Abstract
Drug-resistant bacteria infections and drug residues have been increasing and causing antibiotic resistance and public health threats worldwide. Antimicrobial peptides (AMPs) are novel antimicrobial drugs with the potential to solve these problems. Here, a peptide based on our previously studied peptide PMAP-36PW was designed via N-terminal myristoylation and referred to as Myr-36PW. The fatty acid modification provided the as-prepared peptide with good stability and higher antimicrobial activity compared with PMAP-36PW in vitro. Moreover, Myr-36PW exhibited effective anti-biofilm activity against Gram-negative bacteria and may kill bacteria by improving the permeability of their membranes. In addition, the designed peptide Myr-36PW could inhibit the bacterial growth of Staphylococcus aureus ATCC 25923 and Pseudomonas aeruginosa GIM 1.551 to target organs, decrease the inflammatory damage, show an impressive therapeutic effect on mouse pneumonia and peritonitis experiments, and promote abscess reduction and wound healing in infected mice. These results reveal that Myr-36PW is a promising antimicrobial agent against bacterial infections.
Introduction
Traditional antibiotic resistance and veterinary drug residues have been annually increasing and causing a serious global public health threat (CiŽman and Plankar Srovin, ). The World Health Organization (WHO) has emphasized that the incidence of infections caused by drug-resistant bacteria has been increasing globally and may kill 10 million people by 2050 (Woolhouse et al., ; Zhen et al., ). Antimicrobial peptides (AMPs) are new antimicrobial drugs (Mwangi et al., ; Borro et al., ), particularly natural AMPs that have attracted attention due to their broad spectrum activity, rapid killing effect, and low induced resistance (Agarwal et al., ; Deslouches and Di, ). However, only few AMPs are currently in clinical application due to their instability, high cytotoxicity and low antimicrobial activity (Greber and Dawgul, ; Jacob et al., ). Many methods such as substitution (Zhou et al., ), cyclization (Mwangi et al., ), and hybridization (Miao et al., ) have been studied and adopted to overcome these shortcomings.
PMAP-36 is a typical amphiphilic α-helical antimicrobial peptide isolated from porcine myeloid cells (Lv et al., ). We previously designed PMAP-36PW using Trp (W) to replace the positions of 25 and 26 Pro (P) of PMAP-36, to increase hydrophobicity of PMAP-36 and provided it with high antibacterial activity, good stability, and effective reduction in bacterial load and tissue damage in infected mice (Zhou et al., ). Myristic acid is a 14-carbon saturated fatty acid, and its modification is widely used in proteins and directs the cellular localizations (Martin et al., ). The antibacterial activity of antimicrobial peptides can be improved by N-terminal myristoylation, and N-terminal myristic acid modification is a simple and feasible treatment strategy for drug-resistant bacterial infections (Krishnakumari et al., ; Lei et al., ).
In this study, an N-terminal myristoylated antimicrobial peptide Myr-36PW was designed to improve antimicrobial activities. A series of experimental methods was performed to investigate the antibacterial activity, stability, toxicity, anti-biofilm activity, and antibacterial mechanism in vitro and therapeutic effect in mice infected with Staphylococcus aureus ATCC 25923 and Pseudomonas aeruginosa GIM 1.551.
Materials and Methods
Bacterial Strain, Antibiotic, Reagents, and Mice
S. aureus ATCC 25923 were kindly provided by Bin Tang at Jilin University (China). Listeria monocytogenes CICC 21634 was isolated from clinical cases and maintained in the China Center of Industrial Culture Collection (CICC, China). Salmonella typhimurium SL 1344 and P. aeruginosa GIM 1.551 specimens were isolated from clinical cases and maintained in our laboratory. NIH 3T3 cells were kindly provided by Dr. Lu at Nanjing Medical University (China). Dulbecco's-modified eagle medium (DMEM) and neonatal bovine serum (NBS) were purchased from Sijiqing Biotech (China). Ceftiofur sodium, ampicillin sodium, benzylpenicillin potassium, lysogenic broth (LB) medium, trypticase soy broth (TSB) medium, brain heart infusion (BHI) medium, Mueller-Hinton broth (MHB) medium, mice serum, Triton X-100, methyl thiazolyl diphenyltetrazolium bromide (MTT), dimethyl sulfoxide (DMSO) and propidium iodide (PI) were purchased from Procell Corporation (Wuhan, China). A total of 360 specific pathogen-free (SPF) BALB/c mice (aged 4–6 weeks, weighting 20 ± 3 g, with equal numbers of males and females) were purchased from Henan Province Experimental Animal Center (Henan, Chain). All animal experiments were conducted in accordance with the guidelines and with the approval of the Animal Experiment Committee of Henan University of Science and Technology (No. 20190719001).
Peptide Synthesis
PMAP-36, PMAP-36PW, and Myr-36PW were synthesized by Fmoc-chemistry at Shanghai Apeptide Biological Technology Co., Ltd (Shanghai, China). All peptides were purified by reverse phase high-performance liquid chromatography (HPLC) to a purity of >95%, and the synthesized peptides were identified by using electrospray ionization mass spectrometry (MS).
Inhibition Zone Assay
The inhibition zone assay was performed through the disk diffusion to evaluate the antimicrobial activity of Myr-36PW in vitro (Dunne et al., ). The four above-mentioned bacterial strains were used as experimental strains, with L. monocytogenes CICC 21634 cultured in BHI medium, and P. aeruginosa GIM 1.551 cultured in TSB medium. The bacterial cells were cultured for 12 h at 37°C in the appropriate medium, and the bacterial cell suspension was spread on LB agar. The disks containing 10 μg of peptides (1 μg/μL) were attached to the solid medium and incubated at 37°C for 18 h. Finally the diameter of the inhibition zone was measured.
MIC Assay
The MICs of Myr-36PW in vitro were measured through microdilution in accordance with the Clinical and Laboratory Standards Institute (CLSI, ). The bacterial cells were cultured for 12 h at 37°C in the appropriate medium and then diluted to 1 × 106 CFU/mL. Equal volumes (100 μL) of bacterial cell suspension and two-fold serially diluted different concentrations peptides (0.0039–256 μg/mL) were added to each well of the sterile 96-well plate. The samples were incubated for 18 h at 37°C. After incubation, the MICs of the peptides were determined by evaluating the growth based on the OD600 of the cultures.
Thermal Stability Testing
For thermal stability analysis, the Myr-36PW and peptides were boiled for 10, 20, 30, 40, 50, 60, 90, and 120 min as reported (Ebbensgaard et al., ) with unboiled peptides as controls. Inhibition zone assay was performed against S. aureus ATCC 25923 and P. aeruginosa GIM 1.551. The inhibition zone diameters of peptides (10 μg, 1 μg/μL) were measured after incubation for 18 h at 37°C, and the inhibition curve was drawn.
pH Stability Testing
For stability test, the Myr-36PW and peptides were treated with pH 2–13, and PBS buffer with different pH values was used as a control (Wang et al., ). Inhibition zone assay was performed against S. aureus ATCC 25923 and P. aeruginosa GIM 1.551. The inhibition zone diameters of peptides (10 μg, 1 μg/μL) were measured after incubation for 18 h at 37°C, and the inhibition curve was drawn.
Salt and Serum Stability Assays
The effects of abiotic factors on the antibacterial activity of Myr-36PW were investigated by MIC assay (Xi et al., ; Zhong et al., ). S. aureus ATCC 25923 and P. aeruginosa GIM 1.551 overnight cultures were diluted to 1 × 106 CFU/mL, and the MICs of peptides in MHB with different concentration of physiological salts (150 mM NaCL, 2 mM CaCL2) were determined. And after the peptides incubated in 10% mice serum for 1 h at 37°C, MICs of peptides against S. aureus ATCC 25923 and P. aeruginosa GIM 1.551 were determined. The MICs in MHB in the absence of physiological salts and serum were used as the control group.
Hemolysis Assay
The in vitro hemolytic activity of Myr-36PW was evaluated as described previously (Singh et al., ). In brief, 100 μL mouse erythrocyte suspension (final concentration 8% v/v) was treated with 100 μL of peptides (2.5–640 μg/mL) in a 96-well plate incubated for 1 h at 37°C, and then centrifuged at 1,000 × g for 5 min. The supernatant was transferred to another 96-well plate, and the absorbance was measured at 570 nm. PBS and 0.2% Triton X-100 served as the negative and positive controls, respectively. Hemolysis rate (%) = [OD570 nm(peptides) – OD570 nm(PBS)]/[OD570 nm(TritonX−100) – OD570 nm(PBS)] × 100%.
Cytotoxicity Assay
NIH 3T3 cells were used to evaluate the cytotoxicity of Myr-36PW in vitro by MTT assays (Jia et al., ). The NIH 3T3 cells were cultured in DMEM with 10% NBS and seeded in 96-well plate (2 × 105cells/well). After incubation for 24 h at 37°C, different concentrations of peptides (2.5–640 μg/mL) were added to the wells and incubated for 24 h at 37°C. Afterward, 20 μL MTT solution (5 mg/mL) was added to each well and incubated for another 4 h at 37°C. The medium was completely removed, and 150 μL of DMSO was added in each well to dissolve the formazan crystals. Finally, absorbance was measured at 570 nm.
Biofilm Inhibition Assay
The biofilm-inhibiting ability of Myr-36PW was evaluated against S. aureus ATCC 25923, S. typhimurium SL 1344, and P. aeruginosa GIM 1.551 by using crystal violet dye (Chen et al., ; de Breij et al., ). Overnight cultured strains in TSB medium were diluted to 1 × 106 CFU/mL, 100 μL of bacterial suspension with 100 μL of different concentration of peptides (0.25–128 μg/mL) was added into a 96-well plate. Bacterial suspension without peptides was used the negative control. After incubation for 24 h at 37°C, the supernatant weas discarded, and the biofilm was gently washed with PBS, fixed in methanol for 20 min, stained with 0.1% (w/v) crystal violet for 10 min, and finally removed. After washing with PBS, 95% ethanol was added into wells, and the optical density (OD) was measured at 620 nm.
Biofilm Eradication Assay
The biofilm-eradicating ability of Myr-36PW was determined against S. aureus ATCC 25923, S. typhimurium SL 1344, and P. aeruginosa GIM 1.551 (Chen et al., ; de Breij et al., ). In brief, 200 μL of bacterial dilution (1 × 106 CFU/mL) was added into a 96-well plate and incubated for 24 h at 37°C to form a biofilm, which was washed three times with PBS. Subsequently, 200 μL of peptides at 128 μg/mL were added to the wells. After incubation for 1 h at 37°C, the OD of each well was measured at 620 nm by crystal violet staining. The wells were gently washed three times with PBS after 1 h incubation to evaluate the killing effect of Myr-36PW against bacteria in the biofilm. Afterward, 100 μL of suspension was serially diluted and spread on LB agar plates, and bacterial colony was measured.
Membrane Permeability Assay
The membrane permeability assay was performed to analyze the bacterial killing of Myr-36PW by using inverted fluorescence microscope with PI as a fluorescent indicator. Overnight cultured bacteria (1.5 mL) were centrifuged at 2,000 × g for 5 min and then washed three times with PBS. The bacterial precipitates were resuspended with peptides (1.5 mL) at a concentration of MIC (P. aeruginosa GIM 1.551), 2MIC (S. typhimurium SL 1344), and 4MIC (S. aureus ATCC 25923 and L. monocytogenes CICC 21634), and PBS was added as a control. The samples were incubated at 37°C for 30 min. Equal volumes of PI (200 μg/mL) were added and incubated at 37°C for 10 min in the dark environment. The samples were placed on a glass slide, covered with coverslip, and dried. Bacterial cells were imaged by an inverted fluorescence microscope.
Experimental of Lung Infection and Treatment
A pneumonia model in vivo was established as previously reported, with minor modification (Cortés et al., ; Aoki et al., ; Shi et al., ). A total of 120 mice were randomly divided into two experimental models, one was intranasal inoculation of S. aureus ATCC 25923 (8.3 × 109 CFU/mL, 50 μL), and the other was intranasal inoculation of P. aeruginosa GIM 1.551 (4.5 × 1010 CFU/mL, 50 μL). In the S. aureus ATCC 25923 model, 60 mice were divided into the following six groups of 10 mice each: no infection and treatment was used as a blank control, those with intranasal administration of PBS (40 μL) as the negative control group, those administered with benzylpenicillin potassium (40 μL, 1 μg/μL) as the positive control group, and the remaining three corresponded to Myr-36PW (40 μL, 1 μg/μL), PMAP-36PW (40 μL, 1 μg/μL), and PMAP-36 groups (40 μL, 1 μg/μL). The procedure for P. aeruginosa GIM 1.551 model is the same as for S. aureus ATCC 25923 model, except for the use of ampicillin sodium as the positive control. After 4 h post-inoculation, treatment was initiated, once a day for 3 days. The mice were sacrificed 24 h after the treatment. Changes in the appearance of lung tissues were observed, and lung tissues were removed aseptically from the mice. Half of the removed lung tissues were gently fixed in buffered formaldehyde solution for histopathological assessment by hematoxylin and eosin (H&E) staining. Pathological changes were scored to provide individual therapeutic status as described previously (Lei et al., ). The remaining lung tissues were added with 1 mL of PBS, homogenized, and serially diluted. Bacterial CFU counts were determined.
Experimental of Peritonitis Model
The peritonitis model in vivo was generated by intraperitoneally injecting S. aureus ATCC 25923 (2.5 × 109 CFU/mL, 140 μL). Sixty mice were randomly divided into six groups of 10 members: those who received no infection and treatment was used as a blank control, those with intranasal administration of PBS (60 μL) as the negative control group, those administered with benzylpenicillin potassium (60 μL, 1 μg/μL) as the positive control group, and the remaining three groups corresponded to three antimicrobial peptide groups of Myr-36PW (60 μL, 1 μg/μL), PMAP-36PW (60 μL, 1 μg/μL), and PMAP-36 (60 μL, 1 μg/μL). After 4 h post-inoculation, treatment was initiated by intraperitoneal injection once a day for 3 days. The mice were sacrificed 24 h the treatment. Changes in the appearance of anatomical tissues were observed. The liver and spleen tissues were removed aseptically from the mice, and half of these samples were gently fixed in buffered formaldehyde solution for histopathological assessment by hematoxylin and eosin (H&E) staining. Pathological changes were scored to assess individual therapeutic status as described previously (Song et al., ; Lei et al., ). The remaining half of livers and spleens were added with 1 mL of PBS, homogenized, and serially diluted. Bacterial CFU counts were measured.
Experimental of Skin Infection and Treatment
A subcutaneous abscess model in vivo was established as previously reported (Zhao et al., ). The mouse dorsal region with 3.0 cm diameter was treated with hair pusher. A total of 120 mice were randomly divided into two experimental models, one was challenged with S. aureus ATCC 25923 (2.5 × 108 CFU/mL, 60 μL), and the other was challenged with P. aeruginosa GIM 1.551 (3.0 × 108 CFU/mL, 60 μL). In the S. aureus ATCC 25923 model, 60 mice were divided into six groups of 10 members. The mice with no infection and treatment was used as a blank control, those directly injected with PBS (20 μL) as the negative control group, those injected with benzylpenicillin potassium (20 μL, 1 μg/μL) as the positive control group, and the remaining three groups as the treatment groups injected with Myr-36PW (20 μL, 1 μg/μL), PMAP-36PW (20 μL, 1 μg/μL), and PMAP-36 (20 μL, 1 μg/μL). The procedure in P. aeruginosa GIM 1.551 model is the same as that in S. aureus ATCC 25923 model, except for the use of ampicillin sodium as a positive control. Treatment once a day for 3 days was initiated when the mice developed prominent pustules on their backs. A day after the treatment, the size of the abscess was observed, and its tissues were excised, homogenized, and serially diluted. Bacteria CFU counts were calculated.
Experiment of Wound Infection and Treatment
Sixty mice with ten mice in each group were used in the experiment. Infection and treatment were performed as previously described (Hong et al., ). The mouse dorsal region with a diameter of 3.0 cm was treated with hair pusher, and a full-thickness 2.0 cm diameter wound was created by excising the skin and infected by direct seeding with P. aeruginosa GIM 1.551 (1 × 108 CFU/mL, 50 μL). The wound was then covered with sterile gauze to prevent cross contamination. Treatment was initiated at 24 h after bacterial inoculation. The mice with no infection and treatment was used as a blank control, those provided with PBS (20 μL) as the negative control group, those administered with ampicillin sodium (20 μL, 1 μg/μL) as the positive control group, and the remaining were those treated with the three peptides (20 μL, 1 μg/μL) once a day for 7 days as the treatment groups. The mice were sacrificed after the 7 day treatment. Changes in the wound were observed, and the infected sections of skin were aseptically contained, homogenized, and serially diluted. Bacterial CFU counts were obtained.
Statistical Analysis
Experimental data were encoded in Graphpad 8.0 and presented as mean ± SD. Statistical analyses were performed using unpaired t-tests or one-way ANOVA F-statistics, and differences were considered significant at P < 0.05 or P < 0.01. The sections were observed using Pannoramic Viewer software.
Results
Peptide Design and Characterization
Myr-36PW was designed through fatty acid modification to further improve the antibacterial activity of PMAP-36PW. Myristic acid, a 14-carbon saturated fatty acid was selected to couple with the N-terminus of PMAP-36PW via an amide bond containing a Gly linker, which aims to avoid the effect of fatty acids on the conformation of peptide. The synthesized peptides and their sequences and biochemical parameters are listed in Table 1, and the peptides timeline and molecular structure are shown in Figure 1. HPLC and MS results are shown in Figure 2. MS indicated that the molecular weights of PMAP-36 (4157.16), PMAP-36PW (4335.45), and Myr-36PW (4603.77) were nearly consistent with their theoretical molecular weights, indicating the successfully synthesis of the peptides. The overall hydrophobicity of the peptides was analyzed by HPLC and represented by their retention time: 13.080 min for PMAP-36, 14.628 min for PMAP-36PW, and that of Myr-36PW was prolonged. Therefore, Myr-36PW gained a fatty acid, and its hydrophobicity was enhanced.
Table 1
| Peptide | Sequence | Theoretical MW | Measured MW | Net charge | TR(min) | Theoretical pI |
|---|---|---|---|---|---|---|
| PMAP-36 | GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG | 4157.22 | 4157.16 | +13 | 13.080 | 12.31 |
| PMAP-36PW | GRFRRLRKKTRKRLKKIGKVLKWIWWIVGSIPLGCG | 4335.41 | 4335.45 | +13 | 14.628 | 12.31 |
| Myr-36PW | Myr-G-GRFRRLRKKTRKRLKKIGKVLKWIWWIVGSIPLGCG | 4604.85 | 4603.77 | - | 16.458 | - |
Amino acid sequences and biochemical parameters of Myr-36PW and its analogs.
Molecular weight (MW) was measured by mass spectrometry.
Net charge was calculated by antimicrobial peptide database (http://aps.unmc.edu/AP/prediction/prediction_main.php).
TR: retention time measured by analytical HPLC.
Theoretical pI was determined with https://web.expasy.org/cgibin/protparam/protparam.
-, indicated without testing.
Figure 1
Figure 2
Antimicrobial Activity of Myr-36PW in vitro
Two Gram-positive and two Gram-negative strains were used as test strains for inhibition zone and MIC assays to investigate the antimicrobial activity of Myr-36PW in vitro. Myr-36PW generally exhibited antimicrobial activity against the four bacterial strains, and the inhibition zones are shown in Supplementary Figure 1. Compared with PMAP-36PW, Myr-36PW displayed higher antimicrobial activity, whereas ceftiofur sodium showed no significant difference (Supplementary Table 1). The MICs of Myr-36PW ranged from 0.0020 to 8 μg/mL, which were four times higher than those of PMAP-36PW against S. aureus ATCC 25923 and L. monocytogenes CICC 21634 and two times higher than those of PMAP-36PW against S. typhimurium SL 1344 and P. aeruginosa GIM 1.551 (Table 2). In summary, the antimicrobial activity of N-terminal myristoylated Myr-36PW was higher than that of PMAP-36PW in vitro.
Table 2
| Bacteria strain | MICs (μg/mL)& | ||
|---|---|---|---|
| PMAP-36 | PMAP-36PW | Myr-36PW | |
| S. aureus ATCC 25923 | 0.0156 | 0.0078 | 0.0020 |
| L. monocytogenes CICC 21634 | 4 | 2 | 0.5 |
| S. typhimurium SL 1344 | 32 | 16 | 8 |
| P. aeruginosa GIM 1.551 | 1 | 0.5 | 0.25 |
MICs of Myr-36PW against bacteria.
MICs (Minimum inhibitory concentrations) were determined as the lowest concentration of the peptides that inhibited bacteria growth.
Stability of Myr-36PW Exposed to Heat, pH, Salt, and Serum
Inhibition zone and MIC assays were performed to determine the effects of heat, pH, salt, and serum on Myr-36PW activity. The thermal stability results are shown in Figure 3. Boling reduced the antibacterial activity of Myr-36PW and its analogs against S. aureus ATCC 25923 and P. aeruginosa GIM 1.551. The activity of peptides continued to decrease with prolonged boiling. However, the antimicrobial activity of Myr-36PW was heat-stable, retaining high bacterial inhibition against S. aureus ATCC 25923 and P. aeruginosa GIM 1.551 even after boiling for 120 min. By contrast, PMAP-36 and PMAP-36PW showed low antimicrobial activity after boiling 120 min. In addition, Myr-36PW exhibited pH stability against S. aureus ATCC 25923 at pH 5–9 and P. aeruginosa GIM 1.551 at pH 5–11. Its antimicrobial activity was higher than that of PMAP-36PW at pH 2 and disappeared in pH 13. PMAP-36PW showed minimal or no antimicrobial activity at pH 12 (Figure 4). Supplementary Table 2 shows the effect of salt and serum on the antimicrobial activity of Myr-36PW. The MICs for all peptides were not changed compared with those in the absence of physiological NaCL, but those of Myr-36PW were changed in the presence of physiological CaCL2, about a half or a quarter of the MICs of the control group against S. aureus ATCC 25923 and twice that of the control group against P. aeruginosa GIM 1.551. PMAP-36PW displayed a quarter of control group against S. aureus ATCC 25923 and unchanged against P. aeruginosa GIM 1.551. After pre-incubation in 10% serum for 1 h, Myr-36PW showed a twice MIC of control group against two bacteria, the other peptides did not show any change in MIC. Although the MICs of Myr-36PW had changed, its antimicrobial activity still remained. These results revealed that Myr-36PW can resist physical and chemical challenges and maintain its good stability.
Figure 3
Figure 4
Hemolysis and Cytotoxicity of Myr-36PW
Myr-36PW concentrations from 2.5 to 640 μg/mL were used to further detect its hemolysis and cytotoxicity activity toward mouse erythrocytes and NIH 3T3 cells. As shown in Figure 5A, Myr-36PW displayed increased hemolytic activity, and its hemolysis rate was nearly 30% at a concentration of 640 μg/mL, which was slightly higher than that of PMAP-36PW. However, no significant difference was observed at all test concentrations. The cytotoxicity results in Figure 5B were similar to those for hemolytic activity. Compared with PMAP-36PW, Myr-36PW with an added fatty acid exhibited an increase in cytotoxicity against NIH 3T3 cells, but its cell viability was above 70% even at the concentration of 640 μg/mL. Therefore, Myr-36PW remains safe for mammalian cells.
Figure 5
Biofilm Inhibition and Eradication of Myr-36PW
The biofilm inhibition and eradication activities of Myr-36PW against S. aureus ATCC 25923, S. typhimurium SL 1344, and P. aeruginosa GIM 1.551 were determined via crystal violet staining to analyze its anti-biofilm activity. Myr-36PW, PMAP-36PW, and PMAP-36 generally showed biofilm inhibition against the tested bacteria in a concentration-dependent manner (Figures 6A–C). Compared with the control group, Myr-36PW (P < 0.01) and PMAP-36PW (P < 0.05) at low concentration showed significant difference in their effects against bacteria. However, Myr-36PW, PMAP-36PW, and PMAP-36 only eradicated the preformed biofilm in Gram-negative bacteria, and no significant difference was observed among the three peptides (Figure 6D). As shown in Figure 6E. Myr-36PW, PMAP-36PW, and PMAP-36 also exhibited bacterial killing effect except against S. aureus ATCC 25923, and this finding was consistent with the biofilm eradication results. These results showed that Myr-36PW has a selective anti-biofilm effect.
Figure 6
Membrane Permeability of Myr-36PW
Membrane permeability test was performed to analyze the killing mechanism of Myr-36PW against S. aureus ATCC 25923, L. monocytogenes CICC 21634, P. aeruginosa GIM 1.551, and S. typhimurium SL 1344. Figure 7 shows that under an inverted fluorescence microscope, all PBS groups did not exhibit any red fluorescence, indicating no bacterial death. However, Myr-36PW, PMAP-36PW, and PMAP-36 groups exhibited red fluorescence against the four bacteria. However, the largest number of dead bacteria was found in the Myr-36PW groups, and the red fluorescence was distributed to almost the whole field of view. These results showed that the three peptides may kill bacteria by permeabilizing the bacterial membrane, and Myr-36PW could improve the membrane permeability of bacterial cells.
Figure 7
Myr-36PW Protects Mice Against Lung Infection
The mice were intranasal inoculated with S. aureus ATCC 25923 and P. aeruginosa GIM 1.551 to induce lung disease and evaluate the therapeutic effect of Myr-36PW in vivo. After 3 days of treatment, anatomy results indicated no damage on the lung tissues in S. aureus ATCC 25923 model or local lung necrosis in P. aeruginosa GIM 1.551 model (Figure 8A). The lung tissues were stained with H&E to further clarify the therapeutic effect (Figure 8B). The lung tissues of PBS groups were seriously damaged with congested or thickened alveolar wall and a large number of infiltrating inflammatory cells but no normal alveolar structure. Meanwhile, Myr-36PW, benzylpenicillin potassium in S. aureus ATCC 25923 model, and Myr-36PW, ampicillin sodium in P. aeruginosa GIM 1.551 model showed a complete alveolar structure, reduced blood stasis, and large reduction in inflammatory cells. The pathology scores were recorded to reflect the differences in treatment effects. As shown in Figures 8C,D, Myr-36PW, benzylpenicillin potassium in S. aureus ATCC 25923 model and Myr-36PW, ampicillin sodium in P. aeruginosa GIM 1.551 model showed lower scores than PMAP-36PW group (P < 0.05). The bacterial CFU results were shown in Figures 8E,F, were similar to the pathology score results. The CFU level for S. aureus ATCC 25923 was reduced for PMAP-36PW, Myr-36PW and benzylpenicillin potassium group compared with that for the PBS group (P < 0.01), but the level of Myr-36PW and benzylpenicillin potassium group was lower than that for PMAP-36PW group (P < 0.05). Myr-36PW and ampicillin sodium group also showed decreased the P. aeruginosa GIM 1.551 CFU level compared with the PMAP-36PW group (P < 0.05). These results indicated that Myr-36PW is highly effective at removing bacteria and reducing pathological damage in lung tissues, with no significant difference from antibiotics.
Figure 8
Therapeutic Value of Peritonitis by Myr-36PW
The mice were intraperitoneally injected with S. aureus ATCC 25923 to further analyze the therapeutic values of Myr-36PW in peritonitis model. Figure 9A shows no damage on the liver and spleen tissues of mice, which were subsequently stained with H&E as displayed in Figure 9B. The tissues in PBS group were seriously damaged with central vein bleeding, the liver cells were arranged irregularly, the cells fused into a slice, nucleus lysis and disappearance occurred, and cytoplasmic vacuole and lymphocytes decreased in the spleen. In Myr-36PW and benzylpenicillin potassium group, the liver cells of mice were neatly arranged with clear cell boundaries and no pathological changes in spleen tissues. Statistical difference was found in pathology scores in Figures 9C,D. Compared with those for the PBS group, the liver pathogenic scores were significantly lower for PMAP-36PW (P < 0.05) and Myr-36PW and benzylpenicillin potassium group were significantly lower than PBS group (P < 0.01). Compared with those for the PBS group, the spleen pathogenic scores for PMAP-36PW, Myr-36PW and benzylpenicillin potassium groups displayed significant difference (P < 0.01), and those for Myr-36PW and benzylpenicillin potassium groups were lower than those for PMAP-36PW group (P < 0.05). The CFU number of bacterial in liver and spleen tissues was further determined for each group, and the results are shown in Figures 9E,F. The CFU levels of Myr-36PW and benzylpenicillin potassium groups in the liver and spleen were significantly decreased compared with that of PMAP-36PW group (P < 0.05), which was similar to the pathology scores. These results indicated that Myr-36PW could effectively inhibit bacterial growth and reduce pathological damage in liver and spleen tissues with no significant difference from antibiotics.
Figure 9
Myr-36PW Promotes Mice Abscess Reduction
The abscess model was also used to evaluate the therapeutic performance of Myr-36PW in vivo. Abscesses were formed by injecting S. aureus ATCC 25923 or P. aeruginosa GIM 1.551, and the changes were recorded and are shown in Figure 10A. A large area of abscess appeared in PBS groups, the thick juice was reduced in S. aureus ATCC 25923 model, and the pus volume decreased in P. aeruginosa GIM 1.551 model after 3 days treatment with peptides or antibiotics. In particular, the Myr-36PW, benzylpenicillin potassium in S. aureus ATCC 25923 model and Myr-36PW, ampicillin sodium group in P. aeruginosa GIM 1.551 model significantly reduced the abscess area and effectively suppressed its growth. The bacteria CFU in abscess area was further measured after the 3 day treatment, and the results are shown in Figures 10B,C. The S. aureus ATCC 25923 CFU level in Myr-36PW and benzylpenicillin potassium group was lower than that in PBS group (P < 0.01), and PMAP-36PW group showed significant difference compared with the PBS group (P < 0.05). The P. aeruginosa GIM 1.551 CFU levels of PMAP-36PW, Myr-36PW, and ampicillin sodium groups exhibited significant difference compared with that of PBS group (P < 0.01), but those of Myr-36PW (P < 0.05) and ampicillin sodium groups (P < 0.01) were lower than that of PMAP-36PW group. These results revealed that Myr-36PW could effectively suppress abscesses and eliminate the majority of bacteria.
Figure 10
Myr-36PW Accelerates Wound Healing
Mouse wound models were built to analyze the healing effect of Myr-36PW. P. aeruginosa GIM 1.551 was inoculated directly at the wound site, and the wound changes were recorded after 7 days of treatment (Figure 11A). The wound of blank group healed into small holes, and the mice in PBS group had wide wounds. After treatment, the width and length of the wounds in treatment groups gradually decreased. By comparison, the wounds in Myr-36PW and ampicillin sodium groups were significantly reduced. The bacterial count results were consistent with the wound changes. As Figure 11B shows that compared with that of the PBS group, the bacterial CFU was significantly reduced in the PMAP-36PW (P < 0.05), Myr-36PW and ampicillin sodium groups (P < 0.01). No significant difference was found between Myr-36PW and ampicillin sodium groups. These findings indicated that Myr-36PW can promote wound healing and reduce wound bacterial infection with comparable effects to antibiotics.
Figure 11
Discussion
Bacterial resistance and antibiotic residues have become increasingly prominent, and antimicrobial resistance has become a threat to global public health systems due to the emergence of drug-resistant strains (Li et al., ; Penesyan et al., ; Ferri et al., ). Approximately 7,000,000 people die each year from antibiotic resistance worldwide (Willyard, ). Hence, new antimicrobial agents must be urgently developed. Although AMPs are promising candidates, many problems still limit their clinical use.
Fatty acids are important components of biological membrane phospholipids and have high hydrophobicity. Coupling fatty acids with AMPs can promote the membrane interaction by increasing hydrophobicity and thus enhancing the antibacterial activity (Koh et al., ). Fatty acids modification on some cationic peptides has been studied. Cationic amphiphilic peptide CM4 increases hydrophobicity through N-terminal myristoylation and improves its anticancer activity (Li et al., ). However, a previous study showed that a length-dependent relationship between antimicrobial activity and fatty acid chain (Chu-Kung et al., ). Therefore, the appropriate length is crucial to the antibacterial activity of AMPs. In our previous study, we designed two new peptides PMAP-36PW and PMAP-36PK by amino acid substitution. PMAP-36PW showed better antimicrobial activity in vitro and therapeutic potential in vivo than PMAP-36PK (Zhou et al., ). However, PMAP-36PW still has some shortcomings: The antimicrobial activity of PMAP-36PW on Gram-negative bacteria was worse than that on Gram-positive bacteria, and PMAP-36PW showed no antimicrobial activity against Enterococcus faecium B21. Besides, there is still a difference between the in vivo therapeutic efficacy of PMAP-36PW and that of antibiotics. Studies have shown that modifying the N-teriminus can enhance the antibacterial activity of peptides, and the length of the fatty acid chain can influence the antibacterial activity and cytotoxicity of the peptides (Zhong et al., , ). Moreover, lipopeptides have the advantages of broad-spectrum antibacterial activity, rapid bactericidal activity, and slow drug resistance tendency. Synthetic lipopeptides can effectively improve the therapeutic potential of peptides (Koh et al., ). Especially, cationic antimicrobial peptide HD5 modified by myristic acid can promote self-assembly of peptide to form nano antimicrobial peptide, and exhibited more efficient, rapid and broad-spectrum antibacterial activity, which is a simple and versatile strategy to generating AMP-derived nanobiotics with excellent in vivo tolerability (Lei et al., ). Thus, in the present study, we designed a new peptide Myr-36PW by coupling the myristic acid to the N-terminal of PMAP-36PW to increase its hydrophobicity. Our data also indicated that N-terminal fatty acid modification may be an effective way to develop new AMPs.
The antimicrobial activity of Myr-36PW was detected against four bacterial strains. Inconsistent with previous studies, L. monocytogenes CICC 21533 was replaced by L. monocytogenes CICC 21634 in the present work, because the MIC values of former were higher than those of other bacterial strains, and thus are not valuable for evaluating the antibacterial activity of the peptides. The four strains are two Gram-positive (S. aureus ATCC 25923 and L. monocytogenes CICC 21634) and two Gram-negative strains (S. typhimurium SL 1344 and P. aeruginosa GIM 1.551). Meanwhile, they are all zoonotic pathogens, and cause serious harm to animal and human health. In addition, the MICs of bacteria to different classes of antibiotics were analyzed according to the CLSI criteria, and the results showed that four strains exhibited different degrees of resistance (Supplementary Table 3). Two of them are drug-resistant strains (S. aureus ATCC 25923 and S. typhimurium SL 1344), and the other two are multi drug-resistant strains (L. monocytogenes CICC 21634 and P. aeruginosa GIM 1.551). The antimicrobial activity results showed that Myr-36PW exhibited excellent antimicrobial activity higher than PMAP-36PW, suggesting that hydrophobic fatty acids play an important role in the antimicrobial activity. In addition, the MIC values of Myr-36PW against Gram-positive and Gram-negative bacteria were decreased compared with those of PMAP-36PW. PMAP-36PW itself effectively killed both types of bacteria in vitro, but Myr-36PW exhibited potential bactericidal activity compared with PMAP-36PW. The current modification strategy did not change the arrangement of the hydrophilic and hydrophobic amino acids of the parent peptide PMAP-36PW. The new peptide Myr-36PW maintained the original positive charge, and the combination of fatty acids increased its hydrophobicity and enhanced its antibacterial activity, which is consistent with previous studies (Malina and Shai, ; Krishnakumari et al., ; Zhong et al., ). In addition, fatty acid addition can improve the hydrophobicity and promote the folding or aggregation of AMPs in the solution (Avrahami and Shai, ; Chu-Kung et al., ). As a cationic antimicrobial peptide, Myr-36PW with N-terminal myristoylation exhibited increased hydrophobicity but not self-assembly, possibly due to the high cationic peptide segment found at the N-terminal of PMAP-36PW, that is disadvantageous to self-assembling micelles based on intermolecular interactions.
AMPs are susceptible to proteolytic degradation in vivo because their bactericidal activity in body fluids can be negated by pH, salts, or serum that can interfere through non-specific electrostatic interactions (Svenson et al., ). Thus, the stability of Myr-36PW exposed to heat, pH, salts, and serum was researched. Thermal and pH stability tests indicated that Myr-36PW was more stable than PMAP-36PW. The antimicrobial activity of Myr-36PW against P. aeruginosa GIM 1.551 and S. aureus ATCC 25923 remained more stable than that of PMAP-36PW after boiling for 120 min and within a wide pH range. Salt ions and serum reduce the antibacterial activity of antibacterial peptides (Walkenhorst, ; Zhong et al., ). In this study, physiological activity salts or serum environment also changed the MICs values of Myr-36PW, but no loss of antimicrobial activity was observed. In addition, NaCL and CaCL2 have different effects on the antimicrobial activity of Myr-36PW, the physiological concentration of divalent-cation leads to the high affinity of Myr-36PW to bacterial cell wall and consequent great antimicrobial activities (Hong et al., ). Thus, these findings indicated the antimicrobial peptide Myr-36PW with N-terminal myristolyation exhibited thermal and pH stabilities and salt or serum resistance.
An excellent antimicrobial peptide for clinical application must show efficient, rapid, and stable antibacterial activity and low toxicity to mammalian cells. In general, hemolysis and cytotoxicity are positively correlated with the hydrophobicity of peptides; the increase in the hydrophobicity of peptides could enhance the selectivity, but a further increase could produce negative influence (Dong et al., ; Schmidtchen et al., ; Zhong et al., ). The toxicity of Myr-36PW to erythrocytes and NIH 3T3 cell increased after N-terminal myristolyation. At the concentration of 640 μg/mL, Myr-36PW displayed ~30% hemolytic activity and 70% cell survival, which were slightly higher than those of PMAP-36 and PMAP-36PW. After fatty acid modification, Myr-36PW exhibits increased hydrophobicity and enhanced cytotoxicity to normal mammalian cells but still showed considerable biosecurity.
Antibiotics and other antimicrobial products cannot eliminate bacterial biofilm because only 0.1% of the microbial population actually grow in planktonic mode, resulting in the development of bacterial resistance (Bjarnsholt et al., ; de Breij et al., ). Prevent biofilm formation or treating established biofilms by using AMPs has become a research focus (Dosler and Karaaslan, ; Chen et al., ; Mwangi et al., ). In our study, we further analyzed the anti-biofilm effect of peptides by using two bacteria with strong biofilm (S. aureus ATCC 25923 and P. aeruginosa GIM 1.551) and one bacterial strain with weak biofilm (S. typhimurium SL 1344). Compared with PMAP-36, Myr-36PW could significantly inhibit the biofilm formation of three bacteria. Myr-36PW also showed biofilm eradication but only for Gram-negative bacteria without any effect on S. aureus ATCC 25923. No significant difference was observed among the three peptides possibly because lipopolysaccharide (LPS) is the major molecular component of the outer membrane of Gram-negative bacteria, and AMPs have a high affinity to LPS (Rosenfeld and Shai, ). In this study, the bacteria killing mechanism was also investigated via membrane permeability assay. AMPs first interact with anionic bacterial membranes through electrostatic interactions, and hydrophobic parts are inserted into the phospholipid layer to destroy the membrane structure (Edwards et al., ). The hydrophobicity of Myr-36PW increased significantly after binding with myristic acid and showed strong membrane permeability, thus increasing bacterial killing. Modification with fatty acids such as myristic acid can promote peptide membrane interactions, provide an anchor for fatty acyl chains that are inserted into the bacterial membrane, and result in enhanced membrane permeability and eventually bacterial killing (Lockwood et al., ; Krishnakumari et al., ).
Myr-36PW antibacterial activity in vivo was further investigated due to its excellent antibacterial activity and good stability in vitro. Pneumonia, peritonitis, subcutaneous abscesses and wound infection models were built to evaluate the therapeutic efficacy of this peptide in vivo. As the most common clinical drug-resistant bacteria to cause localized and systemic infection, P. aeruginosa GIM 1.551 and S. aureus ATCC 25923 strains were used to infect mice (van Delden, ; Deleon et al., ; Santajit and Indrawattana, ). In the pneumonia and peritonitis models, PMAP-36 and PMAP-36PW had poor therapeutic effect in vivo, but Myr-36PW significantly decreased the following: bacterial CFU to target organs, including lung, liver, and spleen; tissue damages and inflammatory cell infiltration; and pathological scores. These results indicated the antimicrobial and anti-inflammatory of Myr-36PW in vivo. The therapeutic efficacy of Myr-36PW was also highlighted in subcutaneous abscesses and wound infection models. Myr-36PW could better suppress bacterial growth at the target site and promote abscess reduction and wound healing compared with the same dose of PMAP-36 and PMAP-36PW. It has been reported that antimicrobial peptides can mediate inflammation and improve wound healing (Koczulla and Bals, ; Sebe et al., ). Moreover, the antimicrobial peptide Nano-BA5k promotes wound healing by decreasing bacterial counts of wound, which was consistent with our results that antimicrobial peptides can improve wound healing by reducing the number of bacteria in infected wounds (Hong et al., ). Certainly, wound healing also involves inflammation, re-epithelialization, angiogenesis, granulation tissue formation and other physiological events. And granulation tissue formation plays a key role in wound healing (Murthy et al., ). Whether Myr-36PW improves wound healing in other ways requires further study. This finding further revealed that N-terminal myristoylation is an effective modification strategy, and Myr-36PW is a promising anti-infective agent for the treatment of bacterial infections.
In conclusion, our results revealed the potentials of Myr-36PW, an N-terminal fatty acid modification peptide, and a promising drug candidate with good stability and considerable toxicity and can enhance antimicrobial activity, exhibit anti-biofilm activity, and kill bacteria by permeabilizing the bacterial membrane. Myr-36PW also showed an impressive therapeutic effect in S. aureus ATCC 25923 and P. aeruginosa GIM 1.551 induced infection in vivo. This study can serve as a reference for developing promising drug candidates against antibiotic resistance.
Statements
Data availability statement
All datasets generated for this study are included in the article/Supplementary Material.
Ethics statement
The animal study was reviewed and approved by Animal Experiment Committee of Henan University of Science and Technology.
Author contributions
CW and CL designed the study. TS and SS performed experiments. LC and JZ performed data analysis. YW and ZZ provided materials or resources. YL and SL wrote the draft. YL, CW, and CL revised the manuscript. All authors read and approved the final manuscript.
Funding
This work was supported by the National Natural Science Foundation of China (grant number 31101792), the Natural Science Foundation of Henan Province (grant number 182300410030), and the Programs for Science and Technology Development of Henan Province (grant number 182102110208).
Acknowledgments
We thank Shinewrite Ltd. for editing the manuscript.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest. The reviewer FS declared a shared affiliation with one of the authors, SL to the handling editor at time of review.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcimb.2020.00450/full#supplementary-material
References
1
AgarwalS.SharmaG.DangS.GuptaS.GabraniR. (2016). Antimicrobial peptides as anti-infectives against Staphylococcus epidermidis. Med. Princ. Pract.25, 301–308. 10.1159/000443479
2
AokiN.TatedaK.KikuchiY.KimuraS.MiyazakiC.IshiiY.et al. (2009). Efficacy of colistin combination therapy in a mouse model of pneumonia caused by multidrug-resistant Pseudomonas aeruginosa. J. Antimicrob. Chemother.63, 534–542. 10.1093/jac/dkn530
3
AvrahamiD.ShaiY. (2002). Conjugation of a magainin analogue with lipophilic acids controls hydrophobicity, solution assembly, and cell selectivity. Biochemistry41, 2254–2263. 10.1021/bi011549t
4
BjarnsholtT.CiofuO.MolinS.GivskovM.HøibyN. (2013). Applying insights from biofilm biology to drug development-can a new approach be developed?Nat. Rev. Drug. Discov.12, 791–808. 10.1038/nrd4000
5
BorroB. C.NordströmR.MalmstenM. (2020). Microgels and hydrogels as delivery systems for antimicrobial peptides. Colloids Surf. B. Biointerfaces187:110835. 10.1016/j.colsurfb.2020.110835
6
ChenH.WubboltsR. W.HaagsmanH. P.VeldhuizenE. J. A. (2018). Inhibition and eradication of Pseudomonas aeruginosa biofilms by host defence peptides. Sci. Rep.8:10446. 10.1038/s41598-018-28842-8
7
Chu-KungA. F.BozzelliK. N.LockwoodN. A.HasemanJ. R.MayoK. H.TirrellM. V. (2004). Promotion of peptide antimicrobial activity by fatty acid conjugation. Bioconjug. Chem.15, 530–535. 10.1021/bc0341573
8
Chu-KungA. F.NguyenR.BozzelliK. N.TirrellM. (2010). Chain length dependence of antimicrobial peptide-fatty acid conjugate activity. J. Colloid Interface Sci.345, 160–167. 10.1016/j.jcis.2009.11.057
9
CiŽmanM.Plankar SrovinT. (2018). Antibiotic consumption and resistance of gram-negative pathogens (collateral damage). GMS Infect. Dis.6:Doc05. 10.3205/id000040.eCollection 2018
10
CLSI (2020). Performance Standards for Antimicrobial Susceptibility Testing. Wayne, PA: Clinical and Laboratory Standards Institute.
11
CortésG.AlvarezD.SausC.AlbertíS. (2002). Role of lung epithelial cells in defense against Klebsiella pneumoniae pneumonia. Infect. Immun.70, 1075–1080. 10.1128/IAI.70.3.1075-1080.2002
12
de BreijA.RioolM.CordfunkeR. A.MalanovicN.de BoerL.KoningR. I.et al. (2018). The antimicrobial peptide SAAP-148 combats drug-resistant bacteria and biofilms. Sci. Transl. Med.10:eaan4044. 10.1126/scitranslmed.aan4044
13
DeleonS.ClintonA.FowlerH.EverettJ.HorswillA. R.RumbaughK. P. (2014). Synergistic interactions of Pseudomonas aeruginosa and Staphylococcus aureus in an in vitro wound model. Infect. Immun.82, 4718–4728. 10.1128/IAI.02198-14
14
DeslouchesB.DiY. P. (2017). Antimicrobial peptides: a potential therapeutic option for surgical site infections. Clin. Surg.2:1740.
15
DongN.ZhuX.ChouS.ShanA.LiW.JiangJ. (2014). Antimicrobial potency and selectivity of simplified symmetric-end peptides. Biomaterials35, 8028–8039. 10.1016/j.biomaterials.2014.06.005
16
DoslerS.KaraaslanE. (2014). Inhibition and destruction of Pseudomonas aeruginosa biofilms by antibiotics and antimicrobial peptides. Peptides62, 32–37. 10.1016/j.peptides.2014.09.021
17
DunneW. M.JrJaillardM.RochasO.van BelkumA. (2017). Microbial genomics and antimicrobial susceptibility testing. Expert. Rev. Mol. Diagn.17, 257–269. 10.1080/14737159.2017.1283220
18
EbbensgaardA.MordhorstH.OvergaardM. T.NielsenC. G.AarestrupF. M.HansenE. B. (2015). Comparative evaluation of the antimicrobial activity of different antimicrobial peptides against a range of pathogenic bacteria. PLoS ONE10:e0144611. 10.1371/journal.pone.0144611
19
EdwardsI. A.ElliottA. G.KavanaghA. M.ZueggJ.BlaskovichM. A.CooperM. A. (2016). Contribution of amphipathicity and hydrophobicity to the antimicrobial activity and cytotoxicity of β-Hairpin peptides. ACS Infect. Dis.2, 442–450. 10.1021/acsinfecdis.6b00045
20
FerriM.RanucciE.RomagnoliP.GiacconeV. (2017). Antimicrobial resistance: a global emerging threat to public health systems. Crit. Rev. Food Sci. Nutr.57, 2857–2876. 10.1080/10408398.2015.1077192
21
GreberK. E.DawgulM. (2016). Antimicrobial peptides under clinical trials. Curr. Top. Med. Chem.17, 620–628. 10.2174/1568026616666160713143331
22
HongW.GaoX.QiuP.YangJ.QiaoM.ShiH.et al. (2017). Synthesis, construction, and evaluation of self-assembled nano-bacitracin A as an efficient antibacterial agent in vitro and in vivo. Int. J. Nanomed.12, 4691–4708. 10.2147/IJN.S136998
23
JacobB.RajasekaranG.KimE. Y.ParkI. S.BangJ. K.ShinS. Y. (2016). The stereochemical effect of SMAP-29 and SMAP-18 on bacterial selectivity, membrane interaction and anti-inflammatory activity. Amino Acids48, 1241–1251. 10.1007/s00726-016-2170-y
24
JiaF.ZhangY.WangJ.PengJ.ZhaoP.ZhangL.et al. (2019). The effect of halogenation on the antimicrobial activity, antibiofilm activity, cytotoxicity and proteolytic stability of the antimicrobial peptide jelleine-I. Peptides112, 56–66. 10.1016/j.peptides.2018.11.006
25
KoczullaA. R.BalsR. (2003). Antimicrobial peptides-current status and therapeutic potential. Drugs63, 389–406. 10.2165/00003495-200363040-00005
26
KohJ. J.LinH.CarolineV.ChewY. S.PangL. M.AungT. T.et al. (2015). N-lipidated peptide dimers: effective antibacterial agents against gram-negative pathogens through lipopolysaccharide permeabilization. J. Med. Chem.58, 6533–6548. 10.1021/acs.jmedchem.5b00628
27
KohJ. J.LinS.BeuermanR. W.LiuS. (2017). Recent advances in synthetic lipopeptides as anti-microbial agents: designs and synthetic approaches. Amino Acids49, 1653–1677. 10.1007/s00726-017-2476-4
28
KrishnakumariV.GuruA.AdicherlaH.NagarajR. (2018). Effects of increasing hydrophobicity by N-terminal myristoylation on the antibacterial and hemolytic activities of the C-terminal cationic segments of human-β-defensins 1-3. Chem. Biol. Drug. Des.92, 1504–1513. 10.1111/cbdd.13317
29
LeiR.HouJ.ChenQ.YuanW.ChengB.SunY.et al. (2018). Self-assembling myristoylated human α-defensin 5 as a next-generation nanobiotics potentiates therapeutic efficacy in bacterial infection. ACS Nano12, 5284–5296. 10.1021/acsnano.7b09109
30
LiC.LiuH.YangY.XuX.LvT.ZhangH.et al. (2018). N-myristoylation of antimicrobial peptide CM4 enhances its anticancer activity by interacting with cell membrane and targeting mitochondria in breast cancer cells. Front. Pharmacol.9:1297. 10.3389/fphar.2018.01297
31
LiL.ShiY.CheserekM. J.SuG.LeG. (2013). Antibacterial activity and dual mechanisms of peptide analog derived from cell-penetrating peptide against Salmonella typhimurium and Streptococcus pyogenes. Appl. Microbiol. Biotechnol.97, 1711–1723. 10.1007/s00253-012-4352-1
32
LockwoodN. A.HasemanJ. R.TirrellM. V.MayoK. H. (2004). Acylation of SC4 dodecapeptide increases bactericidal potency against gram-positive bacteria, including drug-resistant strains. Biochem. J.378, 93–103. 10.1042/bj20031393
33
LvY.WangJ.GaoH.WangZ.DongN.MaQ.et al. (2014). Antimicrobial properties and membrane-active mechanism of a potential α-helical antimicrobial derived from cathelicidin PMAP-36. PLoS ONE9:e86364. 10.1371/journal.pone.0086364
34
MalinaA.ShaiY. (2005). Conjugation of fatty acids with different lengths modulates the antibacterial and antifungal activity of a cationic biologically inactive peptide. Biochem. J.390, 695–702. 10.1042/BJ20050520
35
MartinD. D.BeauchampE.BerthiaumeL. G. (2010). Post-translational myristoylation: fat matters in cellular life and death. Biochimie93, 18–31. 10.1016/j.biochi.2010.10.018
36
MiaoX.ZhouT.ZhangJ.XuJ.GuoX.HuH.et al. (2020). Enhanced cell selectivity of hybrid peptides with potential antimicrobial activity and immunomodulatory effect. Biochim. Biophys. Acta Gen. Subj.1864:129532. 10.1016/j.bbagen.2020.129532
37
MurthyS.GautamM. K.GoelS.PurohitV.SharmaH.GoelR. K. (2013). Evaluation of in vivo wound healing activity of bacopa monniera on different wound model in rats. Biomed. Res. Int.2013:972028. 10.1155/2013/972028
38
MwangiJ.HaoX.LaiR.ZhangZ. Y. (2019a). Antimicrobial peptides: new hope in the war against multidrug resistance. Zool. Res.40, 488–505. 10.24272/j.issn.2095-8137.2019.062
39
MwangiJ.YinY.WangG.YangM.LiY.ZhangZ.et al. (2019b). The antimicrobial peptide ZY4 combats multidrug-resistant Pseudomonas aeruginosa and Acinetobacter baumannii infection. Proc. Natl. Acad. Sci. U.S.A. 116, 26516–26522. 10.1073/pnas.1909585117
40
PenesyanA.GillingsM.PaulsenI. (2015). Antibiotic discovery: combatting bacterial resistance in cells and in biofilm communities. Molecules20, 5286–5298. 10.3390/molecules20045286
41
RosenfeldY.ShaiY. (2006). Lipopolysaccharide (endotoxin)-host defense antibacterial peptides interactions: role in bacterial resistance and prevention of sepsis. Biochim. Biophys. Acta1758, 1513–1522. 10.1016/j.bbamem.2006.05.017
42
SantajitS.IndrawattanaN. (2016). Mechanisms of antimicrobial resistance in ESKAPE pathogens. Biomed. Res. Int.2016:2475067. 10.1155/2016/2475067
43
SchmidtchenA.PasupuletiM.MalmstenM. (2014). Effect of hydrophobic modifications in antimicrobial peptides. Adv. Colloid Interface Sci.205, 265–274. 10.1016/j.cis.2013.06.009
44
SebeI.OstorhaziE.FeketeA.KovacsK. N.ZelkoR.KovalszkyI.et al. (2016). Polyvinyl alcohol nanofiber formulation of the designer antimicrobial peptide APO sterilizes Acinetobacter baumannii-infected skin wounds in mice. Amino Acids48, 203–211. 10.1007/s00726-015-2080-4
45
ShiL. M.LiG. X.ShiW. X.TianG. R. (2018). HMGB1 signaling blocking protects against carbapenem-resistant klebsiella pneumoniae in a murine model of infection. Exp. Lung Res.44, 263–271. 10.1080/01902148.2018.1505976
46
SinghJ.JoshiS.MumtazS.MauryaN.GhoshI.KhannaS.et al. (2016). Enhanced cationic charge is a key factor in promoting staphylocidal activity of α-melanocyte stimulating hormone via selective lipid affinity. Sci. Rep.6:31492. 10.1038/srep31492
47
SongY.WangX.ZhangH.TangX.LiM.YaoJ.et al. (2015). Repeated low-dose influenza virus infection causes severe disease in mice: a model for vaccine evaluation. J. Virol. 89, 7841–7851. 10.1128/JVI.00976-15
48
SvensonJ.BrandsdalB. O.StensenW.SvendsenJ. S. (2007). Albumin binding of short cationic antimicrobial micropeptides and its influence on the in vitro bactericidal effect. J. Med. Chem.50, 3334–3339. 10.1021/jm0703542
49
van DeldenC. (2007). Pseudomonas aeruginosa bloodstream infections: how should we treat them?Int. J. Antimicrob. Agents30, 71–75. 10.1016/j.ijantimicag.2007.06.015
50
WalkenhorstW. F. (2016). Using adjuvants and environmental factors to modulate the activity of antimicrobial peptides. Biochim. Biophys. Acta1858, 926–935. 10.1016/j.bbamem.2015.12.034
51
WangM.LinJ.SunQ.ZhengK.MaY.WangJ. (2019). Design, expression, and characterization of a novel cecropin A-derived peptide with high antibacterial activity. Appl. Microbiol. Biotechnol.103, 1765–1775. 10.1007/s00253-018-09592-z
52
WillyardC. (2017). The drug-resistant bacteria that pose the greatest health threats. Nature543:15. 10.1038/nature.2017.21550
53
WoolhouseM.WaughC.PerryM. R.NairH. (2016). Global disease burden due to antibiotic resistance-state of the evidence. J. Glob. Health6:010306. 10.7189/jogh.06.010306
54
XiD.TengD.WangX.MaoR.YangY.XiangW.et al. (2013). Design, expression and characterization of the hybrid antimicrobial peptide LHP7, connected by a flexible linker, against Staphylococcus and Streptococcus. Process. Biochem.48, 453–461. 10.1016/j.procbio.2013.01.008
55
ZhaoY.GuoQ.DaiX.WeiX.YuY.ChenX.et al. (2019). A biomimetic non-antibiotic approach to eradicate drug-resistant infections. Adv. Mater.31:e1806024. 10.1002/adma.201806024
56
ZhenX.LundborgC. S.SunX.HuX.DongH. (2019). Economic burden of antibiotic resistance in ESKAPE organisms: a systematic review. Antimicrob. Resist. Infect. Control8:137. 10.1186/s13756-019-0590-7
57
ZhongC.LiuT.GouS.HeY.ZhuN.ZhuY.et al. (2019). Design and synthesis of new N-terminal fatty acid modified-antimicrobial peptide analogues with potent in vitro biological activity. Eur. J. Med. Chem.182:111636. 10.1016/j.ejmech.2019.111636
58
ZhongC.ZhuN.ZhuY.LiuT.GouS.XieJ.et al. (2020). Antimicrobial peptides conjugated with fatty acids on the side chain of D-amino acid promises antimicrobial potency against multidrug-resistant bacteria. Eur. J. Pharm. Sci.141:105123. 10.1016/j.ejps.2019.105123
59
ZhouJ.LiuY.ShenT.ChenL.ZhangC.CaiK.et al. (2019a). Enhancing the antibacterial activity of PMAP-37 by increasing its hydrophobicity. Chem. Biol. Drug. Des.94, 1986–1999. 10.1111/cbdd.13601
60
ZhouJ.LiuY.ShenT.ChenL.ZhangC.CaiK.et al. (2019b). Antimicrobial activity of the antibacterial peptide PMAP-36 and its analogues. Microb. Pathog.136:103712. 10.1016/j.micpath.2019.103712
Summary
Keywords
myristoylation, antibacterial peptide PMAP-36PW, antibacterial peptide Myr-36PW, antibacterial activity, stability, anti-biofilm, mechanism, therapeutic efficacy
Citation
Liu Y, Li S, Shen T, Chen L, Zhou J, Shi S, Wang Y, Zhao Z, Liao C and Wang C (2020) N-terminal Myristoylation Enhanced the Antimicrobial Activity of Antimicrobial Peptide PMAP-36PW. Front. Cell. Infect. Microbiol. 10:450. doi: 10.3389/fcimb.2020.00450
Received
30 May 2020
Accepted
23 July 2020
Published
27 August 2020
Volume
10 - 2020
Edited by
Xavier Vila Farres, Aelin Therapeutics, Belgium
Reviewed by
Frank Schweizer, University of Manitoba, Canada; John Chu, National Taiwan University, Taiwan
Updates
Copyright
© 2020 Liu, Li, Shen, Chen, Zhou, Shi, Wang, Zhao, Liao and Wang.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Chen Wang wangchen2001@126.comChengshui Liao liaochengshui33@163.com
This article was submitted to Clinical Microbiology, a section of the journal Frontiers in Cellular and Infection Microbiology
†These authors have contributed equally to this work
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.