ORIGINAL RESEARCH article

Front. Immunol., 24 January 2023

Sec. Autoimmune and Autoinflammatory Disorders : Autoimmune Disorders

Volume 14 - 2023 | https://doi.org/10.3389/fimmu.2023.1084283

Platelets derived citrullinated proteins and microparticles are potential autoantibodies ACPA targets in RA patients

  • 1. Hubei Key Laboratory of Genetic Regulation and Integrative Biology, School of Life Sciences, Central China Normal University, Wuhan, China

  • 2. Department of Rheumatology, Union Hospital, Tongji Medical College, Huazhong University of Science and Technology, Wuhan, China

  • 3. Department of Dermatology, Hospital affiliated to Central China Normal University, Wuhan, China

  • 4. Department of Environmental and Biosciences, School of Business, Innovation and Sustainability, Halmstad University, Halmstad, Sweden

  • 5. Division of Medical Inflammation Research, Department of Medical Biochemistry and Biophysics, Karolinska Institute, Stockholm, Sweden

Abstract

Citrullinated neoepitopes have emerged as key triggers of autoantibodies anti-citrullinated protein antibodies (ACPA) synthesis in rheumatoid arthritis (RA) patients. Apart from their critical role in homeostasis and thrombosis, platelets have a significant contribution to inflammation as well. Although anuclear in nature, platelets have an intricate post-translational modification machinery. Till now, citrullination in platelets and its contribution to trigger autoantibodies ACPA production in RA is an unexplored research direction. Herein, we investigated the expression of peptidylarginine deiminase (PAD) enzymes and citrullinated proteins/peptides in the human platelets and platelet derived microparticles (PDP). Both PAD4 mRNA and protein, but not the other PAD isoforms, are detectable in the human platelets. With a strict filtering criterion,108 citrullination sites present on 76 proteins were identified in the human platelets, and 55 citrullinated modifications present on 37 different proteins were detected in the PDPs. Among them, some are well-known citrullinated autoantigens associated with RA. Citrullinated forms of thrombospondin-1, β-actin, and platelet factor-4 (also known as CXCL4) are highly immunogenic and bound by autoantibodies ACPA. Furthermore, ACPA from RA sera and synovial fluids recognized citrullinated proteins from platelets and significantly activated them as evidenced by P-selectin upregulation and sCD40 L secretion. These results clearly demonstrate the presence of citrullinated autoantigens in platelets and PDPs, thus could serve as potential targets of ACPA in RA.

1 Introduction

Accumulating evidences suggest citrullination is a pre-requisite for triggering autoantibodies ACPA generation in the susceptible rheumatoid arthritis (RA) patients (). The presence of autoantibodies ACPA is a hallmark serological feature for classical RA, and has an association with a more destructive disease course, although their functional role might be both pathogenic and protective depending on their specificity (). Interestingly, autoantibodies ACPA can be detected decades before the onset of clinical arthritis (, ) and it was reported that epitope spreading with an increased recognition of citrullinated antigens occurs before the onset of RA (). B cells with citrulline specificity are likely to be triggered in response to citrullinated protein targets in vivo but the identity and role of these targets remain unclear.

Previous studies addressed autoantibodies ACPA targets present in the synovium and synovial fluid (), cartilage (), lungs (), and inflammatory cells such as neutrophils and macrophages (, ). Herein, we investigated the expression of citrullinated proteins within the platelets and PDPs. Platelets are abundant hematopoietic cells present in the blood circulation. In addition to the well-described homeostasis and thrombosis functions, platelets have important immunologic activities too, by expressing multiple pattern recognition receptors, MHC molecules, and immune co-stimulatory molecules (). Platelets are the major source of microparticles in the blood circulation, which enhances their communication within the immune system, and also involved in the crosstalk between immune and coagulation systems (, ). In RA, platelets and PDPs were detected in both the blood and the synovial fluid samples (, ). Depletion of platelets led to reduced vascular leakage in the arthritic joints and attenuated inflammation in the animal models (, ). Interestingly, previous studies reported that autoantibodies ACPA contributes to platelet activation via FcγR-dependent pathways (), platelet-derived microparticals display autoantigen which could be recognition by ACPA, and result in perpetuating formation of inflammatory immune complexes ().

Although platelets lack nuclei, they have an intricate post-translational modification (PTM) processing machinery. Based on a high resolution proteomic analysis, a diverse set of PTMs such as acetylation/deacetylation (, ), phosphorylation, arginylation (), palmitoylation (), glycosylation, and methylation () were described to fine-tune the biogenesis and function of platelets. Compared to these PTMs, citrullination processes occurring within the platelets have been less explored, including their potential contribution to trigger autoantibodies ACPA production in RA.

Here, for the first time, we provide strong evidences for the presence of citrullination proteome in platelets and PDPs. In addition, we identified certain citrullinated proteins as ACPA targeted autoantigens and in turn, ACPA promoted the activation of platelets. Our findings suggest an important role for citrullinated autoantigens present in the platelets and PDPs in RA pathogenesis.

2 Materials and methods

2.1 Patients and controls

Non-paired blood (n=40 for RA, n=11 for OA) and synovial fluid (SF, n=11 for RA, n=8 for OA) samples were collected from RA and OA patients attending the department of rheumatology, Union hospital, Tongji medical college, university of Wuhan, China. RA patients enrolled met the 1987 ACR/ELAR criteria (). Blood samples from the age- and gender-matched healthy controls (n=40) were obtained from the blood bank center, University of Wuhan. SF was collected from RA and OA patients requiring arthrocentesis for their affected knees. This study was approved by the local ethics committee of Union hospital, Tongji medical college (No. [2020] IEC-J (130)), and all the study participants gave a written informed consent to participate in this project.

2.2 Isolation of platelets and monocytes from blood

Peripheral blood from the healthy volunteers (n=4) was collected into acid citrate dextrose tube and centrifuged at 200 g for 15 min to collect the platelet-rich plasma, to avoid contamination with other blood cells. Only the upper third of the platelet-rich plasma was used for analysis. Platelets were pelleted at 600 g for 10 min, and washed twice to reduce the contamination of serum proteins using HEPES-buffered Tyrode’s solution (5 mM HEPES, 145 mM NaCl, 5 mM KCl, 0.5 mM Na2HPO4, 1 mM MgSO4, and 5 mM glucose, pH 7.2). The purity of the collected platelets was determined by CD41-staining and subsequent flow cytometry analysis. For monocyte isolation, 5 ml heparinized blood was diluted 1:1 with PBS containing 0.46% sodium citrate and layered over a 5 ml Ficoll cushion, and then centrifuged at 400 g for 15 min. PBMC containing interphase was collected and washed twice with PBS-citrate solution. Thereafter, the PBMCs were cultured in RPMI-1640 medium containing 10% FBS, in six well culture plates for 1h, allowing monocytes to adhere to the plastics. The non-adherent lymphocytes were removed and the adherent monocytes were harvested for further use.

2.3 Identification of PAD isoenzymes expression by RT-PCR

RNA from the platelets and monocytes was isolated using RNAsimple Total RNA Kit (TIANGEN, Beijing, China). The cDNA was synthetized from 1 µg of RNA using HiScript III 1st Strand cDNA Synthesis Kit (Vazyme, Nanjing, China). For PCR, 1 μl of cDNA was added to 25 μl of 2 × Phanta Flash Master Mix (Vazyme, Nanjing, China) containing Phanta Flash Super-Fidelity DNA Polymerase and, 0.5 mM forward and reverse primers. PCR was performed using a ETC811 thermocycler: 30 s at 98°C, 30 cycles of 10 s, 98°C; 5 s, 50-55°C; 5 s, 72°C, and one min elongation time at 72°C. 5 μl of the PCR product was analyzed by electrophoresis on a 1.5% agarose gel. The primers used to amplify the PAD isoforms and β-actin are presented in Table S1.

2.4 Isolation of the PDPs

For the collection of platelet derived particles (PDPs), platelets were resuspended at 2 × 108/ml and stimulated with 5 μM of ADP (Sigma-Aldrich, Shanghai, China) in platelet aggregometer for 5 min at 37°C. Platelet activation was terminated by placing the tube on ice and then adding ice-cold 0.1% v/v termination buffer containing 10% NP-40, 20 mM PMSF, 200 g/mL trypsin inhibitor, 50 mM N-ethylmaleimide, 10 mM EDTA, 1% SDS and 100 mM benzamidine. Intact platelets and the platelet clots were carefully removed by centrifuging at 800 g for 10 min, sequentially for three times, and the supernatant was harvested each time and pooled before the final spin, which yielded the PDPs.

2.5 MS analysis

Platelet pellets and PDPs were lysed in 8 M or 2 M urea solution, respectively. To this lysate, 10 mM HEPES (pH 8) was added and sonicated at 4°C for 20 min. One fraction of platelet sample was separated by gel electrophoresis and subjected to in-gel trypsin digestion as described earlier (). Briefly, gel slices (20 slices/lane) were excised and the proteins were reduced with 64 mM of dithiothreitol (DTT) at 56°C for 60 min, followed by an alkylation step in the dark for 45 min with 130 mM iodacetamide (IAA). Proteins were digested with trypsin/Lys C mixture (Promega, Wisconsin, USA) overnight at 37°C. The peptides were purified with acetonitrile/0.1% aqueous formic acid 1:1 (v/v), and re-solubilized in 0.1% aqueous formic acid prior to LC-MS/MS analysis. Another fraction of platelet sample as well as PDPs were prepared using a filter-aided sample preparation protocol (FASP) (). Each sample (100 μg) was transferred to 10 kDa cutoff spin-filter (Millipore, Ireland, UK), reduced with DTT, blocked by IAA and digested with trypsin/Lys C mixture for overnight at 37°C. The peptides were eluted from the spin filters, acidified with 0.1% formic acid, and then desalted with a C18 pipet tip (Millipore, Ireland, UK) for further use.

Peptides were loaded onto a Thermo Acclaim Pepmap precolumn followed by an Acclaim Pepmap Easyspray analytical column. Separation was performed using a Thermo Easy-nLC 1200 at a flow rate of 300 nL/min with a gradient of 2-35% organic phase (0.1% formic acid in acetonitrile) over 200 min. Peptides were analyzed using a high-energy collisional dissociation (HCD) fragmentation mode by data-dependent MS/MS acquisition, with the following settings: MS1-scan resolution 70 ;000, the AGC target was 3e6; MS2-scan resolution 17 ;500, the AGC target was 5e4; and the maximum injection time was 50 ms, NCE stepped set 27. The scan range was set at a resolution of 350-2,000 m/z and the 20 most intense precursors were chosen by data-dependent mode.

2.6 Protein identification and quantification

MaxQuant software (version 1.6.6.0) was used for the identification of peptides and proteins against the human proteome database. Peptide identification was performed with a mass tolerance up to 5 ppm for precursor ion and MS/MS tolerance to 20 ppm. A false discovery rate (FDR) was set to 0.01 at the peptide and protein level. Relative protein quantities were calculated by summing the unique peptide peak areas of each protein in MaxQuant using the LFQ (label-free quantitation) feature ().

2.7 Identification of citrullination

To ensure the accuracy of identifying citrullination, we applied a strict filtering criterion to verify the citrullinated side chains, as previously described (, ). At first, the precursor ions were extracted with a mass tolerance up to 5 ppm to prevent the forced 13C mis-assignment. All the total peptide spectral matches (PSMs) in the C-terminal citrullination site were removed due to inability of trypsin/Lys C catalytic activity to citrulline residues. Next, the assigned citrullinated MS2 spectra were manually inspected to exclude 0.984 Dalton mass increments occurring from deamidation with the neighboring N/Q residues. Only the complete fragment ion series (b, y ions) covering the citrullinated sites were considering as correct assignment. Identification of citrullinated sites was further confirmed by the occurrence of neutral loss on the precursor or fragment ions and a shift in the delayed retention time.

2.8 In vitro citrullination

Human recombinant thrombospondin-1 (TSP-1, Sigma-Aldrich), beta-actin (β-actin, Genway, San Diego, USA), or platelet factor 4 (PF4, Sigma-Aldrich) was incubated with PAD4 enzyme (Sigma-Aldrich) in the siliconized tubes containing 100 mM of Tris pH 7.7, 1 mM of DTT, and 5 mM of CaCl2. After 24 h at 37°C, reactions were stopped by adding 0.1% of trifluoroacetic acid. Citrullinated and non-citrullinated samples were loaded on SDS-PAGE followed by in-gel digestion for further mass spectrometry analysis of citrullination sites, as well as to screen for binding of ACPA by ELISA.

2.9 ELISA for autoantibodies ACPA measurement

The plates were coated with 200~500 ng/well of citrullinated or non-citrullinated forms of TSP-1, β-actin, and PF4 in 0.1 M NaHCO3 (pH 9.6), overnight at 4˚C. The plates were washed with PBS/Tween 0.05%, blocked with 1.5% BSA/PBS for 1 h, at RT, and incubated with RA sera (1:100 dilution) for 2 h, RT. Then the plates were washed and developed with HRP-conjugated rabbit anti-human IgG polyclonal antibodies for 1 h. TMB substrate was added and incubated at 37°C for 5~10 min and the reaction was stopped with 1.0 M sulfuric acid (H2SO4). The absorbance (A450 nm) was read using a microplate reader (Thermo, Shanghai, China). The absorbance value of the pooled healthy sera was set at an arbitrary unit (AU) value of 1 and was used as a standard for all other tests (1 AU/μl).

2.10 Affinity purification of autoantibodies ACPA

Autoantibodies ACPA were purified from selected RA patients’ synovial fluid and serum samples having anti-CCP2 IgG level > 500 AU/ml, using Protein G beads and CCP2-coated resins. CCP2 peptide were purchased from Euro Diagnostica (Malmö, Sweden, obtained from Biolead China), and couple to CNBr-activated Sepharase 4B beads (GE Healthcare) according to the manufacturer’s protocol. SF (5~8 mL/sample) was centrifuged at 4,000 rpm for 10 min, and the supernatant collected was treated with hyaluronidase to decrease the viscosity of the samples. Proteins were precipitated by using a saturated ammonium sulfate solution, and then dissolved in PBS and dialyzed extensively against PBS. While the serum samples were centrifuged and diluted 1:5 in PBS before purification. At first, total IgG was enriched from SF and serum samples using protein G beads. To purify ACPA, 1 mg/ml of CCP2 peptide was coupled to 2 ml of NeutrAvidin Plus UltraLink resin (Pierce Biotechnology/Thermo Scientific) for 1 h at RT. Purified total IgG from SF and serum samples was then applied to the CCP2-coated resin, and washed with PBS. ACPA were eluted by adding 0.1 M glycine-HCl buffer (pH 2.7), neutralized with 1 M Tris (pH 9) and then dialyzed against PBS.

2.11 Platelet activation and flow cytometry analysis

To block the binding of IgG-Fc with CD32, platelets (2×108/ml) were first pre-incubated with 20 μg/ml anti-human CD32 (6C4, eBioscience, Rockford, IL) for 1 h at 37°C and washed twice with PBS, To determine the capability of ACPA mediated platelets activation, platelets were incubated with seleted ACPA high sera, or SF (1:20 dilution) from RA patient or purified autoantibodies ACPA (10 μg/ml in PBS + 0.1% BSA) at 37°C for 90 min. Then supernatants were collected by centrifugation (400×g, 15 min, 20°C) and platelets were resuspended for flow cytometric analysis. The activation status of platelets was determined by flow cytometry by measuring the expression of CD62P and sCD40L level in the collected supernatants. Platelets were incubated with anti-CD62P-FITC (clone AK-4; BD Biosciences, New York, USA) which was diluted in HEPES-buffered Tyrode’s solution, pH 7.2 (1:50 dilution) for 30 minutes at RT, after which cells were fixed using 1% paraformaldehyde and analysed by NovoCyte Flow Cytometer and NovoExpress software (Agilent, Palo Alto, USA). The sCD40L level was determined by using an ELISA Kit (eBioscience, San Diego, USA).

2.12 Statistical analyses

For normally distributed populations, mean ± SD values were used and Student’s t test was applied to evaluate the statistical difference between the groups. Differences in antibody levels were examined using the non-parametric Mann-Whitney U test. Data were analyzed using GraphPad Prism version 9.0. The p values < 0.05 were considered as statistically significant.

3 Results

3.1 PAD4 expression was detectable in the human platelets

To date, five Ca2+-dependent PAD isozymes designated as PAD1-4, and PAD6, which catalyze the conversion of arginine to citrulline have been identified, each with a unique tissue and cell distribution pattern (). To examine the presence of PAD isoforms in human platelets, we first investigated the mRNA expression of all the five PAD isozymes by RT-PCR. Platelets (> 98% CD41+ cells by flow cytometry analysis, data not shown) and paired monocytes were isolated from the peripheral blood of four healthy volunteers. Total RNA was isolated from the platelets and monocytes, and each isotype of PAD gene was amplified by RT-PCR. Surprisingly, a substantial number of PAD4 mRNA was detectable in all the four platelet samples, but not the mRNAs of PAD2 or PAD1, 3 and 6 isozymes, the other isoforms described to be present in the platelets. On the other hand, we detected both PAD2 and PAD4 mRNAs in the monocytes (Figure 1A).

Figure 1

We then analyzed the expression of PAD proteins by mass spectrometry (MS). To make the platelet samples less complex to achieve a higher resolution of PADs, platelet proteins were fractioned by gel electrophoresis into 20 gel slices prior to MS analysis (Figure 1B). Clearly, unique peptides from PAD4 could be detected in two gel slices between 70 to 100 KDa bands in all the four platelet samples, which correspond to the expected molecular mass of PAD4 enzyme. BLAST search in the UniProt confirmed the aa sequences of these peptides to be unique for human PAD4 isoform, with an amino acid sequence coverage of 14.5%. In contrast, peptides of PAD2, or PAD1, 3, and 6 isoforms were not detectable in the platelet protein extracts (Figure 1C). Taken together, the identified PAD4 mRNA and protein expressed in the platelets suggests the importance and critical contribution of PAD4 isoform in citrullinating the proteins/peptides within the platelets in humans.

3.2 Identification of citrullinated proteins in human platelets

Next, we identified the proteins and specific arginine residues that were citrullinated in the platelets. To facilitate the peptide recovery, we performed a filter-aided sample preparation (FASP) method in the four platelet samples. MS analysis identified more than 44, 639 unique peptides and 3, 972 proteins with an abundance covering 10 orders of magnitude. The 100 most abundant proteins are well-known cytoskeleton, α-granule, and cytoskeletal-linked signaling proteins (Table S2 and Figure S1).

When peptides were analyzed for citrullinated modifications, a strict filtering criterion was applied to eliminate the interferences from N/Q deamidation and 13C isotopes (Figure 2A). Each MS/MS spectrum was manually verified by comparing it with the theoretically fragmented ions. The FASP short-gun MS and SDS-pre-fraction LC-MS/MS analysis revealed 108 citrullination sites on 76 different proteins (Table 1). These 76 citrullinated proteins included previously characterized substrates of PAD enzymes, such as actin, alpha-enolase, fibrinogen α/β, filamin-A, transgelin-2, and tubulin α (, ). In addition, some proteins with more specific roles in platelet functions were observed to be modified by citrullination, including integrin α-IIb, plasminogen, platelet glycoprotein Ib α, platelet glycoprotein IX, TSP-1, and von Willebrand factor. We noted that proteins with a broad range of expression levels were modified by citrullination, including highly and less abundant proteins in human platelets (Table 1).

Figure 2

Table 1

AccessionDescriptionSiteiBAQAccessionDescriptionSiteiBAQ
P12814Alpha-actinin-1R3502P35579Myosin-9R191223
R76022R1923
Q08043Alpha-actinin-3R74P23368ME2R413422
P06733Alpha-enolaseR4293660Q96SB3Neurabin-2R8101518
P08758Annexin A5R1855O00151PDLIM1R17751
P60709Beta-ActinR256444Q9NR12PDLIM7R137304
Q9BXS5AP1M1R304580R158
O95810CAVIN2R141128P08567PleckstrinR30718
P14209CD99 antigenR170432Q15149PlectinR2767626
Q96G23Ceramide synthaseR3631038R3337
Q00610ClathrinR574190P07737Profilin-1R754
Q6PJW8ConsortinR250384P02760Protein AMBPR1851177
Q9H7D0DOCK5R17212063Q9H0Q0Protein FAM49AR1471042
Q13561Dynactin subunitR212351Q15404RSU1R16533
O00429DNM1LR108218Q9H0U4RAB1BR183186
Q14118DystroglycanR6891437Q9NS28RGS18R205516
Q9NZN3EHD3R40498O94804STK10R4511577
P11021HSPA5R49109P02768Serum albuminR28111
Q9BSJ8ESYT1R1003366R509
P47755CAPZA2R109245O75368SH3BGRLR58198
P02671Fibrinogen alphaR12332Q9UJC5SH3BGRL2R74165
R271Q9UBP0SpastinR4883193
R287Q14247CTTNR59259
R510R434
R573Q7Z422SZRD1R652288
R591O00161SNAP23R148140
P02675Fibrinogen betaR6028Q9Y490Talin-1R3527
P21333Filamin-AR200115R181
R2003R606
R2334R2154
R2484P50991CCT4R153393
P04075ALDOAR33148O43396TXNL1R211447
O15117FYB1R19288P07996Thrombospondin-1R31425
Q3ZCW2LGALSLR106122R412
P06396GelsolinR39739R751
Q02153GUCY1B1R197979R767
P0DMV9HSPA1BR357234R926
P10316HLA-A R863871Q01664TFAP4R2933887
Q9H2U2PPA2R84959P37802Transgelin-2R16020
P23229Integrin alpha-6R635292P55072VCPR210134
P08514Integrin alpha-IIbR10442P09493TPM1R5584
R334P67936TPM4R2710
R399Q9BQE3Tubulin alpha-1CR422371
R433P68366Tubulin alpha-4AR7980
R799Q15813TBCER132743
P05106Integrin beta-3R50535O43399TPD52L2R182382
R662Q92614MYO18AR13021524
P13645KRT10R15967P46459NSFR5331014
P35908KRT2AR5241917P18206VinculinR54749
Q15691MAPRE1R162171R622
Q13201Multimerin-1R450160R874
P35579Myosin-9R16523P04275von Willebrand factorR1136214
R930R1597
R1342Q15942ZyxinR51770

Citrullination modifications present in human platelets.

String and GO analysis showed 32.53% (n = 27 proteins) of the identified citrullinated proteins are involved in the organization of cytoskeleton (p = 3.21×10−11) related to actin-myosin filaments and microtubules in platelets (Figures 2B, C). Protein interactome analysis indicated that a substantial portion of the citrullinated proteins was enriched after platelet degranulation (20.48%, p = 5.80×10−16; Figure 2B). Previous studies using brain, gut mucosa, and myocardial tissues showed a more preferential targeting of extracellular- and membrane-bound proteins by citrullination (). Similarly, in our analysis, proteins annotated as membrane-bound proteins involved in cell-cell and cell-substrate adhesions were over-represented in the human platelet citrullinome (14.46%, p = 8.57×10−10), especially in the processes involved in integrin α-IIb and fibrinogen, as well as in the interactions related to the cytoskeletal remodeling and platelet degranulation.

3.3 Citrullinated proteins are released in the platelet derived microparticles

Since human platelets expressed PAD4 enzyme and abundant citrullinated proteins were identified, we next addressed whether platelets could release the citrullinated proteins outside the cells. To investigate the citrullinated protein contents of PDPs, platelets from 12 volunteers were stimulated with ADP to induce the release of PDPs, and then the PDPs were harvested and subjected to MS analysis. We identified 5, 476 peptides of 687 proteins at FDR 0.01 (Table S3). As expected, many PDPs were found to be citrullinated, with the identification of 55 citrullinated peptides from 37 different proteins (Table 2). As described above, some proteins having more specific roles in platelet functions were observed to be citrullinated in the PDPs as well, such as integrin α-IIb, multimerin-1, pleckstrin, TSP-1, and von Willebrand factor. However, the majority of proteins identified to be in the citrullinated form were present within a single sample. This may be due to technical reasons, such as varying sampling depth or low abundance of the modification, or individual differences in the citrullination patterns.

Table 2

AccessionDescriptionSiteiBAQAccessionDescriptionSiteiBAQ
P35609Alpha-actinin-3R067620P02776Platelet factor 4R0801
P02749Beta-2-glycoprotein 1R210122P07359PG-Ib-alphaR08074
P60709β-actinR2564P01127PDGFBR142110
P27797CalreticulinR177176P08567PleckstrinR30721
O95810CAVIN2R141220P07737Profilin-1R07513
P10909ClusterinR19419A6NCN2KRT87PR072559
P01024Complement C3R159169P02787SerotransferrinR23925
P29279CCN2R240161R651
Q86UX7FERMT3R09848R682
P02671Fibrinogen alphaR21815P02768Serum albuminR1223
P02675Fibrinogen betaR41014R141
P21333Filamin-AR200364R281
P06396GelsolinR04823R469
R295R509
R397Q9H299SH3BGRL3R047164
P04406GAPDHR08032P09486SPARCR1815
P01857IGHG1R2997Q9Y490Talin-1R60680
P08514Integrin alpha-IIbR312136P07996Thrombospondin-1R3146
P35527KRT9R327153R412
Q14766LTBP1R144585R460
R1508R751
R1538R926
Q13201Multimerin-1R45065P01137TGF beta-1R25567
R589P67936Tropomyosin alpha-4R06517
R890P07437Tubulin betaR08644
P14543Nidogen-1R101754P04275von Willebrand factorR647102
P02775Platelet basic proteinR0622R1597
P02776Platelet factor 4R0511

Citrullination modifications detected in platelet delivery PRMs.

3.4 Autoantibodies ACPA bind to citrullinated TSP-1, β-actin, and PF4

To address the citrullination activities by PAD4 on platelet proteins, we chose TSP-1, β-actin, and PF4 as testing substrates, because of their identified citrullinated forms present in the platelets and PDPs. After the treatment with PAD4 in vitro, in total 18 arginine residues of rTSP-1 were citrullinated, which included the five in vivo citrullination sites of TSP-1 observed in the platelets and PDPs, as well as additional 12 citrullinated residues (Table 3). For β-actin samples treated with the PAD4 enzyme, 12 citrullination sites were identified, including the 10 citrullination sites that had previously been reported by another group () (Table 3). Human PF4 (also named as CXCL4) contained 4 Arg residues, including Arg51 and Arg80 that could be citrullinated in vitro (Table 3). Over all, PAD4 was efficient in citrullinating the platelet proteins TSP-1, β-actin, and PF4.

Table 3

proteinsiteAnnotated SequenceaIn vivo
TSP-1 (18)R83FQDLVDAVRAEK
R101TRGTLLALERK
R196DLASIARLRIAK
R216GGVNDNFQGVLQNVRFVFGTTPEDILR
R285DLQAICGISCDELSSMVLELRGLR
R288GLRTIVTTLQDSIR
R314RPPLCYHNGVQYRR314
R404GRSCDSLNNR
R412SCDSLNNRCEGSSVQTRR412
R421CEGSSVQTRTCHIQECDK
R458QDGGWSHWSPWSSCSVTCGDGVITRIR
R460IRLCNSPSPQMNGK
R517RSRLCNNPTPQFGGK
R607EVPDACFNHNGEHRCENTDPGYNCLPCPPR
R675CNYLGHYSDPMYRCECK
R751IPDDRDNCPFHYNPAQYDYDRR751
R767DNCPFHYNPAQYDYDRDDVGDRR767
R926DSDGDGRGDACKDDFDHDSVPDIDDICPENVDISETDFRR926
β-Actin (10)R62RGILTLK
R95IWHHTFYNELRVAPEEHPVLLTEAPLNPK
R183LDLAGRDLTDYLMK
R196ILTERGYSFTTTAER
R206GYSFTTTAEREIVR
R210REIVRDIK
R254SYELPDGQVITIGNERFR
R256FRCPEALFQPSFLGMESCGIHETTFNSIMKR256
R312DLYANTVLSGGTTMYPGIADRMQK
R372QEYDESGPSIVHRK
PF4 (2)R51TTSQVRPRR51
R80AGPHCPTAQLIATLKNGR*KR80

Citrullination sites present in TSP-1, β-actin, and PF4 by PAD4 catalysis.

a

red color indicates citrullinated arginine residue.

We then investigated whether citrullinated TSP-1, β-actin, and PF4 could serve as autoantigens in RA. The reactivity of RA serum with native and citrullinated forms of TSP-1, β-actin, and PF4 was assessed by ELISA. RA serum showed a low reactivity towards native forms of TSP-1, β-actin, and PF4, similar to healthy controls (Figures 3A–C). In comparison, an increased frequency of RA sera showed reactivity to citrullinated forms of TSP-1 (37.5%), β-actin (30.0%), and PF4 (22.5%) (Figures 3A–C), while the control serum had no such increased reactivity. As expected, the majority of the citrullinated TSP-1, β-actin, and PF4 positive RA cases were confined to the anti-CCP2+ RA group (Figure 3D).

Figure 3

3.5 Autoantibodies ACPA bind to citrullinated platelet proteins and enhance the activation of platelets.

Since citrullinated proteins are present in the human platelets, we hypothesized that autoantibodies ACPA in RA patients may react to the citrullinated platelet proteins and interact with the activation of platelets. To investigate the ACPA reactivity, we used RA plasma and SF having a high titer of anti-CCP2 antibodies (> 500 AU/ml) in the stimulation experiments. A higher basal activation status was detected in platelets from high anti-CCP2+ RA patients, as indicated by an increased expression of P-selectin (RA patients 7.94 ± 1.25% vs control 1.86 ± 0.82; p < 0.05) (Figure 4A). Upon stimulation, both the serum and SF from high anti-CCP2+ RA patients have potently induced platelets collected from healthy and RA patients, when compared to the healthy serum or OA SF, and also increased the production of sCD40L (Figures 4B, C). We further purified the ACPA from RA patients’ SF and serum samples. Pooled ACPA samples have significantly increased the expression of both P-selectin and the production of sCD40L in the healthy and RA neutrophils, when compared to control IgG or IgG from OA SF (Figure 4D). These observations demonstrate ACPA reactivity to the citrullinated proteins present in the platelets and their subsequent activation of platelets.

Figure 4

4 Discussion

In this study for the first time, we have demonstrated the expression of PAD4 enzyme and citrullinated proteins present within the human platelets and PDPs. In addition, we also found platelet activation mediated by ACPA from RA patients. In RA, platelet aggregates are often observed in the blood and the joint, microparticles releasing as consequence of platelet activation accumulate in the joints of patients. While the mechanistic events that lead to platelet activation in RA have not been extensively characterised. We hypothesized that citrullinated proteins from platelet and PDP may play prominence role in stimulating platelet activation in RA. Here we shown that plenty of citrullinated protein present in platelets and PDPs can be recognized by autoantibodies ACPA. and ACPA can stimulate platelet activation lead to releasing active inflammatory molecules and citrullinated autoantigens that may sustain inflammatory responses in RA joint (Figure 5).

Figure 5

The most noticeable finding is the unique expression of PAD4 in platelets both at mRNA and protein levels, which citrullinated platelet proteins/peptides. Recently, PAD4 was identified to be inextricably associated with RA than other PAD isoforms. PAD4 enzymes have been founded in the rheumatoid synovial tissue and fluid (37, 38). In addition, PAD4 gene and certain SNPs were detected within a susceptibility locus associated with RA (39). PAD4 is unique because only this PAD isoform contains a canonical nuclear localization signal (NLS) found predominantly in the nucleus (40). Many in vitro experiments demonstrated that both PAD4 and PAD2 isoforms are efficient in generating citrullinated target sites for autoantibodies ACPA, while ACPA preferentially bind to histone H3 and fibrinogen citrullinated by PAD4 than PAD2 (41, 42).

Our data uncovered a list of previously unreported citrullinated proteins present in the platelets and PDPs. We also identified citrullinated forms of fibrinogen α/β, α-enolase, β-actin, and α/β-tubulin, which are all well-known ACPA auto-antigens in the platelets and PDPs (, 41, 43). In addition, our MS data uncovered a list of citrullinated proteins including numerous cytoskeletal and cell-motility proteins such as myosin-9, caveolae-associated protein 2, tubulin, and actin. Platelets are highly specialized cells and their activation involves a series of rapid rearrangements in the cytoskeleton. In this context, we hypothesized that the citrullination may modify the protein’s functional properties regulating their actin dynamics, similar to the functions of other PTMs present in the actin cytoskeleton like acetylation, phosphorylation, tyrosination and polyglutamylation (, , 44). Furthermore, upon stimulation by various dysregulated molecules in the synovium and circulation, platelet could quick release immunostimulatory microparticals and intracellular citrullinated proteins in their environment, the exposed citrullinated proteins recognition by ACPA leading to formation of inflammatory immune complexes. Thus, activated platelet, immunostimulatory microparticals, and inflammatory immune complexes perpetuate pathogenic mechanisms in RA disease (Figure 5).

Intriguingly, we detected citrullination on some cytokines in PDPs, such as PF-4 and TGFβ-1. Previous studies have found that citrullination of cytokines could regulate their biochemical functions. For example, citrullinated chemokines CXCL10, CXCL11, CXCL8 and CXCL12 have reduced chemoattracting capacity, and their ability to signal through the chemokine receptors (4547). Thus, it is important to underscore that the citrullination process should no longer be considered as a rare modification, because a large number of citrullinated proteins are being identified in RA (, , ) and in many other diseases as well. Our proteomic analysis of platelets and PDPs has shown the presence of abundant citrullinated proteins/peptides that overlap with ACPA autoantigens. Citrullination of proteins, even among the important targets of autoantibodies ACPA, is a physiological event, not specific for RA, although the production of ACPA is more specific for RA.

Citrullination of TSP-1, β-actin, and PF4 led to exposure of epitopes recognized by ACPA may facilitate our understanding of the role of ACPA in RA development by providing evidences for previous observations involving platelet activation by ACPA in RA (), the elevated levels of PDPs associated with disease activity (, 48), and possibly the increased risk of cardiovascular events observed in RA patients (49). Although ACPA and tested platelet used in this study are non-paired sample, we speculate in matched samples, ACPA could reactive with self-generation platelet derived citrullination protein and lead to self-platelet activation, since both citrullinated protein and ACPA are heterogeneity, PTM as citrullinated modification could break of autoreactive B cell tolerance (50).

This study is the first comprehensive description of the platelet citrullination and expands our understanding of the scope of citrullination in platelets. We propose PAD4 enzyme could be responsible for eliciting protein citrullination in human platelets and thus suitable as a target protein for future drug development. In addition, our results may help for better understanding of the origin and consequences of citrullination processes as well as the citrullination-associated autoimmune mechanisms involved in RA.

Statements

Data availability statement

The mass spectrometry proteomics data was deposited in the ProteomeXchange with a dataset identifier PXD037743.

Ethics statement

The study was approved by the local ethics committee of Union Hospital, Tongji Medical College (No. [2020] IEC-J(130)). The patients/participants provided their written informed consent to participate in this study.

Author contributions

All authors were involved in drafting the article or revising it critically for important intellectual content, and all authors approved the final version to be published. HG had full access to all of the data in the study and take responsibility for the integrity of the data and the accuracy of the data analysis. All authors contributed to the article and approved the submitted version.

Funding

This work was supported by the Natural Science Foundation of China (32170906), Fundamental Research Funds for the Central University of Central China Normal University (CCNU20TS02112), and the Swedish Research Council (2019-01209).

Conflict of interest

The authors declare that this research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

The reviewer SC declared a shared parent affiliation with the author RD at the time of review.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2023.1084283/full#supplementary-material

Abbreviations

ACPA, anti-citrullinated protein antibodies; RA, rheumatoid arthritis; OA, osteoarthritis; SF, synovial fluid; Cit, citrullination; ELISA, enzyme-linked immunosorbent assay; FASP, filter-aided sample preparation protocol; MHC, Major histocompatibility complex; PAD, peptidylarginine deiminase; PDP, platelet derived microparticles; PTM, post-translational modification; TSP-1, thrombospondin-1; β-actin, beta actin; PF4, platelet factor 4.

References

  • 1

    SchellekensGADe JongBAVan Den HoogenFHVan De PutteLBVan VenrooijWJ. Citrulline is an essential constituent of antigenic determinants recognized by rheumatoid arthritis-specific autoantibodies. J Clin Invest (1998) 101:273–81. doi: 10.1172/JCI1316

  • 2

    HillJABellDABrintnellWYueDWehrliBJevnikarAMet al. Arthritis induced by posttranslationally modified (citrullinated) fibrinogen in DR4-IE transgenic mice. J Exp Med (2008) 205:967–79. doi: 10.1084/jem.20072051

  • 3

    TrouwLARispensTToesREM. Beyond citrullination: Other post-translational protein modifications in rheumatoid arthritis. Nat Rev Rheumatol (2017) 13:331–9. doi: 10.1038/nrrheum.2017.15

  • 4

    GeCHolmdahlR. The structure, specificity and function of anti-citrullinated protein antibodies. Nat Rev Rheumatol (2019) 15:503–8. doi: 10.1038/s41584-019-0244-4

  • 5

    Rantapää-DahlqvistSDe JongBABerglinEHallmansGWadellGStenlundHet al. Antibodies against cyclic citrullinated peptide and IgA rheumatoid factor predict the development of rheumatoid arthritis. Arthritis Rheum (2003) 48:2741–9. doi: 10.1002/art.11223

  • 6

    JohanssonLPratesiFBrinkMÄrlestigLD'amatoCBartaloniDet al. Antibodies directed against endogenous and exogenous citrullinated antigens pre-date the onset of rheumatoid arthritis. Arthritis Res Ther (2016) 18:127. doi: 10.1186/s13075-016-1031-0

  • 7

    van der WoudeDRantapää-DahlqvistSIoan-FacsinayAOnnekinkCSchwarteCMVerpoortKNet al. Epitope spreading of the anti-citrullinated protein antibody response occurs before disease onset and is associated with the disease course of early arthritis. Ann Rheum Dis (2010) 69:1554–61. doi: 10.1136/ard.2009.124537

  • 8

    van BeersJJSchwarteCMStammen-VogelzangsJOosterinkEBožičBPruijnGJ. The rheumatoid arthritis synovial fluid citrullinome reveals novel citrullinated epitopes in apolipoprotein e, myeloid nuclear differentiation antigen, and β-actin. Arthritis Rheum (2013) 65:6980. doi: 10.1002/art.37720

  • 9

    HaagSSchneiderNMasonDETuncelJAnderssonIEPetersECet al. Identification of new citrulline-specific autoantibodies, which bind to human arthritic cartilage, by mass spectrometric analysis of citrullinated type II collagen. Arthritis Rheumatol (2014) 66:1440–9. doi: 10.1002/art.38383

  • 10

    YtterbergAJJoshuaVReynisdottirGTarasovaNKRutishauserDOssipovaEet al. Shared immunological targets in the lungs and joints of patients with rheumatoid arthritis: identification and validation. Ann Rheum Dis (2015) 74:1772–7. doi: 10.1136/annrheumdis-2013-204912

  • 11

    TutturenAEFleckensteinBDe SouzaGA. Assessing the citrullinome in rheumatoid arthritis synovial fluid with and without enrichment of citrullinated peptides. J Proteome Res (2014) 13:2867–73. doi: 10.1021/pr500030x

  • 12

    SpenglerJLugonjaBYtterbergAJZubarevRACreeseAJPearsonMJet al. Release of active peptidyl arginine deiminases by neutrophils can explain production of extracellular citrullinated autoantigens in rheumatoid arthritis synovial fluid. Arthritis Rheumatol (2015) 67:3135–45. doi: 10.1002/art.39313

  • 13

    MaouiaARebetzJKapurRSempleJW. The immune nature of platelets revisited. Transfus Med Rev (2020) 34:209–20. doi: 10.1016/j.tmrv.2020.09.005

  • 14

    GaertnerFAhmadZRosenbergerGFanSNicolaiLBuschBet al. Migrating platelets are mechano-scavengers that collect and bundle bacteria. Cell (2017) 171:13681382.e1323. doi: 10.1016/j.cell.2017.11.001

  • 15

    BanerjeeMHuangYJoshiSPopaGJMendenhallMDWangQJet al. Platelets endocytose viral particles and are activated via TLR (Toll-like receptor) signaling. Arterioscler Thromb Vasc Biol (2020) 40:1635–50. doi: 10.1161/ATVBAHA.120.314180

  • 16

    BoilardENigrovicPALarabeeKWattsGFCoblynJSWeinblattMEet al. Platelets amplify inflammation in arthritis via collagen-dependent microparticle production. Science (2010) 327:580–3. doi: 10.1126/science.1181928

  • 17

    CloutierNTanSBoudreauLHCrambCSubbaiahRLaheyLet al. The exposure of autoantigens by microparticles underlies the formation of potent inflammatory components: The microparticle-associated immune complexes. EMBO Mol Med (2013) 5:235–49. doi: 10.1002/emmm.201201846

  • 18

    CloutierNParéAFarndaleRWSchumacherHRNigrovicPALacroixSet al. Platelets can enhance vascular permeability. Blood (2012) 120:1334–43. doi: 10.1182/blood-2012-02-413047

  • 19

    MottPJLazarusAH. CD44 antibodies and immune thrombocytopenia in the amelioration of murine inflammatory arthritis. PloS One (2013) 8:e65805. doi: 10.1371/journal.pone.0065805

  • 20

    HabetsKLTrouwLALevarhtEWKorporaalSJHabetsPADe GrootPet al. Anti-citrullinated protein antibodies contribute to platelet activation in rheumatoid arthritis. Arthritis Res Ther (2015) 17:209. doi: 10.1186/s13075-015-0665-7

  • 21

    SadoulKWangJDiagouragaBVitteALBuchouTRossiniTet al. HDAC6 controls the kinetics of platelet activation. Blood (2012) 120:4215–8. doi: 10.1182/blood-2012-05-428011

  • 22

    AslanJERiggRANowakMSLorenCPBaker-GrobergSMPangJet al. Lysine acetyltransfer supports platelet function. J Thromb Haemost (2015) 13:1908–17. doi: 10.1111/jth.13070

  • 23

    LianLSuzukiAHayesVSahaSHanXXuTet al. Loss of ATE1-mediated arginylation leads to impaired platelet myosin phosphorylation, clot retraction, and in vivo thrombosis formation. Haematologica (2014) 99:554–60. doi: 10.3324/haematol.2013.093047

  • 24

    DowalLYangWFreemanMRSteenHFlaumenhaftR. Proteomic analysis of palmitoylated platelet proteins. Blood (2011) 118:e62–73. doi: 10.1182/blood-2011-05-353078

  • 25

    RocheleauADMelroseARCunliffeJMKlimekJBaburÖTassi YungaSet al. Identification, quantification, and system analysis of protein n-ϵ lysine methylation in anucleate blood platelets. Proteomics (2019) 19:e1900001. doi: 10.1002/pmic.201900001

  • 26

    ArnettFCEdworthySMBlochDAMcshaneDJFriesJFCooperNSet al. The American rheumatism association 1987 revised criteria for the classification of rheumatoid arthritis. Arthritis Rheum (1988) 31:315–24. doi: 10.1002/art.1780310302

  • 27

    SuYLWangBHuMDCuiZWWanJBaiHet al. Site-specific n-glycan characterization of grass carp serum IgM. Front Immunol (2018) 9:2645. doi: 10.3389/fimmu.2018.02645

  • 28

    WiśniewskiJRZougmanANagarajNMannM. Universal sample preparation method for proteome analysis. Nat Methods (2009) 6:359–62. doi: 10.1038/nmeth.1322

  • 29

    TyanovaSTemuTCoxJ. The MaxQuant computational platform for mass spectrometry-based shotgun proteomics. Nat Protoc (2016) 11:2301–19. doi: 10.1038/nprot.2016.136

  • 30

    LeeCYWangDWilhelmMZolgDPSchmidtTSchnatbaumKet al. Mining the human tissue proteome for protein citrullination. Mol Cell Proteomics (2018) 17:1378–91. doi: 10.1074/mcp.RA118.000696

  • 31

    MauraisAJSalingerAJTobinMShafferSAWeerapanaEThompsonPR. A streamlined data analysis pipeline for the identification of sites of citrullination. Biochemistry (2021) 60:2902–14. doi: 10.1021/acs.biochem.1c00369

  • 32

    MondalSThompsonPR. Protein arginine deiminases (PADs): Biochemistry and chemical biology of protein citrullination. Acc Chem Res (2019) 52:818–32. doi: 10.1021/acs.accounts.9b00024

  • 33

    Fert-BoberJGilesJTHolewinskiRJKirkJAUhrigshardtHCrowgeyELet al. Citrullination of myofilament proteins in heart failure. Cardiovasc Res (2015) 108:232–42. doi: 10.1093/cvr/cvv185

  • 34

    BennikeTBEllingsenTGlerupHBonderupOKCarlsenTGMeyerMKet al. Proteome analysis of rheumatoid arthritis gut mucosa. J Proteome Res (2017) 16:346–54. doi: 10.1021/acs.jproteome.6b00598

  • 35

    FaigleWCrucianiCWolskiWRoschitzkiBPuthenparampilMTomas-OjerPet al. Brain citrullination patterns and T cell reactivity of cerebrospinal fluid-derived CD4(+) T cells in multiple sclerosis. Front Immunol (2019) 10:540. doi: 10.3389/fimmu.2019.00540

  • 36

    DarrahERosenAGilesJTAndradeF. Peptidylarginine deiminase 2, 3 and 4 have distinct specificities against cellular substrates: novel insights into autoantigen selection in rheumatoid arthritis. Ann Rheum Dis (2012) 71:92–8. doi: 10.1136/ard.2011.151712

  • 37

    ChangXYamadaRSuzukiASawadaTYoshinoSTokuhiroSet al. Localization of peptidylarginine deiminase 4 (PADI4) and citrullinated protein in synovial tissue of rheumatoid arthritis. Rheumatol (Oxford) (2005) 44:4050. doi: 10.1093/rheumatology/keh414

  • 38

    KinlochALundbergKWaitRWegnerNLimNHZendmanAJet al. Synovial fluid is a site of citrullination of autoantigens in inflammatory arthritis. Arthritis Rheum (2008) 58:2287–95. doi: 10.1002/art.23618

  • 39

    SuzukiAYamadaRChangXTokuhiroSSawadaTSuzukiMet al. Functional haplotypes of PADI4, encoding citrullinating enzyme peptidylarginine deiminase 4, are associated with rheumatoid arthritis. Nat Genet (2003) 34:395402. doi: 10.1038/ng1206

  • 40

    NakashimaKHagiwaraTYamadaM. Nuclear localization of peptidylarginine deiminase V and histone deimination in granulocytes. J Biol Chem (2002) 277:49562–8. doi: 10.1074/jbc.M208795200

  • 41

    BlachèreNEParveenSFrankMODillBDMolinaHOrangeDE. High-titer rheumatoid arthritis antibodies preferentially bind fibrinogen citrullinated by peptidylarginine deiminase 4. Arthritis Rheumatol (2017) 69:986–95. doi: 10.1002/art.40035

  • 42

    DamgaardDBawadekarMSenoltLStensballeAShelefMANielsenCH. Relative efficiencies of peptidylarginine deiminase 2 and 4 in generating target sites for anti-citrullinated protein antibodies in fibrinogen, alpha-enolase and histone H3. PloS One (2018) 13:e0203214. doi: 10.1371/journal.pone.0203214

  • 43

    KinlochATatzerVWaitRPestonDLundbergKDonatienPet al. Identification of citrullinated alpha-enolase as a candidate autoantigen in rheumatoid arthritis. Arthritis Res Ther (2005) 7:R1421–1429. doi: 10.1186/ar1845

  • 44

    ShevchukOBegonjaAJGambaryanSTotzeckMRassafTHuberTBet al. Proteomics: A tool to study platelet function. Int J Mol Sci (2021) 22(9):4776. doi: 10.3390/ijms22094776

  • 45

    LoosTMortierAGouwyMRonsseIPutWLenaertsJPet al. Citrullination of CXCL10 and CXCL11 by peptidylarginine deiminase: A naturally occurring posttranslational modification of chemokines and new dimension of immunoregulation. Blood (2008) 112:2648–56. doi: 10.1182/blood-2008-04-149039

  • 46

    ProostPLoosTMortierASchutyserEGouwyMNoppenSet al. Citrullination of CXCL8 by peptidylarginine deiminase alters receptor usage, prevents proteolysis, and dampens tissue inflammation. J Exp Med (2008) 205:2085–97. doi: 10.1084/jem.20080305

  • 47

    StruyfSNoppenSLoosTMortierAGouwyMVerbekeHet al. Citrullination of CXCL12 differentially reduces CXCR4 and CXCR7 binding with loss of inflammatory and anti-HIV-1 activity via CXCR4. J Immunol (2009) 182:666–74. doi: 10.4049/jimmunol.182.1.666

  • 48

    Knijff-DutmerEAKoertsJNieuwlandRKalsbeek-BatenburgEMVan De LaarMA. Elevated levels of platelet microparticles are associated with disease activity in rheumatoid arthritis. Arthritis Rheum (2002) 46:1498–503. doi: 10.1002/art.10312

  • 49

    Avina-ZubietaJAThomasJSadatsafaviMLehmanAJLacailleD. Risk of incident cardiovascular events in patients with rheumatoid arthritis: A meta-analysis of observational studies. Ann Rheum Dis (2012) 71:1524–9. doi: 10.1136/annrheumdis-2011-200726

  • 50

    DekkersJSVerheulMKStoopJNLiuBIoan-FacsinayAVan VeelenPAet al. Breach of autoreactive b cell tolerance by post-translationally modified proteins. Ann Rheum Dis (2017) 76:1449–57. doi: 10.1136/annrheumdis-2016-210772

Summary

Keywords

rheumatoid arthritis, citrullination, platelets, anti-citrullinated protein antibodies (ACPA), platelet derived microparticles (PDP)

Citation

Xu M, Du R, Xing W, Chen X, Wan J, Wang S, Xiong L, Nandakumar KS, Holmdahl R and Geng H (2023) Platelets derived citrullinated proteins and microparticles are potential autoantibodies ACPA targets in RA patients. Front. Immunol. 14:1084283. doi: 10.3389/fimmu.2023.1084283

Received

30 October 2022

Accepted

12 January 2023

Published

24 January 2023

Volume

14 - 2023

Edited by

Gerald Nabozny, Boehringer Ingelheim (United States), United States

Reviewed by

Meera Ramanujam, Aro biotherapeutics, United States; Shaozhe Cai, Huazhong University of Science and Technology, China

Updates

Copyright

*Correspondence: Hui Geng,

†These authors share first authorship

This article was submitted to Autoimmune and Autoinflammatory Disorders : Autoimmune Disorders, a section of the journal Frontiers in Immunology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics