Immunotoxicity of aflatoxin M1: as a potent suppressor of innate and acquired immune systems in a subacute study. J. Sci. Food Vet. Agric. 98, 5884–5892. doi: 10.1002/jsfa.9240

PubMed Abstract | CrossRef Full Text | Google Scholar

Silvotti, L., Petterino, C., Bonomi, A., and Cabassi, E. (1997). Immunotoxicological effects on piglets of feeding sows diets containing aflatoxins. Vet. Record 141, 469–472. doi: 10.1136/vr.141.18.469

PubMed Abstract | CrossRef Full Text | Google Scholar

Smith, W. L., DeWitt, D. L., and Garavito, R. M. (2000). Cyclooxygenases: Structural. Cell. Mol. Biol. Ann. Rev. Biochem. Ann. Rev. Biochem. 69, 145–182. doi: 10.1146/annurev.biochem.69.1.145

PubMed Abstract | CrossRef Full Text | Google Scholar

Soliman, S. S. M., Baldin, C., Gu, Y., Singh, S., Gebremariam, T., Swidergall, M., et al. (2021). Mucoricin is a ricin-like toxin that is critical for the pathogenesis of mucormycosis. Nat. Microbiol. 6, 313–326. doi: 10.1038/s41564-020-00837-0

PubMed Abstract | CrossRef Full Text | Google Scholar

Song, E., Xia, X., Su, C., Dong, W., Xian, Y., Wang, W., et al. (2014). Hepatotoxicity and genotoxicity of patulin in mice, and its modulation by green tea polyphenols administration. Food Chem. Toxicol. 71, 122–127. doi: 10.1016/j.fct.2014.06.009

PubMed Abstract | CrossRef Full Text | Google Scholar

Spikes, S., Xu, R., Nguyen, C. K., Chamilos, G., Kontoyiannis, D. P., Jacobson, R. H., et al. (2008). Gliotoxin production in Aspergillus fumigatus contributes to host−specific differences in virulence. J. Infect. Dis. 197, 479–486. doi: 10.1086/525044

PubMed Abstract | CrossRef Full Text | Google Scholar

Stanzani, M., Orciuolo, E., Lewis, R., Kontoyiannis, D. P., Martins, S. L. R., St John, L. S., et al. (2005). Aspergillus fumigatus suppresses the human cellular immune response via gliotoxin-mediated apoptosis of monocytes. Blood 105, 2258–2265. doi: 10.1182/blood-2004-09-3421

PubMed Abstract | CrossRef Full Text | Google Scholar

Su, J., Liu, D., Wang, Q., Lin, J., Song, S., and Huang, K. (2019). Long-time instead of short-time exposure in vitro and administration in vivo of ochratoxin a is consistent in immunosuppression. J. Agric. Food Chem. 67, 7485–7495. doi: 10.1021/acs.jafc.9b02595

PubMed Abstract | CrossRef Full Text | Google Scholar

Suen, Y. K., Fung, K. P., Lee, C. Y., and Kong, S. K. (2001). Gliotoxin induces apoptosis in cultured macrophages via production of reactive oxygen species and cytochrome c release without mitochondrial depolarization. Free Radical Res. 35, 1–10. doi: 10.1080/10715760100300541

PubMed Abstract | CrossRef Full Text | Google Scholar

Sugiyama, I., Muroi, M., Kinoshita, M., Hamada, O., Minai, Y., Sugita-Konishi, Y., et al. (2016). NF-K B activation via MyD88-dependent toll-like receptor signaling is inhibited by trichothecene mycotoxin deoxynivalenol. J. Toxicol. Sci. 41, 273–279. doi: 10.2131/jts.41.273

PubMed Abstract | CrossRef Full Text | Google Scholar

Sugui, J. A., Pardo, J., Chang, Y. C., Zarember, K. A., Nardone, G., Galvez, E. M., et al. (2007). Gliotoxin is a virulence factor of Aspergillus fumigatus: glip deletion attenuates virulence in mice immunosuppressed with hydrocortisone. Eukaryotic. Cell 6, 1562–1569. doi: 10.1128/EC.00141-07

PubMed Abstract | CrossRef Full Text | Google Scholar

Sun, M., Wang, S., Jiang, L., Bai, Y., Sun, X., Li, J., et al. (2018). Patulin induces autophagy-dependent apoptosis through lysosomal-mitochondrial axis and impaired mitophagy in HepG2 cells. J. Agric. Food Chem. 66, 12376–12384. doi: 10.1021/acs.jafc.8b03922

PubMed Abstract | CrossRef Full Text | Google Scholar

Surup, F., Medjedović, A., Szczygielski, M., Schroers, H. J., and Stadler, M. (2014). Production of trichothecenes by the apple sooty blotch fungus Microcyclospora tardicrescens. J. Agric. Food Chem. 62, 3525–3530. doi: 10.1021/jf500153d

PubMed Abstract | CrossRef Full Text | Google Scholar

Swidergall, M., Khalaji, M., Solis, N. V., Moyes, D. L., Drummond, R. A., Hube, B., et al. (2019). Candidalysin is required for neutrophil recruitment and virulence during systemic Candida albicans infection. J. Infect. Dis. 220, 1477–1488. doi: 10.1093/infdis/jiz322

PubMed Abstract | CrossRef Full Text | Google Scholar

Tatay, E., Espín, S., García-Fernández, A. J., and Ruiz, M. J. (2018). Estrogenic activity of zearalenone, α-zearalenol and β-zearalenol assessed using the e-screen assay in MCF-7 cells. Toxicol. Mechanisms Methods 28, 239–242. doi: 10.1080/15376516.2017.1395501

PubMed Abstract | CrossRef Full Text | Google Scholar

Thurston, J. R., Richard, J. L., and Peden, W. M. (1986). “Immunomodulation in mycotoxicoses other than aflatoxicosis,” in Diagnosis of Mycotoxicoses, eds J. L. Richard and J. R. Thurston (Dordrecht: Springer), 149–161. doi: 10.1007/978-94-009-4235-6_14

CrossRef Full Text | Google Scholar

Tsai, W. T., Lo, Y. C., Wu, M. S., Li, C. Y., Kuo, Y. P., Lai, Y. H., et al. (2016). Mycotoxin Patulin suppresses innate immune responses by mitochondrial dysfunction and P62/sequestosome-1-dependent mitophagy. J. Biol. Chem. 291, 19299–19311. doi: 10.1074/jbc.M115.686683

PubMed Abstract | CrossRef Full Text | Google Scholar

Tsunawaki, S., Yoshida, L. S., Nishida, S., Kobayashi, T., and Shimoyama, T. (2004). Fungal metabolite gliotoxin inhibits assembly of the human respiratory burst NADPH oxidase. Infect. Immun. 72, 3373–3382. doi: 10.1128/IAI.72.6.3373-3382.2004

PubMed Abstract | CrossRef Full Text | Google Scholar

Tuomi, T., Reijula, K., Johnsson, T., Hemminki, K., Hintikka, E. L., Lindroos, O., et al. (2000). Mycotoxins in crude building materials from water-damaged buildings. Appl. Environ. Microbiol. 66, 1899–1904. doi: 10.1128/AEM.66.5.1899-1904.2000

PubMed Abstract | CrossRef Full Text | Google Scholar

Ubagai, T., Tansho, S., Ito, T., and Ono, Y. (2008). Influences of aflatoxin b1 on reactive oxygen species generation and chemotaxis of human polymorphonuclear leukocytes. Toxicol. Vitro 22, 1115–1120. doi: 10.1016/j.tiv.2008.01.007

PubMed Abstract | CrossRef Full Text | Google Scholar

Ukwuru, M. U., Ohaegbu, C. G., and Muritala, A. (2017). An overview of mycotoxin contamination of foods and feeds. J. Biochem. Microbial. 1:101.

Google Scholar

van der Merwe, K. J., Steyn, P. S., Fourie, L., Scott, D. B., and Theron, J. J. (1965). Ochratoxin a, a toxic metabolite produced by aspergillus ochraceus wilh. Nature 205, 1112–1113. doi: 10.1038/2051112a0

PubMed Abstract | CrossRef Full Text | Google Scholar

Vane, J. R., Bakhle, Y. S., and Botting, R. M. (1998). Cyclooxygenases 1 and 2. Ann. Rev. Pharmacol. Toxicol. 38, 97–120. doi: 10.1146/annurev.pharmtox.38.1.97

PubMed Abstract | CrossRef Full Text | Google Scholar

Venkatasubbaiah, P., Sutton, T. B., and Chilton, W. S. (1995). The structure and biological properties of secondary metabolites produced by peltaster fructicola, a fungus associated with apple sooty blotch disease. Plant Dis. 79, 1157–1160.

Google Scholar

Verma, A. H., Richardson, J. P., Zhou, C., Coleman, B. M., Moyes, D. L., Ho, J., et al. (2017). Oral epithelial cells orchestrate innate type 17 responses to candida albicans through the virulence factor candidalysin. Sci. Immunol. 2:eaam8834. doi: 10.1126/sciimmunol.aam8834

PubMed Abstract | CrossRef Full Text | Google Scholar

Videmann, B., Mazallon, M., Tep, J., and Lecoeur, S. (2008). Metabolism and transfer of the mycotoxin zearalenone in human intestinal Caco-2 cells. Food Chem. Toxicol. 46, 3279–3286. doi: 10.1016/j.fct.2008.07.011

PubMed Abstract | CrossRef Full Text | Google Scholar

Wan, D., Wang, X., Wu, Q., Lin, P., Pan, Y., Sattar, A., et al. (2015). Integrated transcriptional and proteomic analysis of growth hormone suppression mediated by trichothecene T-2 toxin in rat GH3 cells. Toxicol. Sci. 147, 326–338. doi: 10.1093/toxsci/kfv131

PubMed Abstract | CrossRef Full Text | Google Scholar

Wan, L. Y., Turner, P. C., and El-Nezami, H. (2013). Individual and combined cytotoxic effects of fusarium toxins (Deoxynivalenol, Nivalenol, Zearalenone and Fumonisins B1) on swine jejunal epithelial cells. Food Chem. Toxicol. 57, 276–283. doi: 10.1016/j.fct.2013.03.034

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, H., Chen, Y., Zhai, N., Chen, X., Gan, F., Li, H., et al. (2017). Ochratoxin a-induced apoptosis of ipec-j2 cells through ros-mediated mitochondrial permeability transition pore opening pathway. J. Agric. Food Chem. 65, 10630–10637. doi: 10.1021/acs.jafc.7b04434

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, J. S., Qian, G. S., Zarba, A., He, X., Zhu, Y. R., Zhang, B. C., et al. (1996). Temporal patterns of aflatoxin-albumin adducts in hepatitis b surface antigen-positive and antigen-negative residents of daxin, qidong county, people’s republic of china. Cancer Epidemiol. Prevention Biomarkers 5, 253–261.

Google Scholar

Wang, N., Liang, H., and Zen, K. (2014). Molecular mechanisms that influence the macrophage M1-M2 polarization balance. Front. Immunol. 5:614. doi: 10.3389/fimmu.2014.00614

PubMed Abstract | CrossRef Full Text | Google Scholar

Wang, X., Yu, H., Shan, A., Jin, Y., Fang, H., Zhao, Y., et al. (2018). Toxic effects of zearalenone on intestinal microflora and intestinal mucosal immunity in Mice. Food Agric. Immunol. 29, 1002–1011. doi: 10.1080/09540105.2018.1503233

CrossRef Full Text | Google Scholar

Ward, C., Chilvers, E. R., Lawson, M. F., Pryde, J. G., Fujihara, S., Farrow, S. N., et al. (1999). NF-K B activation is a critical regulator of human granulocyte apoptosis in vitro. J. Biol. Chem. 274, 4309–4318. doi: 10.1074/jbc.274.7.4309

PubMed Abstract | CrossRef Full Text | Google Scholar

Waring, P., Eichner, R. D., Mullbacher, A., and Sjaarda, A. (1988). Gliotoxin induces apoptosis in macrophages unrelated to its antiphagocytic properties. J. Biol. Chem. 263, 18493–18499.

Google Scholar

Weindling, R. (1941). Experimental consideration of the mold-toxins of gliocladium and trichoderma. Phytopath 31, 991–1003.

Google Scholar

Weindling, R., and Emerson, O. H. (1936). The Isolation of a toxic substance from the culture filtrate of trichoderma. Phytopathology 26, 1068–1070.

Google Scholar

Wong, S., Schwartz, R. C., and Pestka, J. J. (2001). Superinduction of TNF-α and IL-6 in macrophages by vomitoxin (Deoxynivalenol) modulated by mRNA stabilization. Toxicology 161, 139–149. doi: 10.1016/S0300-483X(01)00331-6

CrossRef Full Text | Google Scholar

Xiong, Z., Wang, Q., Xie, Y., Li, N., Yun, W., and Yang, L. (2021). Simultaneous detection of aflatoxin B1 and ochratoxin a in food samples by Dual DNA tweezers nanomachine. Food Chem. 338:128122. doi: 10.1016/j.foodchem.2020.128122

PubMed Abstract | CrossRef Full Text | Google Scholar

Xu, Q., Shi, W., Lv, P., Meng, W., Mao, G., Gong, C., et al. (2020). Critical role of caveolin-1 in aflatoxin B1-induced hepatotoxicity via the regulation of oxidation and autophagy. Cell Death Dis. 11:6. doi: 10.1038/s41419-019-2197-6

PubMed Abstract | CrossRef Full Text | Google Scholar

Yang, G. H., Jarvis, B. B., Chung, Y. J., and Pestka, J. J. (2000). Apoptosis Induction by the satratoxins and other trichothecene mycotoxins: relationship to ERK, P38 MAPK, and SAPK/JNK activation. Toxicol. Appl. Pharmacol. 164, 149–160. doi: 10.1006/taap.1999.8888

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhang, C., Chen, F., Liu, X., Han, X., Hu, Y., Su, X., et al. (2019). Gliotoxin induces cofilin phosphorylation to promote actin cytoskeleton dynamics and internalization of aspergillus fumigatus into type II human pneumocyte cells. Front. Microbiol. 10:1345. doi: 10.3389/fmicb.2019.01345

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhou, H. R., Islam, Z., and Pestka, J. J. (2003). Rapid, sequential activation of mitogen-activated protein kinases and transcription factors precedes proinflammatory cytokine mRNA expression in spleens of mice exposed to the trichothecene vomitoxin. Toxicol. Sci. 72, 130–142. doi: 10.1093/toxsci/kfg006

PubMed Abstract | CrossRef Full Text | Google Scholar

Zhou, H. R., Yan, D., and Pestka, J. J. (1997). Differential cytokine mrna expression in mice after oval exposure to the trichothecene vomitoxin (Deoxynivalenol): dose response and time course. Toxicol. Appl. Pharmacol. 144, 294–305. doi: 10.1006/taap.1997.8132

PubMed Abstract | CrossRef Full Text | Google Scholar

Keywords: fungal toxins, mycotoxins, candidalysin, immunity, toxins

Citation: Brown R, Priest E, Naglik JR and Richardson JP (2021) Fungal Toxins and Host Immune Responses. Front. Microbiol. 12:643639. doi: 10.3389/fmicb.2021.643639

Received: 18 December 2020; Accepted: 08 March 2021;
Published: 13 April 2021.

Edited by:

Ludovic Tailleux, Institut Pasteur, France

Reviewed by:

Philippe Guerre, Ecole Nationale Vétérinaire de Toulouse, France
Eva M. Galvez, Institute of Carbochemistry (CSIC), Spain

Copyright © 2021 Brown, Priest, Naglik and Richardson. This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.

*Correspondence: Jonathan P. Richardson, am9uYXRoYW4ucmljaGFyZHNvbkBrY2wuYWMudWs=

Disclaimer: All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.