Abstract
Background:
Methicillin-resistant Staphylococcus aureus (MRSA) poses a significant challenge in clinical environments due to its resistance to standard antibiotics. Staphylococcal Protein A (SpA), a crucial virulence factor of MRSA, undermines host immune responses, making it an attractive target for vaccine development. This study aimed to identify potential epitopes within SpA that could elicit robust immune responses, ultimately contributing to the combat against multidrug-resistant (MDR) MRSA.
Methods:
The SpA protein sequence was retrieved from the UniProt database, with various bioinformatics tools employed for epitope prediction. T-cell epitopes were identified using the Tepitool server, focusing on high-affinity interactions with prevalent human leukocyte antigens (HLAs). B-cell epitopes were predicted using the BepiPred tool. Predicted epitopes underwent docking studies with HLA molecules to evaluate binding properties. In-silico analyses confirmed the antigenicity, promiscuity, and non-glycosylated nature of the selected epitopes.
Results:
Several T and B cell epitopes within SpA were identified, showcasing high binding affinities and extensive population coverage. A multi-epitope vaccine construct, linked by synthetic linkers and an adjuvant, was modelled, refined, and validated through various bioinformatics assessments. The vaccine candidate was subsequently docked with Toll-like receptor 4 (TLR-4) to evaluate its potential for immunogenicity.
Conclusion:
This study lays the groundwork for developing epitope-based vaccines targeting SpA in MRSA, identifying promising candidates for experimental validation and contributing to innovative immunotherapeutic strategies against MRSA infections.
1 Introduction
Methicillin-resistant Staphylococcus aureus (MRSA) is a formidable pathogen that represents a significant public health challenge (). Its extensive resistance to conventional antibiotics, combined with its ability to cause a spectrum of severe infections—from localized skin infections to critical conditions such as pneumonia, endocarditis, and sepsis—positions MRSA as a top priority for healthcare systems worldwide (). Globally, MRSA contributes to a substantial burden of morbidity and mortality, ranking among the top six multidrug-resistant (MDR) bacteria responsible for an estimated 700,000 deaths annually due to antibiotic resistance (). The persistence and adaptability of MRSA necessitate the exploration of novel therapeutic strategies beyond traditional antibiotic treatment (). One promising avenue in the fight against MRSA is the development of epitope-based vaccines. Epitopes are specific regions of antigens recognized by the immune system, and their precise targeting is crucial for eliciting effective immune responses (). Such vaccines can specifically target key virulence factors of the bacterium, thereby neutralizing its pathogenic mechanisms. Recent studies have highlighted the importance of immunogenic epitope identification for developing vaccines against resistant pathogens like MRSA, emphasizing the need for innovative approaches to immunotherapy () Staphylococcal Protein A (SpA) emerges as a pivotal virulence factor, exerting profound influence over the host immune response, notably by functioning as a B cell superantigen (). SpA has also been implicated in MRSA’s ability to evade both innate and adaptive immune responses, which makes it an attractive target for vaccine development (). The identification of immunogenic epitopes within SpA is crucial for designing vaccines that can effectively target MRSA (). Superantigens constitute a diverse class of proteins with the remarkable ability to robustly engage and activate the immune system in a nonspecific manner (). Within the arsenal of Staphylococcus aureus (S. aureus), the production of superantigens serves as a formidable shield, hindering the accurate identification and neutralization of other S. aureus antigens by the human immune system. Recent advances in structural biology and immunology have provided new insights into how SpA modulates the immune response, suggesting potential sites for targeted vaccine intervention (). In light of its pivotal role in impeding the generation of effective antibodies and subverting the full functionality of B-cell responses against S. aureus, SpA has emerged as a focal point of considerable interest in deciphering the evolutionary dynamics of the human immune response to S. aureus (; ). Given its pivotal role in immune evasion, SpA stands as an enticing target for the development of vaccines (). The targeting of SpA epitopes represents a promising strategy to enhance immune recognition and clearance of MRSA, particularly in the context of multidrug resistance (). Identifying immunogenic epitopes within SpA can lead to the design of a vaccine that elicits robust and specific immune responses. T-cell epitopes can activate cellular immunity by presenting peptides to T cells through HLA molecules, while B cell epitopes can induce humoral immunity by stimulating antibody production (). This computational approach accelerates the vaccine development process by streamlining the identification of potential candidates for further experimental validation (). In this study, we aimed to employ an in-depth immuno-informatics approach to pinpoint potential T&B cell epitopes in SpA protein. By elucidating these epitopes, we aimed not only to contribute to the expanding repertoire of knowledge in the field of vaccine design but also to chart a novel trajectory in the combat against MRSA infections through the application of innovative immunological strategies. The hypothesis driving this work is that a computational identification of SpA-derived epitopes capable of generating both humoral and cellular immune responses can provide valuable candidates for future MRSA vaccine development. We specifically tried to answer the research question: Can potential epitopes in SpA protein capable of generating humoral and cellular immune response be accurately identified against MRSA? The identified epitopes present promising candidates for further experimental validation and eventual vaccine development, which could provide a powerful tool in the ongoing battle against antibiotic-resistant pathogens.
2 Methodology
2.1 Staphylococcal Protein A assessment
The protein sequence of SpA was obtained from the NCBI database https://www.ncbi.nlm.nih.gov/ bearing ID: WP_033567379. To ensure comprehensive coverage and variability analysis, the BLASTP tool was used to extract approximately 250 homologous sequences. Multiple sequence alignment (MSA) was conducted utilizing the COBALT tool available at NCBI https://www.ncbi.nlm.nih.gov/tools/cobalt/re_cobalt.cgi () to identify conserved and variable regions within the protein, which is crucial for epitope prediction. The ProtParam tool https://web.expasy.org/protparam/ was utilized to examine the physicochemical properties of SpA (). The physicochemical properties help in understanding the stability and solubility of the protein, which are important for vaccine design.
2.2 Epitope screening
2.2.1 T&B cell epitope prediction
Epitopes specific to different Major Histocompatibility Complex (MHC) classes were forecasted using Tepitool http://tools.iedb.org/tepitool/ () [7]. The HLA Class I alleles (including A & B alleles) were screened using a panel of 27 most common alleles provided in the Tepitool server (Supplementary Figure 1A). Peptide lengths were selected as 9mers. To predict HTL epitopes, a panel of 26 most frequent alleles (Supplementary Figure 1B) were selected, and the length of peptides selected were 15mers. The peptides with percentile rank ≤ 1 were selected. For the prediction of B cell epitopes, the BepiPred 2.0 tool https://services.healthtech.dtu.dk/services/BepiPred-2.0/ was utilized (). All tools were run at default parameters without altering anything.
2.3 Epitope selection criteria
Epitopes were selected based on several criteria:
2.3.1 Binding affinity
Epitopes were identified for their robust projected binding affinity to widely occurring HLA alleles. Consequently, only epitopes with higher percentile scores were included for further analysis.
2.3.2 Population coverage
In order to ensure broad applicability across different populations, ensuring the epitopes applicability in diverse demographic groups. For this, we selected only those epitopes which were promiscuous.
2.3.3 Antigenicity
Evaluated using the VaxiJen tool https://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html to predict the potential to be recognized as an antigen (, pp. 2017–2021).
2.4 Molecular docking
Predicted epitopes (CTL & HTL) were subjected to molecular docking studies to assess their binding affinities with HLA molecules. ClusPro tool https://cluspro.org/help.phpb was used for these studies (). The binding interactions were visualized and the interaction patterns were analyzed using Pymol to ensure strong and specific binding.
2.5 Constructing a multi-epitope chain and its interaction analysis
The selected T&B-cell epitopes were concatenated into a single multi-epitope chain. Linker sequences were used to join the epitopes to enhance their presentation and processing by the immune system. Furthermore, the vaccine construct was supplemented with an adjuvant and PADRE sequence to bolster its immunogenicity and facilitate epitope presentation. The physicochemical properties of the finalized vaccine construct was also noted. The I-Tasser server https://zhanggroup.org/I-TASSER/ () was employed to initially model the multi-epitope chain, followed by refinement utilizing the Galaxy refine server https://galaxy.seoklab.org/cgi-bin/submit.cgi?type=REFINE (). The refined vaccine’s 3D model underwent validation using the ProSA-web tool https://bio.tools/prosa-web (). In addition, the Ramachandran plot was also investigated using MolProbity https://phenix-online.org/documentation/reference/molprobity_tool.html and the structural robustness of the modelled vaccine was examined using CABS-flex 2.0 https://bio.tools/cabs-flex_2.0 (). Molecular docking with the Cluspro server https://cluspro.org/help.php was performed to determine the ability of the multi-epitope construct to trigger innate immune activation via TLR-4.
2.6 Disulfide engineering
In order to improve the structural stability of the vaccine structure numerous disulfide bonds were incorporated into the refined vaccine construct utilizing the design v2.0 web server ().
2.7 Immune simulation
The vaccine sequence was also investigated foe the ability to induce humoral and adaptive immune responses. We employed in silico immune simulation assay for the same utilizing C-immsim server ().
3 Results
3.1 SpA assessment
Multiple sequence alignments revealed some mutations in the Spa protein. These mutations were noted for emitting the epitopes lying within these regions (Figure 1). The protein’s properties unveiled its molecular weight at 45528.47, theoretical pI at 5.65, with 56 +vely charged residues and 62-vely charged residues. The projected ½ life spanned 30 hrs (mammalian reticulocytes, in-vitro), greater than 20 hours (yeast, in-vivo), and greater than 10 hours (E. coli, in-vivo). The Aliphatic and instability index stood at 69.47, (II) and 50.49 respectively. The GRAVY was measured at -0.991. The identified mutations could potentially impact the immunogenic properties of SpA by altering its epitope structure or antigen presentation. These changes may influence vaccine efficacy, necessitating careful consideration during epitope selection and structural modeling. The molecular weight and pI of the SpA are crucial factors that can influence its immunogenic properties. The molecular weight of a protein impacts its processing and presentation by antigen-presenting cells, as smaller peptides may be more readily processed, while larger proteins may require additional processing steps. The theoretical pI, on the other hand, reflects the protein’s charge at physiological pH, affecting its solubility, stability, and binding interactions with immune receptors and antibodies. Proteins with pI values close to the physiological pH are often more soluble and can interact more effectively with immune components, potentially enhancing their immunogenicity. These properties, therefore, underscore the significance of SpA’s structural and physicochemical characteristics in the design of effective epitope-based vaccines.
Figure 1
3.2 Epitope screening
The Tepitool server from IEDB was used to forecast HLA-Class I & II epitopes. Tepitool predicts how peptides bind to HLA molecules, with HLA class II molecules accommodating longer peptides due to their expanded binding groove, in contrast to the confined groove in HLA class I molecules. Despite this difference, the core binding region of class II molecules is typically around 9 amino acids in length. Flanking amino acids enhances the stability of the binding without directly interacting with the HLA binding groove. To maximize the coverage of potential binding cores while minimizing redundancy, we selected 15mer peptides overlapping by 10 amino acids. This approach ensured that all possible 9mer binding cores were represented, with a minimum of one flanking residue on each side for stability. This approach eliminates the selection of overlapping peptides that share identical binding cores (). We followed the IEDB recommended method for predicting and selecting the most ideal peptides, which is the default prediction method in Tepitool. While 15mer peptides were selected for optimal CD4+ T cell recognition, their larger size may lead to overlap with adjacent sequences, potentially reducing specificity and increasing cross-reactivity. Additionally, larger peptides may face processing limitations that could impact overall immunogenicity. However, if we do carry out blast analysis against the human genome, this will reduce the probability of cross reactivity. For HLA Class I epitopes, 9 mers were selected. Tepitool selects the best prediction approach available for a given MHC molecule based on predictor availability and historical performance. Peptides with a percentile rank of less than 0.5 were only selected for further screening. A total of 71 epitopes targeting HLA Class I alleles and 33 promiscuous epitopes targeting HLA Class II alleles were predicted. In addition, BepiPred 2.0 predicted nearly 12 B cell epitopes (Supplementary Figure 2). The IEDB database-based tools have earlier been employed by numerous research groups to predict promising epitopes targeting viral (; ) bacterial (), parasitic () and other metabolic disorders (). This underscores the reliability of the predicted epitopes for vaccine applications.
3.3 Epitope selection criteria
The selected epitopes underwent a comprehensive filtering process before molecular docking analysis to ensure their suitability for vaccine development. The filters applied and their relevance are discussed below:
3.3.1 High predicted affinities to HLA alleles
The efficacy of an immune response is significantly influenced by how well epitopes bind to HLA molecules. Our results demonstrated that the selected epitopes exhibited strong binding affinities, as indicated by their high percentile scores.
3.3.2 Broad population coverage
Ensuring broad population coverage is imperative for the universal applicability of a vaccine. To achieve this, we selected promiscuous epitopes capable of binding to multiple HLA alleles, thereby covering a larger population. This approach increases the likelihood that a significant proportion of the population will respond to the vaccine, thus enhancing its overall efficacy.
3.3.3 Immunogenicity
Peptide-based vaccines often exhibit lower immunogenicity. To address this, we utilized the VaxiJen server to select epitopes with high immunogenic potential (). The chosen epitopes demonstrated the ability to trigger both humoral and cellular immune responses, indicating their effectiveness as vaccine candidates.
3.3.4 Consideration of glycosylation sites
Glycosylation can impact the stability, immunogenicity, and efficacy of epitopes. Using the NetNGlyc tool (), we excluded epitopes lying within glycosylation regions to ensure optimal performance. This additional filter further refined our selection, enhancing the stability and immune recognition of the epitopes.
3.3.5 Molecular docking
The epitopes were further docked with HLA alleles. Visual analysis of the docking complexes revealed that the epitopes fit well into the binding domains of the HLA molecules, forming stable hydrogen bonds with key residues. For HLA Class II-epitope interaction analysis, docking was performed with two HLA-DRB1 alleles i.e. 01 & 15. In contrast, for HLA Class I-epitope interaction analysis, we used the HLA-A*02:01 allele (Figure 2). This analysis confirmed that the epitopes could be effectively displayed by HLA molecules on the membrane of antigen-presenting cells.
Figure 2
3.4 Epitopes finalization
After applying the above filters, we identified 10 HTL and 7 CTL epitopes. These epitopes demonstrated high binding affinity (Figure 3), broad population coverage, and immunogenicity, and were free from glycosylation sites. For the identification of the B cell epitope, we employed the BepiPred 2.0 tool with a threshold of 0.5. We selected epitopes that were above this threshold, greater than 10 amino acids in length, conserved, immunogenic, and not within glycosylation sites. Based on these criteria, 3 B cell epitopes were selected (Table 1). The above filters led to the identification of the most promising epitopes within SpA protein. Similar kinds of filters have earlier been employed by several research groups in their immuno-informatics study to screen out epitopes for high success probabilities (). The physicochemical properties of the finally selected epitopes are represented in Supplementary Table 1.
Figure 3
Table 1
| Location | Epitope sequence | Interacting HLA alleles | Antigenicity score |
|---|---|---|---|
| HLA Class I epitopes | |||
| 11-19 | KLGVGIASV | HLA-A*02:01, HLA-A*02:03, HLA-A*02:06 | 0.9 |
| 84-92 | KLNDSQAPK | HLA-A*03:01, HLA-A*11:01, HLA-A*30:01, | 1.28 |
| 92-100 | KADAQQNKF | HLA-A*01:01, HLA-B*58:01 | 1.2 |
| 132-140 | DPSQSANLL | HLA-B*35:01, HLA-B*51:01, HLA-B*53:01, | 0.58 |
| 145-153 | KLNESQAPK | HLA-A*03:01, HLA-A*11:01, HLA-A*30:01 | 0.98 |
| 203-211 | KLNDAQAPK | HLA-A*03:01, HLA-A*11:01, HLA-A*30:01 | 1.09 |
| 352-360 | KLADKNMIK | HLA-A*03:01, HLA-A*11:01, HLA-A*30:01 | 0.7 |
| HLA Class II epitopes | |||
| 27-41 | SGGVTPAANAAQHDE | HLA-DRB1*04:01, HLA-DRB1*04:05, HLA-DRB1*08:02, HLA-DRB1*09:01, HLA-DRB1*11:01, HLA-DRB1*15:01, HLA-DRB3*02:02, HLA-DRB4*01:01, HLA-DQA1*05:01/DQB1*03:01, HLA-DQA1*05:01/DQB1*02:01, HLA-DQA1*04:01/DQB1*04:02, HLA-DQA1*03:01/DQB1*03:02, HLA-DQA1*01:02/DQB1*06:02, | 0.83 |
| 70-84 | DDPSQSANVLGEAQK | HLA-DQA1*01:02/DQB1*06:02, HLA-DQA1*03:01/DQB1*03:02 | 0.61 |
| 82-96 | AQKLNDSQAPKADAQ | HLA-DRB1*01:01, HLA-DRB1*04:01, HLA-DRB1*07:01, HLA-DRB1*09:01, HLA-DRB3*02:02, HLA-DQA1*01:02/DQB1*06:02, HLA-DQA1*05:01/DQB1*03:01, | 1.01 |
| 92-106 | KADAQQNKFNKDQQS | HLA-DPA1*01:03/DPB1*02:01, HLA-DPA1*02:01/DPB1*01:01 | 1.09 |
| 143-157 | AKKLNESQAPKADNK | HLA-DRB1*01:01, HLA-DRB1*04:01, HLA-DRB1*07:01, HLA-DRB1*09:01, HLA-DRB1*13:02, HLA-DRB3*02:02 HLA-DRB4*01:01, HLA-DQA1*01:02/DQB1*06:02, HLA-DQA1*04:01/DQB1*04:02, HLA-DQA1*05:01/DQB1*03:01 | 0.9 |
| 201-215 | AKKLNDAQAPKADNK | HLA-DRB1*01:01, HLA-DRB1*04:01, HLA-DRB1*08:02, HLA-DRB1*09:01, HLA-DRB1*15:01, HLA-DRB3*02:02 HLA-DRB4*01:01, HLA-DRB5*01:01, HLA-DQA1*01:01/DQB1*05:01, HLA-DQA1*01:02/DQB1*06:02, HLA-DQA1*03:01/DQB1*03:02, HLA-DQA1*04:01/DQB1*04:02, HLA-DQA1*05:01/DQB1*02:01, HLA-DQA1*05:01/DQB1*03:01 | 0.91 |
| 321-335 | GNGVHVVKPGDTVND | HLA-DRB4*01:01, HLA-DQA1*04:01/DQB1*04:02, HLA-DQA1*05:01/DQB1*03:01 | 0.94 |
| 330-344 | GDTVNDIAKANGTTA | HLA-DRB1*08:02, HLA-DRB1*11:01, HLA-DQA1*01:02/DQB1*06:02 | 0.55 |
| 336-350 | IAKANGTTADKIAAD | HLA-DRB1*07:01, HLA-DQA1*01:02/DQB1*06:02, HLA-DQA1*03:01/DQB1*03:02, HLA-DQA1*05:01/DQB1*02:01, HLA-DQA1*05:01/DQB1*03:01 | 1.3 |
| 343-357 | TADKIAADNKLADKN | HLA-DRB1*03:01, HLA-DRB1*04:01, HLA-DRB1*04:05, HLA-DRB1*08:02, HLA-DRB1*11:01, HLA-DRB1*13:02, HLA-DRB3*01:01, HLA-DRB3*02:02, HLA-DRB4*01:01HLA-DPA1*02:01/DPB1*01:01, HLA-DPA1*02:01/DPB1*05:01, HLA-DPA1*03:01/DPB1*04:02, HLA-DQA1*01:01/DQB1*05:01, HLA-DQA1*04:01/DQB1*04:02, HLA-DQA1*05:01/DQB1*02:01 | 0.99 |
| B Cell epitopes | |||
| 31-45 | TPAANAAQHDEAQQN | 1.04 | |
| 69-92 | KDDPSQSANVLGEAQKLNDSQAPK | 0.6 | |
| 260-324 | KKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDNNKPGKEDNNKPGKEDGNKPGKEDNKKPGKEDGNKPGKEDGNKPGKEDGNGV | 1.08 | |
Finalized T and B cell epitopes.
Their location, sequence, promiscuousity and antigenicity are depicted.
3.6 Multi-epitope vaccine: structural modelling and validation
The vaccine construct was designed by integrating the optimal T & B cell epitopes to induce a strong immune response. The epitopes selected from previous screening stages (10 HTL, 7 CTL, and 3 B cell epitopes) were used as building blocks for these constructs. The vaccine had molecular weight of 53667.56 Daltons, theoretical PI: 5.75, extinction coefficient 15930, estimated half life 30 hours, instability index 32.26, aliphatic index 63.64 and GRAVY -0.796 as predicted by protparam tool. The incorporation of adjuvants and synthetic linkers was aimed at enhancing immunogenicity and ensuring the proper folding of the vaccine constructs. The addition of the 50S ribosomal protein L7/L12 fortified the vaccine construct to enhance the immune response, capitalizing on its robust immunostimulatory capabilities (Figure 4A). The initial vaccine constructs were modelled using the I-Tasser server (Figure 4B). This tool provided a preliminary 3D structure of the multi-epitope vaccines by predicting the folding and spatial arrangement of the included epitopes. The top 10 templates used by the I-Tasser server for modelling the vaccine construct were 1rquA, 7wkkB, 1rqv, 2nbiA, 1rqv, 8wxbY, 1rquA, 8p0vL, 5h7c and 1dd3A. The model generated had a C-score of -0.97, with estimated TM and RMSD scores as 0.59 ± 0.14 and 9.7 ± 4.6Å respectively. Refinement of the preliminary structure was conducted using the online available Galaxy Refine server. This step was essential to enhance the integrity of the vaccine model by refining both local and global structure, thereby enhancing the overall stability and accuracy of the model. The refinement process included side-chain repacking and overall energy minimization, leading to more reliable and realistic vaccine structures. The refined vaccine models were validated using Ramachandran plot analysis using MolProbilty. The overall amino acids lying in the favored region were 98.5% (Supplementary Figure 3). This method assesses the stereochemical characteristics of the protein structures by assessing the φ (phi) and ψ (psi) dihedral angles of the aa residues. It was observed that a predominant number of residues in the refined vaccine constructs were situated within the favored regions of the Ramachandran plot (about 98.5%), indicating a high-quality and reliable structure. The results obtained by the ProSa-web tool also demonstrated the considerable structural integrity of the vaccine construct (Figures 4C, D). Finally, employing the CABSflex 2.0 server, the vaccine’s flexible and rigid domains were delineated by molecular motion analysis, within the vaccine construct. Evaluation of the final 3D structures (ten) demonstrated minor changes at the beginning locations, where the adjuvant was connected. Conversely, notable fluctuations were detected close to the terminus. This was the region where a succession of epitopes was affixed using linkers, delineated in dark brown and red sections (Figure 5A). Across all 10 models, the contact map illustrated the patterns of residue-residue interactions (Figure 5B). According to the RMSF plot, residue fluctuations varied from 0 Å to 7 Å, with more pronounced variability towards the latter part of the sequence, mainly comprising the epitopes, suggesting a high degree of flexibility in these regions (Figure 5C).
Figure 4
Figure 5
3.6 Molecular docking analysis
In order to explore the interaction between the vaccine model and TLR-4, molecular docking analysis was performed, aiming to assess its binding affinity and potential immunostimulatory effects. The ClusPro server was employed for the same. It provided a detailed understanding of the binding interactions, depicting binding energies and the interacted amino acids. The vaccine construct exhibited a strong binding affinity to TLR-4, as indicated by the docking score, which revealed stability with significant interactions. Visual analysis of the docking complex demonstrated multiple H-bond interactions between the vaccine and TLR-4. Key residues of TLR-4 involved in binding with the vaccine were identified, ensuring the stability and specificity of the interaction (Figure 6). The robust binding conformation of the vaccine construct in the TLR-4 binding pocket hints at effective interaction with the receptor, potentially bolstering immune response through TLR-4-mediated signaling pathways. This strong and stable binding interaction with TLR-4 is crucial for activating innate and adaptive immune responses. The presence of an adjuvant in the vaccine construct may significantly contribute to the enhanced immunogenicity, acting as a potent immunostimulant and enhancing interaction with TLR-4. Overall, the stable and specific interactions observed in the docking studies highlight the suitability of the construct for further experimental validation as an effective vaccine against MRSA. These findings support the potential of the proposed vaccine construct to engage TLR-4 and promote an enhanced immune response through the activation of TLR-4-dependent pathways.
Figure 6
3.7 Disulfide engineering
In order to enhance the structural integrity of the vaccine construct, it was subjected to disulfide engineering. Disulfide by Design 2.12 was used for the same. We uploaded the refined model of the vaccine construct to the server and used for residue pair discovery before being used for disulfide engineering. Following that, 18 latent amino acid pairs were shortlisted (Figure 7).
Figure 7
3.8 Immune simulation assay
The immune simulation was carried out at random seed, simulation volume 10, and number of steps 100, 3 injections at 1-, 24- and 48-weeks interval. The vaccine sequence was observed to elicit varied immune cells revealing its potential immune system activation capability (Figure 8).
Figure 8
4 Discussion
MRSA possess high resistance to conventional antibiotics and has the ability to cause severe infections ranging from skin infections to life-threatening conditions such as pneumonia and sepsis. The global rise in MRSA infections emphasizes the urgent need for innovative therapeutic strategies, particularly vaccines that prevent infection. While there is currently no licensed vaccine for MRSA, several candidates have been investigated, including protein-based and polysaccharide-conjugate vaccines. However, these approaches have demonstrated limited efficacy in clinical trials, underscoring the necessity for alternative strategies (). The growing incidence of MRSA infections underscores the urgent need for novel therapeutic strategies, particularly those aimed at preventing infections through vaccination (). This study aimed to leverage immuno-informatics to identify potential immunogenic epitopes in SpA a key virulence factor in MRSA, which could serve as a promising target for vaccine development. Tepitool, one of the most advanced tools for predicting epitopes was employed for predicting how peptides bind to HLA molecules, with HLA class II molecules accommodating longer peptides due to their expanded binding groove, in contrast to the confined groove in HLA class I molecules. Despite this difference, the core binding region of class II molecules is typically around 9 amino acids in length. Flanking amino acids enhances the stability of the binding without directly interacting with the HLA binding groove. To maximize the coverage of potential binding cores while minimizing redundancy, we selected 15mer peptides overlapping by 10 amino acids. This approach ensured that all possible 9mer binding cores were represented, with a minimum of one flanking residue on each side for stability. This approach eliminates the selection of overlapping peptides that share identical binding cores (). The same tool and strategy were applied earlier by Moustafa et al. for cell epitope selection (). We then filtered the epitopes based on their high predicted affinities to HLA alleles, indicated by high percentile scores. Epitopes with broad population coverage due to their promiscuous nature, immunogenic characteristics, and positions in non-glycosylation sites were prioritized. The present epitope filtration strategy was applied as described earlier (). After applying these criteria, the selected epitopes underwent molecular docking, and those demonstrating promising interactions were finally chosen. Finally, we designed the vaccine model concatenated with epitopes which passed stringent filters as applied, linkers, adjuvant (50S ribosomal protein L7/L12) and PADRE sequence. The adjuvant has proven TLR-4 stimulating properties. Studies have shown that incorporating ribosomal proteins as adjuvants can lead to improved vaccine efficacy by promoting antigen presentation. Recently, a similar kind of immuno-informatics study was conducted where the multi-epitope vaccine was developed against Mycobacterium tuberculosis and they incorporated 50S ribosomal protein L7/L12 as an immune stimulator in their vaccine sequence (). I-Tasser server produced the 3-D model which we refined and checked its robustness using several validation parameters. Later on, the vaccine model was docked with TLR-4 to examine its binding nature. The presented vaccine has the potential to elicit both humoral and cellular immunity as it is comprised of carefully selected epitopes (cytotoxic, helper T cell and B cell), adjuvant and PADRE sequences. This approach is particularly relevant in the context of the ongoing global effort to combat antibiotic-resistant bacteria through innovative immunological strategies.
Moving forward, in vitro and in vivo validation studies will be essential to confirm the immunogenicity, safety, and efficacy of the proposed multi-epitope construct. Further experimental testing will allow us to evaluate the immune responses generated by the vaccine, ensuring that it provides adequate protection against MRSA without adverse effects. In addition to validation, future research could benefit from exploring advanced adjuvant formulations and delivery systems to optimize the vaccine’s immunogenicity and stability. Studies investigating this vaccine construct’s effectiveness across diverse population groups are also warranted, given the global prevalence of MRSA and the need for a broadly applicable solution. Such population studies could help tailor the vaccine to address regional HLA variability, enhancing its efficacy and coverage.
5 Conclusion
The study successfully identified and screened multiple T & B-cell epitopes within the SpA of MRSA, utilizing advanced immuno-informatics tools. These epitopes were incorporated into multi-epitope vaccine constructs, modelled, and refined to ensure structural stability and immunogenicity. Molecular docking studies demonstrated strong and stable interactions with TLR-4, suggesting the potential for robust immune activation. The study highlights the need for in vitro immunogenicity assays to validate epitope-specific responses, animal model studies to assess the safety and efficacy of the multi-epitope vaccine, and adjuvant optimization to enhance immune responses, paving the way for advanced vaccine development against MRSA. The study underscores the potential of epitope-based vaccines targeting SpA as a novel approach to combat MRSA infections.
Statements
Data availability statement
Publicly available datasets were analyzed in this study. This data can be found here: NCBI - WP_033567379.
Author contributions
PZ: Conceptualization, Data curation, Investigation, Methodology, Writing – original draft, Writing – review & editing. XS: Formal analysis, Investigation, Methodology, Writing – original draft, Writing – review & editing. JX: Investigation, Resources, Writing – original draft, Writing – review & editing. YW: Conceptualization, Methodology, Validation, Visualization, Writing – original draft, Writing – review & editing. SD: Investigation, Methodology, Writing – original draft, Writing – review & editing.
Funding
The author(s) declare financial support was received for the research, authorship, and/or publication of this article. This work is supported by the Science and Technology Projects in Guangzhou (2023A04J1143 to PZ).
Acknowledgments
The authors thank the research committee for permitting them to carry out the following study.
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Generative AI statement
The author(s) declare that no Generative AI was used in the creation of this manuscript.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fcimb.2024.1503944/full#supplementary-material
Supplementary Figure 1HLA Class I (A) and Class II alleles (B) targeted for epitope prediction.
Supplementary Figure 2Overall results of BepiPred-2.0 server.
Supplementary Figure 3Ramachandran Plot of the refined vaccine construct. 98.5% of residues were in the favored region.
References
1
BaneshS.PatilN.ChethireddyV. R.BhukmariaA.SaudagarP. (2024). Design and evaluation of a multiepitope vaccine for pancreatic cancer using immune-dominant epitopes derived from the signature proteome in expression datasets. Med. Oncol.41, 90. doi: 10.1007/s12032-024-02334-4
2
BearA.LockeT.Rowland-JonesS.PecettaS.BagnoliF.DartonT. C. (2023). The immune evasion roles of Staphylococcus aureus protein A and impact on vaccine development. Front. Cell Infect. Microbiol.13. doi: 10.3389/fcimb.2023.1242702
3
ChauhanV.KhanA.FarooqU. (2023). In silico study to predict promiscuous peptides for immunodiagnosis of cystic echinococcosis. Trop. Parasitol.13, 54–62. doi: 10.4103/tp.tp_70_22
4
ChauhanV.RungtaT.RawatM.GoyalK.GuptaY.SinghM. P. (2021). Excavating SARS-coronavirus 2 genome for epitope-based subunit vaccine synthesis using immunoinformatics approach. J. Cell Physiol.236, 1131–1147. doi: 10.1002/jcp.29923
5
ChauhanV.SinghM. P. (2020). Immuno-informatics approach to design a multi-epitope vaccine to combat cytomegalovirus infection. Eur. J. Pharm. Sci.147, 105279. doi: 10.1016/j.ejps.2020.105279
6
ChauhanV.SinghM. P.RathoR. K. (2018). Identification of T cell and B cell epitopes against Indian HCV-genotype-3a for vaccine development- An in silico analysis. Biologicals53, 63–71. doi: 10.1016/j.biologicals.2018.02.003
7
CleggJ.SoldainiE.McLoughlinR. M.RittenhouseS.BagnoliF.PhogatS. (2021). Staphylococcus aureus vaccine research and development: the past, present and future, including novel therapeutic strategies. Front. Immunol.12. doi: 10.3389/fimmu.2021.705360
8
CruzA. R.BoerM. A. D.StrasserJ.ZwarthoffS. A.BeurskensF. J.de HaasC. J. C.et al. (2021). Staphylococcal protein A inhibits complement activation by interfering with IgG hexamer formation. Proceedings of the National Academy of Sciences of the United States of America.118 (7), e2016772118. doi: 10.1073/pnas.2016772118IF:9.4
9
DenissenJ.ReynekeB.Waso-ReynekeM.HavengaB.BarnardT.KhanS.et al. (2022). Prevalence of ESKAPE pathogens in the environment: Antibiotic resistance status, community-acquired infection and risk to human health. Int. J. Hyg Environ. Health244, 114006. doi: 10.1016/j.ijheh.2022.114006
10
DoytchinovaI. A.FlowerD. R. (2007). VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinf.8, 4. doi: 10.1186/1471-2105-8-4
11
ForsgrenA.SjöquistJ. (1966). Protein A” from S. aureus. I. Pseudo-immune reaction with human gamma-globulin. J. Immunol.97, 822–827. doi: 10.4049/jimmunol.97.6.822
12
GBD 2021 Antimicrobial Resistance Collaborators (2024). Global burden of bacterial antimicrobial resistance 1990-2021: a systematic analysis with forecasts to 2050. Lancet404, 1199–1226. doi: 10.1016/S0140-6736(24)01867-1
13
GhafouriE.FadaieM.AmirkhaniZ.EsmaeilifallahM.RahimmaneshI.HosseiniN.et al. (2024). Evaluation of humoral and cellular immune responses against Vibrio cholerae using oral immunization by multi-epitope-phage-based vaccine. Int. Immunopharmacol134, 112160. doi: 10.1016/j.intimp.2024.112160
14
GuoY.SongG.SunM.WangJ.WangY. (2020). Prevalence and therapies of antibiotic-resistance in staphylococcus aureus. Front. Cell Infect. Microbiol.10. doi: 10.3389/fcimb.2020.00107
15
GuptaR.BrunakS. (2002). Prediction of glycosylation across the human proteome and the correlation to protein function. Pac Symp Biocomput, 310–322.
16
HeoL.ParkH.SeokC. (2013). GalaxyRefine: protein structure refinement driven by side-chain repacking. Nucleic Acids Res.41, W384. doi: 10.1093/nar/gkt458
17
HowdenB. P.GiulieriS. G.Wong Fok LungT.BainesS. L.SharkeyL. K.LeeJ. Y. H.et al. (2023). Staphylococcus aureus host interactions and adaptation. Nat. Rev. Microbiol.21, 380–395. doi: 10.1038/s41579-023-00852-y
18
JawaV.TerryF.GokemeijerJ.Mitra-KaushikS.RobertsB. J.TourdotS.et al. (2020). T-cell dependent immunogenicity of protein therapeutics pre-clinical assessment and mitigation–updated consensus and review 2020. Front. Immunol.11. doi: 10.3389/fimmu.2020.01301
19
JespersenM. C.PetersB.NielsenM.MarcatiliP. (2017). BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res.45, W24–W29. doi: 10.1093/nar/gkx346
20
KhalidK.PohC. L. (2023). The Promising Potential of Reverse Vaccinology-Based Next-Generation Vaccine Development over Conventional Vaccines against Antibiotic-Resistant Bacteria. Vaccines11, 1264. doi: 10.3390/vaccines11071264
21
KhanM. T.MahmudA.IslamM. M.SumaiaM. S. N.RahimZ.IslamK.et al. (2023). Multi-epitope vaccine against drug-resistant strains of Mycobacterium tuberculosis: a proteome-wide subtraction and immunoinformatics approach. Genomics Inform21, e42. doi: 10.5808/gi.23021
22
KlimkaA.MertinsS.NicolaiA. K.RummlerL. M.HigginsP. G.GüntherS. D.et al. (2021). Epitope-specific immunity against Staphylococcus aureus coproporphyrinogen III oxidase. NPJ Vaccines6, 11. doi: 10.1038/s41541-020-00268-2
23
KuriataA.GierutA. M.OlenieckiT.CiemnyM. P.KolinskiA.KurcinskiM.et al. (2018). CABS-flex 2.0: a web server for fast simulations of flexibility of protein structures. Nucleic Acids Res.46, W338–W343. doi: 10.1093/nar/gky356
24
MandelliA. P.MagriG.TortoliM.TorricelliS.LaeraD.BagnoliF.et al. (2024). Vaccination with staphylococcal protein A protects mice against systemic complications of skin infection recurrences. Front. Immunol.15. doi: 10.3389/fimmu.2024.1355764
25
MillerL. S.FowlerV. G.ShuklaS. K.RoseW. E.ProctorR. A. (2020). Development of a vaccine against Staphylococcus aureus invasive infections: Evidence based on human immunity, genetics and bacterial evasion mechanisms. FEMS Microbiol. Rev.44, 123–153. doi: 10.1093/femsre/fuz030
26
MoustafaR. I.FaraagA. H. I.El-ShenawyR.AgwaM. M.ElsayedH. (2023). Harnessing immunoinformatics for developing a multiple-epitope peptide-based vaccination approach against SARS-CoV-2 spike protein. Saudi J. Biol. Sci.30, 103661. doi: 10.1016/j.sjbs.2023.103661
27
PapadopoulosJ. S.AgarwalaR. (2007). COBALT: constraint-based alignment tool for multiple protein sequences. Bioinformatics23, 1073–1079. doi: 10.1093/bioinformatics/btm076
28
ParsonsJ. B.WestgeestA. C.ConlonB. P.FowlerV. G. (2023). Persistent methicillin-resistant staphylococcus aureus bacteremia: host, pathogen, and treatment. Antibiotics (Basel)12, 455. doi: 10.3390/antibiotics12030455
29
PaulS.SidneyJ.SetteA.PetersB. (2016). TepiTool: A pipeline for computational prediction of T cell epitope candidates. Curr. Protoc. Immunol.114, 18.19.1–18.19.24. doi: 10.1002/cpim.12
30
PauliN. T.KimH. K.FalugiF.HuangM.DulacJ.Henry DunandC.et al. (2014). Staphylococcus aureus infection induces protein A-mediated immune evasion in humans. J. Exp. Med.211, 2331–2339. doi: 10.1084/jem.20141404
31
SalodZ.MahomedO. (2022). Protocol for a scoping review of potential vaccine candidates predicted by VaxiJen for different viral pathogens between 2017-2021. Syst. Rev.11, 284. doi: 10.1186/s13643-022-02121-0
32
Sanchez-TrincadoJ. L.Gomez-PerosanzM.RecheP. A. (2017). Fundamentals and methods for T- and B-cell epitope prediction. J. Immunol. Res.2017, 2680160. doi: 10.1155/2017/2680160
33
StolfiP.CastiglioneF.MastrostefanoE.Di BiaseI.Di BiaseS.PalmieriG.et al. (2022). In-silico evaluation of adenoviral COVID-19 vaccination protocols: Assessment of immunological memory up to 6 months after the third dose. Front. Immunol.13, 998262. doi: 10.3389/fimmu.2022.998262
34
TurnerN. A.Sharma-KuinkelB. K.MaskarinecS. A.EichenbergerE. M.ShahP. P.CarugatiM.et al. (2019). Methicillin-resistant Staphylococcus aureus: an overview of basic and clinical research. Nat. Rev. Microbiol.17, 203–218. doi: 10.1038/s41579-018-0147-4
35
VajdaS.YuehC.BeglovD.BohnuudT.MottarellaS. E.XiaB.et al. (2017). New additions to the ClusPro server motivated by CAPRI. Proteins85, 435–444. doi: 10.1002/prot.25219
36
WiedersteinM.SipplM. J. (2007). ProSA-web: interactive web service for the recognition of errors in three-dimensional structures of proteins. Nucleic Acids Res.35, W407–W410. doi: 10.1093/nar/gkm290
37
WilkinsM. R.GasteigerE.BairochA.SanchezJ. C.WilliamsK. L.AppelR. D.et al. (1999). Protein identification and analysis tools in the ExPASy server. Methods Mol. Biol.112, 531–552. doi: 10.1385/1-59259-584-7:531
38
XieD. F.FangH.MeiJ. Q.GongJ. Y.WangH. P.ShenX. Y.et al. (2018). Improving thermostability of (R)-selective amine transaminase from Aspergillus terreus through introduction of disulfide bonds. Biotech. App Biochem.65, 255–262. doi: 10.1002/bab.1572
39
ZhouX.ZhengW.LiY.PearceR.ZhangC.BellE. W.et al. (2022). I-TASSER-MTD: a deep-learning-based platform for multi-domain protein structure and function prediction. Nat. Protoc.17, 2326–2353. doi: 10.1038/s41596-022-00728-0
Summary
Keywords
human leukocyte antigen, immuno-informatics, methicillin-resistant Staphylococcus aureus, Staphylococcal Protein A, toll-like receptor, vaccine development
Citation
Zhou P, Shi X, Xia J, Wang Y and Dong S (2025) Innovative epitopes in Staphylococcal Protein-A an immuno-informatics approach to combat MDR-MRSA infections. Front. Cell. Infect. Microbiol. 14:1503944. doi: 10.3389/fcimb.2024.1503944
Received
30 September 2024
Accepted
09 December 2024
Published
14 January 2025
Volume
14 - 2024
Edited by
Biswajit Mishra, Brown University, United States
Reviewed by
Mukesh Kumar, All India Institute of Medical Sciences, India
Ravneet Chug, Amity University Jaipur, India
Updates
Copyright
© 2025 Zhou, Shi, Xia, Wang and Dong.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Yifei Wang, twang-yf@163.com; Shaowei Dong, michael.dong.85@gmail.com
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.