METHODS article

Front. Immunol., 06 April 2023

Sec. Vaccines and Molecular Therapeutics

Volume 14 - 2023 | https://doi.org/10.3389/fimmu.2023.1127896

Multiparametric flow cytometry to characterize vaccine-induced polyfunctional T cell responses and T cell/NK cell exhaustion and memory phenotypes in mouse immuno-oncology models

  • 1. The University of Queensland Frazer Institute, Woolloongabba, QLD, Australia

  • 2. Peter MacCallum Cancer Centre, Melbourne, VIC, Australia

  • 3. Clinical Research Division, Fred Hutchinson Cancer Research Center, Seattle, WA, United States

  • 4. TRI Flow Cytometry Suite, Translational Research Institute, Woolloongabba, QLD, Australia

  • 5. Sir Peter MacCallum Department of Oncology, The University of Melbourne, Melbourne, VIC, Australia

  • 6. Department of Microbiology and Immunology, The University of Melbourne, Melbourne, VIC, Australia

Article metrics

View details

4

Citations

6,5k

Views

2,4k

Downloads

Abstract

Suitable methods to assess in vivo immunogenicity and therapeutic efficacy of cancer vaccines in preclinical cancer models are critical to overcome current limitations of cancer vaccines and enhance the clinical applicability of this promising immunotherapeutic strategy. In particular, availability of methods allowing the characterization of T cell responses to endogenous tumor antigens is required to assess vaccine potency and improve the antigen formulation. Moreover, multiparametric assays to deeply characterize tumor-induced and therapy-induced immune modulation are relevant to design mechanism-based combination immunotherapies. Here we describe a versatile multiparametric flow cytometry method to assess the polyfunctionality of tumor antigen-specific CD4+ and CD8+ T cell responses based on their production of multiple cytokines after short-term ex vivo restimulation with relevant tumor epitopes of the most common mouse strains. We also report the development and application of two 21-color flow cytometry panels allowing a comprehensive characterization of T cell and natural killer cell exhaustion and memory phenotypes in mice with a particular focus on preclinical cancer models.

1 Introduction

Despite significant technological advances obtained in the last decade, only a very limited number of cancer vaccines progressed to phase III clinical trials (1). A thorough and in-depth characterization of feasibility, immunogenicity and therapeutic efficacy of cancer vaccines in suitable preclinical models remains critical to overcome current limitations and enhance the clinical applicability of this promising immunotherapeutic strategy. In particular, assays allowing a reliable characterization of T cell responses to endogenous tumor antigens in mouse models is required to assess vaccine potency and improve the antigen formulation. Moreover, multiparametric assays are required to comprehensively characterize the immune modulation and regulatory/immunosuppressive effects generated by the tumor itself or induced by the therapy to design mechanism-based combination immunotherapies.

Therapeutically effective cancer vaccines should generate strong tumor-specific immune responses that need to be evaluated by measuring adequate parameters to assess vaccine potency. In this respect, the mere enumeration of T cells recognizing the antigens targeted by the vaccine is not sufficient and should be implemented by a more appropriate qualitative characterization of the functional properties of vaccine-induced CD4+ and CD8+ T lymphocytes (2, 3). Therefore, assays able to assess the polyfunctionality of antigen-specific T cells are particularly relevant to optimize the antigen formulation of cancer vaccines and assess the strength and quality of the T cell responses induced in vivo in naïve or tumor bearing mice. Here we describe a versatile multiparametric flow cytometry method to assess the polyfunctionality of tumor antigen-specific CD4+ and CD8+ T cell responses based on their production of multiple cytokines after short-term ex vivo restimulation with relevant mouse tumor epitopes. The method can be useful to characterize the quality of T cell responses induced not only by the antigens targeted by the vaccine, but also by “universal” tumor associated antigens as a measure of therapy-induced epitope spreading.

The generation of strong tumor-specific T cell responses by cancer vaccines is often not sufficient to achieve satisfactory therapeutic responses. Indeed, the efficacy of cancer vaccines and other immunotherapies is hampered by systemic and local immune suppression, which subvert anti-tumor immune responses leading to dysfunctional and exhausted immune cells. T and NK cell function is dependent on the balance between activation/co-stimulation and the consequent upregulation of inhibitory signals triggered by numerous inhibitory immune checkpoint pathways (4). This complex landscape of regulatory molecules evolves dynamically over time and may be also heavily modulated by treatment, particularly immunotherapies. As such, profiling the expression of these regulatory molecules has become a major focus to inform therapeutic choices and identify novel therapeutic targets. Moreover, the assessment of preclinical tumor microenvironments and associated lymphoid organs (spleens and lymph nodes) for changes in expression of regulatory molecules is also required to identify possible evasion mechanisms and facilitate the rationale design of more effective combination therapies (5). Finally, the strength and duration of therapeutic responses induced by immunotherapy are closely dependent on the induction of strong and long-lasting memory immune responses (6). To be able to evaluate local and systemic immune modulation, we have developed two 21-color flow cytometry panels to comprehensively characterize T cell and natural killer (NK) cell exhaustion and memory phenotypes in mice with a particular focus on preclinical cancer models.

2 Methods

2.1 Cell lines and tissue cultures

Murine triple negative breast cancer 4T1.2 cells were kindly provided by Prof. B. Parker (Peter MacCallum Cancer Centre, Melbourne, Australia). Murine melanoma B16F10 cells were kindly provided by Prof. N. Haas, University of Queensland). Murine melanoma YUMM UV 1.7 UV cells (7) (generated by UV irradiating YUMM 1.7 cells) were kindly provided by Prof. B. Gabrielli (Mater Research, University of Queensland). Cells were grown at 37°C and 5% CO2 and passed using TrypLE Express when reaching 80% confluence. 4T1.2 and B16F10 cells were cultured in DMEM (Gibco) containing 10% FBS (Gibco), 2mM L-Glutamine (Gibco), 100IU/ml Penicillin (Gibco), 100µg/ml Streptomycin (Gibco) and 1mM Sodium Pyruvate (Gibco). YUMM UV 1.7 UV cells were cultured in DMEM/F12 (Gibco) containing 10% FBS (Gibco), 2mM L-Glutamine (Gibco), 100IU/ml Penicillin (Gibco), 100µg/ml Streptomycin (Gibco) and 1mM Sodium Pyruvate (Gibco).

2.2 Vaccine preparation

Tumor cell lysate preparation. Eighty percent confluent tumor cells from six T75 culture flasks were harvested, washed 3 times with PBS and resuspended in 0.5 mL sterile water and then subjected to 5 cycles of freeze and thaw in liquid nitrogen. Lysates were centrifuged at 10,000 rpm for 20 min at 4°C and the recovered supernatant quantified for protein concentration using a NanoDropTM 2000 spectrophotometer and diluted to 5 mg/mL in water. Aliquots of 200 µL of lysates were converted to powder by snap-freezing in liquid nitrogen followed by overnight lyophilization (0.05 mbar, -80°C) and stored at -80°C. Lysate powder was dissolved in 1 mL ultrapure water to a final protein concentration of 1mg/mL. The tumor cell lysate solution (0.4 mL) was added to 0.8 mL of CithrolTM GMO HP solution into a 1.5 mL vial and mixed with a sonicator (Branson Sonifier® S-450A, Danbury, United State) for 1 min at 20 W to form stable water in oil (w/o) emulsion. CithrolTM GMO HP solution (1%, w/v) was prepared by dissolving CithrolTM GMO HP (gift from Croda Europe Ltd) in Hexane (Sigma). The resulting emulsion was frozen in dry ice for 2 h before being lyophilized for 24 h. The lyophilized lysate-Cithrol GMO HP pellet was dissolved in Miglyol 812 (10 µL; (gift from Cremer Oleo GmbH & Co. KG) to 5mg/ml and used as oil phase for preparing Clec9A-targeting Tailored NanoEmusions (TNE) loaded with tumor cell lysate as antigen formulation (Lysate-Clec9A-TNE) as described in Zeng et al. (8) and below.

Preparation of Clec9A-targeting Tailored NanoEmusions (TNE) loaded with tumor cell lysate. 490 µL of AM1 (400 µM; GL Biochem, China) was added to 10 μL of lysate loaded Miglyol 812 to give an oil volume fraction of 2% (v/v). The mixture was homogenized using a Branson Sonifier 450A ultrasonicator for four 45 s bursts at 60 W. The resulting oil-in-water (O/W) emulsion was coated with PEG (200 µM; Nanocs, US) and the mouse Clec9A targeting WH peptide fused to anchor peptide DAMP4 (3 µM) by gentle mixing for 60 min at room temperature. Clec9A-TNEs loaded with B16F10 immunogenic neoepitopes were prepared as described (8).

2.3 Mouse studies

All animal experiments were approved by the University of Queensland Animal Ethics Committee (approval number UQDI/252/16). Mice were obtained from the Animal Resources Centre (Perth, WA, Australia).

Murine triple negative breast cancer model. Eight to ten-week-old female Balb/c mice were injected with 0.5×106 4T1.2 cells (50 µl) orthotopically in the 3rd shaved mammary fat pad. Three days after tumor injection, mice were injected i.v. with 100 μL Clec9a-TNE loaded with the 4T1.2 lysate (Clec9A-TNE-lysate). At the indicated times tumors and/or draining lymph nodes were collected and processed as described below.

Murine B16F10 melanoma model. Eight to ten-week-old female C57BL/6 mice were injected with 0.25×106 B16F10 cells (50 µl) subcutaneously in the shaved right back flank. Ten days after tumor injection, mice were injected i.v. with 100μL Clec9a-TNE loaded with a pool of functionally validated, immunogenic B16F10 neo-epitopes (25 μg) (8). Mice without treatment were included as controls (NT CTRL). Tumor growth was measured two to three times per week using calliper. Tumor volume was measured using an electronic caliper and calculated using the following formula: (m1)2 X m2 X 0.5236 – where m1 stand for the small tumor diameter, and m2 for the long one. Spleens were collected at the indicated times for processing as described below.

Murine YUMM UV 1.7 melanoma model. Tumor-bearing mice were generated by injecting 2x106 melanoma cells (50µl) subcutaneously into C57BL/6 mice. Tumors, spleens and draining lymph nodes were collected at the indicated times for processing as described below.

The YUMM UV 1.7 and 4T1.2 mouse models were used to set up and optimize the two multiparametric flow cytometry panels. The 4T1.2 and B16F10 models were used for the polyfunctional assay on blood.

2.4 Polyfunctional T cell assay

Ex vivo restimulation with tumor specific peptides. Blood from tumour-bearing mice was collected into EDTA treated tubes and red blood cells were lysed by adding ACK (Ammonium-Chloride-Potassium) buffer after centrifugation and removal of supernatant and incubating for 5 min on ice. ACK buffer was prepared according to the Cold Spring Harbor Protocol: 150 mM NH4Cl, 10 mM KHCO3, 0.1 mM Na2EDTA. After washing with complete RPMI medium (Gibco), white blood cells were plated in complete RPMI medium (10% FBS, 2mM L-Glutamine, 100IU/ml Penicillin, 100µg/ml Streptomycin and 1mM Sodium Pyruvate) in round bottom 96-well plates at a density of 1x106 cells/well and ex vivo re-stimulated for 6 hours at 37°C with the antigens/epitopes listed in Table 1 (20 µg/mL in a total volume of 200 µL). Brefeldin A (Biolegend) was added after 1 hour to block cytokine release at a final concentration of 5 µg/ml.

Table 1

Mouse modelPool of peptidesEpitopeSequencePresenting MHC moleculeReference
C57Bl/6 mice bearing B16F10 melanomaneo-epitopesaMUT20 FRRKAFLHWYTGEAMDEMEFTEAESNMI-Ab, H-2Db, H-2KbZeng, (8)
MUT25STANYNTSHLNNDVWQIFENPVDWKEK
MUT30PSKPSFQEFVDWENVSPELNSTDQPFL
MUT33DSGSPFPAAVILRDALHMARGLKYLHQ
MUT36CGTAFFINFIAIYHHASRAIPFGTMVA
MUT44EFKHIKAFDRTFANNPGPMVVFATPGM
universal TAAsmSurvivin20-28ATFKNWPFLH-2DbLladser, (9)
mSurvivin53-67DLAQCFFCFKELEGWI-AbCiesielski, (10)
mTERT198-205VGRNFTNLH-2KbMennuni, (11)
Balb/c mice bearing 4T1.2autologous tumour cell lysateaCell lysate-derived epitopesN/AN/ADolcettib
universal TAAsmSurvivin85-93AFLTVKKQMH-2DdSiegel, (12)
mSurvivin53-67DLAQCFFCFKELEGWI-Ad, I-EdResults presented herein (Figure S2)
mTERT167-175AYQVCGSPLH-2KdMennuni, (11)

Tumor-specific epitope peptides for ex vivo restimulation of T cells.

a Included in the vaccine formulation.

b Unpublished data.

TAAs: tumor associated antigens.

Antibody staining for the detection of cytokine production. At the end of the re-stimulation the cells were washed with 200 µL PBS by discarding the supernatant after centrifugation for 5 minutes at 500 rcf at 4°C. Pellets were resuspended in 100 µL of FVS440UV (BD Biosciences) working solution (1:1000 in PBS) and incubated for 15 minutes at room temperature in the dark. Cells were washed twice with 200 µL of MACS buffer (2mM EDTA pH8.0, 0.5% BSA in PBS). After the last wash, the supernatant was tipped off and the pellets were resuspended in the 50 µL of residual supernatant that remained. Non-specific antibody binding was limited by adding 0.5 µL of anti-mouse CD16/32 (BioLegend) to samples for 10 minutes on ice. An antibody master mix (Table 2) was then added for 30 minutes on ice, in the dark and the cells were then washed twice with 100 µL of MACS buffer. Samples were fixed using the eBiosciences FoxP3 kit according to manufacturer’s instructions. Samples were then left in 50 µL of the permeabilization buffer containing 0.5 µL of anti-mouse CD16/32 overnight at 4°C, protected from light. Incubation with intracellular antibodies was performed in a final volume of 100 µL of permeabilization buffer at room temperature, protected from light, for 1 hour. Samples were then washed with 100 µL of permeabilization buffer. After centrifugation for 5 minutes at 500 rcf at 4°C, samples were resuspended in 200 µL of MACS buffer for same-day acquisition on a BD FACSymphony A5 Cell Analyzer. Cytokine co-expression profiles were quantified using the Boolean function of Flowjo™ software. Figure S1 describes the manual gating strategy carried out on blood cells (related to Figure 1)

Table 2

SpecificityFluorochromeCloneVendorDilution
Surface stainingCD3eAF488145-2C11Biolegend1/100
CD8APC/Cy753-6.7Biolegend1/100
CD4PE/Cy7RM4-4Biolegend1/100
Intracellular stainingTNFαAF647MP6-XT22Biolegend1/100
IFNγAF700XMG1.2Biolegend1/100
IL-2PEJES6-5H4Biolegend1/100

Flow cytometry antibodies used in the polyfunctional T cell assay.

Figure 1

2.5 Staining Protocol for Multiparametric Flow Cytometry Panels 1 & 2

Tissue processing. Tissues were harvested immediately prior to processing. Spleens were manually dissociated and contaminating red blood cells were lysed with ACK buffer (150 mM NH4Cl, 10 mM KHCO3, 0.1 mM Na2EDTA). Peripheral lymph nodes and YUMM UV 1.7 tumors were manually dissociated. All samples were filtered with a 70 µM filter prior to processing for antibody staining. A viable cell count was performed, and 2 x 106 cells were aliquoted into 1.5 mL polystyrene FACS tubes. Cells were washed with 600 µL PBS by discarding the supernatant after centrifugation for 5 minutes at 500 rcf at 4°C.

Cell staining. Cell pellets were resuspended in 100 µL of FVS440UV working solution (1:100 in PBS) and incubated for 15 minutes at room temperature in the dark. Cells were washed twice with 600 µL of MACS buffer (2mM EDTA pH8.0, 0.5% BSA in PBS). After the last wash, the supernatant was tipped off and the pellets were resuspended in the 50 µL of residual supernatant that remained. Non-specific antibody binding was limited by adding 0.5 µL of anti-mouse CD16/32 (BioLegend) to samples for 10 minutes on ice. An antibody master mix (Table 3) containing 10 µL of Brilliant Stain Buffer Plus (BD Biosciences) in a volume 50 µL, was then added to samples in 50 µL of MACS buffer; to make a final staining volume of 100 µL. Samples were stained for 30 minutes, on ice, in the dark and then washed with 1 mL of MACS buffer. Samples were fixed using the eBiosciences FoxP3 kit according to manufacturer’s instructions. Samples were then left in 100 µL of the permeabilization buffer overnight at 4°C, protected from light. Incubation with intracellular antibodies (Table 3) was performed at room temperature, protected from light, for 1 hour. Samples were then washed with 1 mL of permeabilization buffer. After centrifugation for 5 minutes at 500 rcf at 4°C, samples were resuspended in 200 µL of MACS for same-day acquisition on a BD FACSymphony A5 Cell Analyzer (Tables 4, 5).

Table 3

PanelSpecificityCloneFluorochromeVendorTitrationPurpose
Shared Back boneCD4530-F11BUV563BD – 5657101/800Lineage
CD3145-2C11BUV737BD – 5646181/200Lineage
CD4GK1.5BUV496BD – 5646671/400Lineage
CD85.3-6.7BUV805BD – 5649201/400Lineage
FoxP3*FJK-16sPE-Cy5eBio – 15-5773-821/200Lineage
CD49bHMα2BV786BD – OptiBuild1/400Lineage
Amine-reactiveN/AFVS440UVBD – 5663321/1000Viability
CD44IM7APC-Cy7BD – 5605681/400Effector/memory
CD279 (PD-1)J43BUV395BD - OptiBuild1/100Inhibition
Granzyme B*QA16A02PE-Dazzle594BL – 3722161/400Activation
CD69H1.2F3BV480BD – OptiBuild1/100Activation
Markers specific for Panel 1CD226 (DNAM-1)TX42.1BV650BL – 1336211/200Activation
CD314 (NKG2D)CX5BV711BD – 5636941/200Activation
CD152 (CTLA-4)UC10-4F10-11APC-R700BD – 5657781/200Inhibition
CD366 (TIM-3)RMT3-23FITCeBio – 11-5870-821/400Inhibition
TIGIT1G9BV421BD – 5652701/200Inhibition
CD223 (LAG-3)C9B7WBV750BD – OptiBuild1/200Inhibition
VISTAMIH64PEBD – 5662701/200Inhibition
NKG2A/C/E20d5BV605BD – 5643821/200Inhibition
Eomes*Dan11magPE-Cy7eBio – 25-4875-821/200Differentiation
T-bet*4B10AF647BL – 6448041/400Differentiation
Markers specific for Panel 2CD62LMEL-14BB515BD – 5652611/400Effector/memory
CD1032-E7BV605BL – 1214331/100Differentiation
CD122TM-β1BB700BD – OptiBuild1/100Differentiation
CD127SB/199BV711BD – 5654901/100Differentiation
CD197 (CCR7)4B12BV650BD – 5643561/200Differentiation
CD25PC61APC-R700BD – 5651341/800Differentiation
Ki-67*B56PEBD – 5560271/400Proliferation
KLRG12F1BV421BD – 5628971/200Differentiation
NKp4629A1.4PE-Cy7BL – 1376181/200Differentiation
TCF-1*C63D9AF647CST – 6709S1/200Stemness

List of antibodies and relative fluorochromes used in Panels 1 & 2 .

*Intracellular staining.

APC, Allophycocyanin; AF, Alexa Fluor; BUV, Brilliant Ultraviolet; BV, Brilliant Violet; PE, Phycoerythrin.

Table 4

LaserOpticsChannelsMarkers
WavelengthPowerTypeLP FilterBP FilterNameFlourochromePanel 1
355 nm60 mWDPSSNone379/28UV_379/28BUV395CD279 (PD-1)
410450/50UV_450/50FVS440UVFVS440UV
450515/30UV_515/30BUV496CD4
550586/15UV_586/15BUV563CD45
600610/20UV_610/20
635670/30UV_670/30
690740/35UV_740/35BUV737CD3
770820/60UV_820/60BUV805CD8
406 nm250 mWDPSS410450/50V_450/50BV421TIGIT
505525/50V_525/50BV480CD69
550586/15V_586/15
600610/20V_610/20BV605NKG2A/C/E
635670/30V_670/30BV650CD226 (DNAM-1)
690710/50V_710/50BV711CD314 (NKG2D)
710740/35V_740/35BV750CD223 (LAG-3)
750780/60V_780/60BV786CD49b
488 nm150 mWDPSS505515/20B_515/20FITCCD366 (TIM-3)
600610/20B_610/20
635670/30B_670/30
690710/50B_710/50
750780/60B_780/60
None488/10SSCSSC
None488/10FSCFSC
561 nm150 mWDPSSNone586/15YG_586/15PEVISTA
600610/20YG_610/20PE-Dazzle594Granzyme B
635670/30YG_670/30PE-Cy5FoxP3
690710/50YG_710/50
750780/60YG_780/60PE-Cy7omes
637 nm140 mWDPSSNone670/30R_670/30AF647T-bet
690710/50R_710/50APC-R700CD152 (CTLA-4)
750780/60R_780/60APC-Cy7CD44

Instrument Configuration for Panel 1.

APC, Allophycocyanin; AF, Alexa Fluor; BUV, Brilliant Ultraviolet; BV, Brilliant Violet; PE, Phycoerythrin.

Table 5

LaserOpticsChannelsMarkers
WavelengthPowerTypeLP FilterBP FilterNameFluorchromePanel 2
355 nm60 mWDPSSNone379/28UV_379/28BUV395CD279 (PD-1)
410450/50UV_450/50FVS440UVFVS440UV
450515/30UV_515/30BUV496CD4
550586/15UV_586/15BUV563CD45
600610/20UV_610/20
635670/30UV_670/30
690740/35UV_740/35BUV737CD3
770820/60UV_820/60BUV805CD8
406 nm250 mWDPSS410450/50V_450/50BV421KLRG1
505525/50V_525/50BV480CD69
550586/15V_586/15
600610/20V_610/20BV605CD103
635670/30V_670/30BV650CD197
690710/50V_710/50BV711CD197 (CCR7)
710740/35V_740/35
750780/60V_780/60BV786CD49b
488 nm150 mWDPSS505515/20B_515/20BB515CD62L
600610/20B_610/20
635670/30B_670/30
690710/50B_710/50BB700CD122
750780/60B_780/60
None488/10SSCSSC
None488/10FSCFSC
561 nm150 mWDPSSNone586/15YG_586/15PEKi67
600610/20YG_610/20PE-Dazzle594Granzyme B
635670/30YG_670/30PE-Cy5FoxP3
690710/50YG_710/50
750780/60YG_780/60PE-Cy7NKp46
637 nm140 mWDPSSNone670/30R_670/30AF647TCF-1
690710/50R_710/50APC-R700CD25
750780/60R_780/60APC-Cy7CD44

Instrument Configuration for Panel 2.

3 Results and discussion

3.1 Assay to characterize polyfunctional T cell responses to mouse tumor antigens

Cancer vaccine-induced antigen-specific T cell responses can be functionally characterized by ex vivo restimulation of peripheral blood cells, splenocytes or isolated tumor infiltrating lymphocytes with the antigens targeted by the vaccine in the form of peptide epitopes or, less frequently, tumor cell lysates. The expression of IFNγ, TNFα and IL-2 by intracellular staining and flow cytometry analysis can be used as read out where polyfunctionality of antigen-specific CD4+ and CD8+ T cell responses is given by the extent of stimulated T cells expressing more than one cytokine. Additional functional markers can be also investigated such as CD137, CD107, as well as cytolytic molecules (perforin and granzyme B). Tumor cell lysates can be used for restimulation when no suitable tumor antigen is available. Figure 1A-E shows the results of a polyfunctional T cell assay carried out on blood cells isolated from Balb/c mice carrying a 4T1.2 triple negative breast cancer and vaccinated with Clec9a-TNE loaded with the 4T1.2 cell-lysate. Blood cells from controls and vaccinated mice were ex vivo restimulated with the tumor cell lysate used for the vaccination (Table 1). As presented in Figure 1C, vaccinated mice showed significantly higher percentages of CD8+ T cells expressing IFNγ, TNFα or both cytokines as evidence of polyfunctionality when compared with control mice. In vaccinated mice, the assay also revealed higher percentages of CD4+ T cells expressing IFNγ or IL-2 as single cytokines, whereas only a slight increase in CD4+ T cells expressing both cytokines was observed (Figure 1B). This data indicate that the lysate included in the vaccine generated only partial tumor-specific polyfunctional T cell responses, mainly involving CD8+ T cells. These results are consistent with the limited immunogenicity of tumor cell lysates, which need to be ex vivo manipulated to enhance their therapeutic efficacy (1).

The recent advances in genomics, trancriptomics and tumor epitope prediction allowed the use of neo-antigen epitopes identified in individual tumors to track and characterize neo-antigen specific T cell responses in cancer patients treated with personalized vaccines (1, 13, 14). Tumor neo-epitopes may be also available for some preclinical cancer models (14), allowing thus a more precise assessment of the quality of tumour-specific T cell responses induced in these models by a variety of experimental immunotherapeutic strategies. Figures 1G, H shows the results of polyfunctional responses of CD4+ and CD8+ T cells restimulated with the highly immunogenic B16F10 neo-epitopes (8) used to vaccinate tumor-bearing C57BL/6 mice (Figure 1F).

Although feasible (Figures 1B, C), the characterization of tumor-specific polyfunctional T cell responses in mice vaccinated with tumor cell lysates is hampered by the lack of knowledge of the immunogenic (neo-)antigens targeted by the vaccine. Although re-stimulation of T cells with the whole tumor cell lysate can be an option, this approach suffers from variability among cell lysate batches that may lead to inconsistent results. To obviate these limitations, we exploited epitopes of the “universal” TAAs telomerase and survivin, for which CD4 and CD8 immunogenic epitopes are available for both Balb/c and C57BL/6 mouse strains (Table 1). To complete the panel of suitable “universal” TAAs applicable in the most common preclinical models, we have validated the immunogenicity of the mSurvivin53-67 epitope so far applied in C57BL/6 cancer models also in the Balb/c mouse strain (Figure S2). Figures 1D, E reports the results of a polyfunctional T cell assay carried out on blood cells isolated from 4T1.2-bearing Balb/c mice vaccinated with an autologous tumour cell lysate, and ex vivo re-stimulated with telomerase and survivin epitopes. Higher percentages of CD4+ T cells expressing IL-2 and CD8+ T cells expressing IFNγ, IL-2, TNFα or the IFNγ/IL-2, and TNFα/IL-2 combinations (polyfunctionality) were observed in immunized mice. These epitopes can be also useful to identify and characterize epitope spreading in both C57BL/6 and Balb/c mice vaccinated with different antigenic formulations or treated with other immunotherapeutic strategies. As representative example of this application, Figures 1I, J reports the CD4+ and CD8+ T cell responses specific for telomerase and survivin detected in C57BL/6 mice bearing B16F10 melanoma and vaccinated with autologous tumor neo-epitopes.

3.2 Integrated multiparametric flow cytometry assays to immune profile mouse T and NK cells.

Two flow cytometry panels were designed to simultaneously allow the comprehensive characterization of NK and T cell exhaustion, activation, functionality, transcription factor profile, memory and differentiation states. When used in combination, these panels can provide a comprehensive overview of the functional status of T and NK cells in the tumor microenvironment and peripheral lymphoid organs in mice. Moreover, the two panels can also be used separately for focused investigation of activation/exhaustion (Panel 1) or memory phenotypes (Panel 2) in a variety of disease settings. The panels share a set of common hematopoietic and lineage markers as backbone (Table 3). In both panels, CD45 was included to identify hematopoietic cells in complex tissues, and this can be adapted to track transferred T cells based on their allotype (CD45.1/CD45.2) in adoptive cell transfer studies. Briefly, in both panels, CD45 and a live/dead marker are used to first gate live hematopoietic cells. FSC and SSC are then used to gate lymphocytes followed by doublet discrimination. Major T cell subsets are identified using CD3, CD4, CD8 and FoxP3, whereas NK cells are identified with CD49b (Figure 2 & Figure S3). The results presented were obtained in the YUMM 1.7 UV mouse melanoma model, which closely recapitulates the main genetic and immunologic features of human cutaneous melanoma (7).

Figure 2

3.3 Panel 1: Activation and exhaustion phenotypes

In addition to the backbone lineage markers, to address activation vs. exhaustion in T and NK cells, the evaluation of the transcription factors Eomesodermin (Eomes) and T-bet was incorporated in Panel 1 given their role in T and NK cell differentiation, activation and exhaustion (1517) (Figure 2A). To specifically assess activation, antigen experience, and cytolytic activity, CD44, CD69, NKG2D, DNAM-1 and Granzyme-B were included in Panel 1 (Figures 3A, B & Figure S4). Finally, a suite of inhibitory immune checkpoints (TIGIT, VISTA, TIM-3, CTLA-4, NKG2A, PD-1, LAG-3) were added to evaluate the exhaustion state of the different subpopulations during tumor progression and following treatments (Figures 3C, E & Figure S4)

Figure 3

3.3.1 NK cells

Within NK cells (Figure 2A, blue frame), the inhibitory receptors NKG2A, TIM-3, PD-1, LAG-3 and TIGIT together with the activating receptor NKG2D and DNAM-1 can be used to evaluate the effector function of CD3-CD49b+ NK cells. The balance between activating and inhibitory receptors determines whether NK cells will have cytolytic functions or contribute to a tolerogenic microenvironment (18). To investigate whether impaired effector functions are associated with reduced activation or cytolytic activity, the early activation and immune modulator CD69, as well as the cytolytic molecule Granzyme-B, can be assessed. The dysfunctional and exhausted phenotype of tumor-associated NK cells can additionally be investigated by analyzing the expression of Eomes and T-bet, T‐box transcription factors that drive the differentiation and function of cytotoxic lymphocytes and NK cells (15). In the context of tumor progression, upon adoptive transfer to tumor‐bearing mice, NK cells were shown to display a progressive decrease in the expression of both transcription factors and this correlated with a rapid loss of effector function including the ability to control metastasis development (19).

3.3.2 CD4+ T cells

Within CD4+ T cells, the two main regulatory T cell subsets, Tregs (Figure 2A, green frame) and type 1 regulatory T cells (TR1), can be identified based on FoxP3 and Eomes expression, respectively (19, 20) and distinguished from conventional CD4+ T cells (Figure 2A, red frame). CD44, a marker commonly used to assess activation in T cells, can also be employed to identify antigen-experienced T cells. CD44 expression is rapidly up-regulated after antigen encounter and is maintained in memory T cells. T-bet and Eomes were included to report on their expression profile in various CD4+ T-helper subsets. Eomes plays an important role in cytotoxic T lymphocytes where it promotes their development and survival via upregulation of CD122 (the β-chain of the IL‐15 receptor) and represses Th17‐type cytokine expression (15). Expression of T‐bet and Eomes is induced upon activation and differentiation. Moreover, T‐bet promotes Th1 cell differentiation and prevents the development of Th2 and Th17 helper cells. Recent studies have reported that both circulating and tumour-infiltrating Th1-like CD4+ T cells expressing T-bet display strong anti-tumour cytotoxic activities (21) (Figure 2A, red frame). However, TGFß-mediated conversion of anti-tumor T-bet+Th1 CD4+ T cells into immunosuppressive T-bet+Foxp3+ Tregs was recently described in mice bearing lung carcinoma (22). TIGIT, a co-inhibitory receptor, is highly expressed on Tregs that specifically inhibits Th1 and Th17 responses (2325), also known as induced Tregs (iTregs: Tbet+TIGIT+, Figure 2A, green frame).

3.3.3 CD8+ T cells

CD44, CD69 and Granzyme-B were included as classical markers to evaluate activation and cytolytic activity of CD8+ T cells (Figure 2A, frame orange), with DNAM-1 and NKG2D included to provide further information on the activation status of the CD8+ T cell compartment. Additionally, NKG2D can work as a co-stimulatory molecule in antigen-experienced T cells (26). DNAM-1 acts as a co-stimulatory factor in CD8+ cytotoxic T lymphocytes and is down-regulated in dysfunctional tumor-infiltrating CD8+ T cells (27, 28). The two transcription factors T-bet and Eomes were used to further evaluate the differentiation status of CD8+ T cells. Indeed, high T-bet expression has been associated with an effector phenotype, and high expression of Eomes with a memory phenotype (29, 30). Finally, various immune checkpoints (TIGIT, VISTA, TIM-3, CTLA-4, NKG2A, PD-1, LAG-3) were included to delineate activation vs. exhaustion, and to aid in the identification of dysfunctional CD8+ T cells in the tumor microenvironment. Of note, the co-expression of immune checkpoints with DNAM-1 on CD8+ T cells, particularly in hematological malignancies, is indicative of activation rather than exhaustion (28, 30). DNAM-1 and TIGIT share the same ligands (CD155 and CD112), however, they have opposing functions (activation vs. suppression, respectively) in tumor infiltrating CD8+ T cells (27).

3.3.4 T cell exhaustion signatures

T cell exhaustion signatures may vary between different tumor types. However, they are almost invariably associated with co-expression of several classical immune checkpoint molecules such as PD-1, CTLA-4, TIM-3, LAG-3 and TIGIT. Indeed, high PD-1 expression levels on effector memory T cells can signal either activation or exhaustion depending on the level and repertoire of additional checkpoint molecules expressed (31). It is the progressive upregulation of these additional inhibitors, and loss of co-stimulatory molecules, that determines the hierarchical loss of effector functions and acquisition of dysfunctional/exhausted phenotypes (Figure 3C-G).

3.3.5 LAG-3

LAG-3 is upregulated on activated CD4+ and CD8+ T cells, as well as on a subset of NK cells. Importantly, LAG-3 and PD-1 are frequently co-expressed on both CD4+ and CD8+ tumor infiltrating lymphocytes (TILs) and their co-blockade has been shown to synergize to improve anti-tumor responses in several pre-clinical murine cancer models (32). LAG-3 is highly expressed in Treg cells and its blockade abrogates Treg cell suppressor functions (33). LAG-3 is also expressed on type 1 regulatory (Tr1) T cells, identified in both humans and mice as FoxP3negLAG-3+CD49b+ CD4+ T cells (32).

3.3.6 TIM-3

TIM-3 is a negative regulator of type 1 immunity expressed on IFN-γ-producing CD4+ Th1 helper cells, CD8+ cytotoxic T cells, Tregs cells as well as on innate immune cells (dendritic cells, NK cells, monocytes). In these cell types, TIM-3 inhibits immune responses and promotes tolerance (34). Tumor infiltrating CD8+ T cells co-expressing TIM-3 and PD-1 can exhibit a severely dysfunctional or exhausted phenotype and TIM-3 and PD-1 co-blockade is more effective than PD-1 blockade alone in improving anti-tumor immune effector functions in preclinical models of both solid and hematologic cancer (32). TIM-3 also regulates the function of FoxP3+ Treg cells and TIM-3+ Tregs display higher expression of known Treg effector molecules such as IL-10, Granzymes, and perforin. In the context of cancer, high level of TIM-3 on NK cells is associated with a dysfunctional and exhausted phenotype and TIM-3 blockade restores NK cell functions (32).

3.3.7 TIGIT

TIGIT is highly expressed on human and murine TILs in several tumor types. It is often co-expressed with PD-1, TIM-3, and LAG-3 whose co-expression in the absence of co-stimulatory molecules can identify the most dysfunctional CD8+ TILs (24, 27). TIGIT ligands CD155 and CD112 are widely expressed on tumor cells. DNAM-1 (CD226), the agonistic signal of this co-stimulatory pathway, promotes cytotoxicity and enhances anti-tumor responses. In contrast, TIGIT negatively regulates anti-tumor responses, but with a specialized role in the tumor tissue as it is not expressed in peripheral lymphoid organs (34). Of note, TIGIT also promotes the immunosuppressive activity of tumor tissue Treg cells (34, 35). Therefore, targeting TIGIT with monoclonal antibodies may not only enhance effector T cell function, but also suppresses TIGIT cell-mediated immunosuppression (27, 36).

3.3.8 VISTA

VISTA is predominantly expressed in hematopoietic cells with the highest level of expression observed in myeloid cells, particularly microglia and neutrophils, followed by monocytes, macrophages, and dendritic cells. VISTA is also highly expressed on naïve CD4+ and CD8+ T cells, as well as Foxp3+ Treg cells. While most immune checkpoint modulators fine-tune T cell response and fate after activation, VISTA was recently shown to regulate naïve T cell quiescence and peripheral T cell tolerance (37). VISTA is also emerging as a novel targetable immune checkpoint in oncology and its altered expression has been prognostically implicated in different types of cancer (38).

3.3.9 NKG2A

NKG2A is an inhibitory member of the NKG2 family, it dimerizes with CD94 on the cell surface and its major ligand is the non-classical MHC class I molecule HLA-E. NKG2A is expressed on NK cells, natural killer T (NKT) cells and a subset of CD8+ T cells. Importantly, exhausted TILs can display high NKG2A expression, and this correlates with reduced survival in patients with ovarian or colorectal cancer (39).

3.4 Panel 2: Memory phenotypes

The ability to preclinically evaluate the capacity of a new treatment, or a novel combination therapy, to enhance anti-tumor immune responses and subsequent formation of memory populations is vital to formulating new treatment strategies to translate into the clinic. To this end, we have designed and optimized a multiparametric flow cytometry panel (Panel 2) to specifically assess changes in memory cell differentiation, proliferation and effector functions in mouse immune cells (Table 3). The same backbone designed for Panel 1 to identify major T and NK cell subset was used for this panel thus allowing a broad applicability and the simultaneous investigation of activation/exhaustion and memory phenotypes (Figure 2B & S3).

3.4.1 NK cells

To identify mature, effector NK cells, CD49b+ cells were further characterized for the co-expression of NKp46, which is used in mice to specifically and accurately identify NK cells (40), and KLRG1 (Figure 2B and Figure S3, blue frame). Consistently, NKp46+KLRG1+ cells lack TCF-1 expression (41). However, because KLRG1 may have inhibitory functions upon binding to cadherins abundantly expressed in some tumor microenvironments, its monitoring may inform on the immune modulatory activity of a given therapy on NK cells in a context-dependent manner (42). Of note, the addition of CD25 in this panel also allows the monitoring of “memory-like” NK cells, a subpopulation with enhanced recall function to multiple stimuli (4345).

3.4.2 T cells

For T cells, CD44 and CD62L gating was used to identify naïve (TN), central memory (TCM) and effector/effector memory (TEFF/EM) subsets (Figure 2B; Figure S3). A marker for ‘stemness’, TCF-1, was included as it has recently been described as an important indicator of T cell self-renewal capability and, when co-expressed with PD-1, as marker of responsiveness to immune checkpoint inhibition (46, 47). The expression of Ki67 allows the identification of proliferating T cells providing a potential means to identify T cell populations that are responding to any immunotherapy or vaccination (48). CCR7 was included in this panel to assess T cell trafficking, particularly in lymph node samples, and to monitor T cell differentiation (49).

3.4.3 CD8+ T cells

Within the CD8+ TCM subset (Figure 2B and Figure S3, orange frame), CD122 expression has been identified as a marker denoting antigen experience (50), whereas the expression of CD69 and/or CD103 may identify tissue-resident memory T cells (51, 52). Within the TEFF/EM subset, KLRG1 and CD127 are utilized to delineate short lived effector cells (SLECs) and memory precursor cells (MPECs) (53). Moreover, within the same subset, assessment of PD-1 and CD25 expression allows the identification of suppressive and/or regulatory CD8+ T cells (54, 55). In tumor draining lymph nodes, co-expression of PD-1 and TCF1 can identify precursors of exhausted T cells (TPEX), which are known for their abilities to self-renew and for their properties of functionally restrained effector cells that are emerging as important mediators of cancer immunotherapy (21, 47).

3.4.4 CD4+ conventional T cells

Conventional CD4+ T cells (Figure 2B and Figure S3, red frame) with direct cytotoxic activity are emerging as important players in anti-tumor immunity (56). In this panel, focusing on CD4+FoxP3- T cells, KLRG1 can be used to identify cytotoxic CD4+ T cells, which display an effector phenotype (57, 58).

3.4.5 Tregs

Within CD4+FOXP3+ Tregs (Figure 2B and Figure S3, green frame), CD25 is a useful marker for assessing maturation of these cells (59). CD69 can additionally be used to identify a Treg cell subset known to express high levels of IL-10 in a STAT3-dependent manner (60). CD103 can be used to identify another Tregs cell subset present in both lymphoid tissues and tumors, whose expression levels correlate with the level of TGFß secreted by tumor cells (61, 62). KLRG1 was applied to identify a small proportion of Tregs in the periphery that exhibit a gene expression profile of “activated and terminally differentiated effector Tregs (63).

3.5 Panel 1 & 2: data analysis

The main purpose of these two integrated flow cytometry panels is to allow the simultaneous analysis of the co-expression of multiple checkpoint inhibitors and the characterization of the memory/effector status of distinct T cell and NK cell subpopulations. With regard to Panel 1, this can be achieved by combining manual gating of known sub-populations (Figures 2A, 3A, B, C, E) with Boolean gating (Figures 3D, F, G). This approach allows the assessment of the proportions of cells expressing none, one or different combinations of multiple immune checkpoint molecules within a specific (known) subpopulation of interest. Back-gating on the parental population against specific activation/differentiation markers of interest provides additional information on the functional status of the immune checkpoint expressing cells (Figure S4). For Panel 2, manual gating of known sub-populations can be used followed by downstream analysis within a specific subset (naïve versus effector/memory) for the characterization of additional subpopulations of functional relevance (Figure 2B; Figure S3). Alternatively, the differentiation status (naïve versus effector/memory) of immune cell subsets, such as CD8+ T cells (Figure 4), expressing specific combinations of markers can be elucidated using this panel. Moreover, for an unbiased interrogation of the data, dimension reduction techniques such as tSNE or UMAP combined with clustering algorithms (FlowSOM and PhenoGraph) can be used to identify known and novel subpopulations characterized by the co-expression of specific differentiation, activation, and/or checkpoint molecules in both Panels (Figures 5, 6; S5).

Figure 4

Figure 5

Figure 6

During the development of these integrated panels, antigen classification, resolution ranking, and an instrument specific spillover spread matrix (Figure S6 and Tables S1, S2) were used to predict the best fluorochrome combination and fluorochrome/antigen association listed in Table 3. Please refer to online supplemental material for the optimization of the panel, antibody titration and detailed technical information (Figures S6–S11).

4 Conclusive remarks

One limitation of the results presented herein is the application of the polyfunctional T cell assays to blood immune cells. Although this approach can allow a reliable monitoring of systemic tumor-specific T cell responses over time during immunotherapeutic treatments, it may not accurately reflect the real situation in the tumour microenvironment. However, the same protocol can easily applied to ex vivo cultured tumour infiltrating lymphocytes provided that adequate numbers of these cells can be obtained from tumor tissues. Similar approaches assessing the extent of polyfunctional T cell responses to tumor antigens have been successfully applied to the peripheral blood immune cells of tumor patients, providing useful indication of changes in adaptive immunity responses induced by treatment and allowing the identification of potential immune biomarkers predictive of the response to therapy (64, 65). Moreover, the multicolor flow cytometry panels we developed for mouse cells can be easily adapted to characterize T cell/NK cell exhaustion and memory phenotypes of human immune cells. These panels may be particularly useful to identify changes in the expression of targetable immune checkpoint molecules thus allowing a rational tailoring of combination immunotherapy for cancer patients. These panels, however, should take into account the differences between mouse and humans with regard to the level of expression and biological meaning of distinct immune markers.

In summary, the integrated exploitation of the multiparametric flow cytometry-based methods we developed can allow a reliable preclinical assessment of vaccine-induced polyfunctional T cell responses, also including the epitope spreading, and the concomitant characterization and T cell/NK cell exhaustion and memory phenotypes in mouse immuno-oncology models. Application of these protocols may improve the definition of the most effective antigen formulations for next generation cancer vaccines and allow the identification of novel mechanism-based combination immunotherapies.

Statements

Data availability statement

The raw data supporting the conclusions of this article will be made available by the authors, without undue reservation.

Ethics statement

The animal study was reviewed and approved by University of Queensland Animal Ethics Committee (approval number UQDI/252/16).

Author contributions

RD, SM, DS and RM designed the research. DM, BZ, SM, RB and JW performed the experiments. DM, BZ, SM, RM and RD analyzed the data. SM and RM drafted the manuscript. RM and RD revised the manuscript. All authors contributed to the article and approved the submitted version.

Funding

The work was supported in part by funding provided by National Breast Cancer Foundation (IIRS-18-047, IIRS-20-124) and by the Peter MacCallum Cancer Centre Foundation (ID #2114). IIRS-23-033 to the National Breast cancer foundation grants.

Acknowledgments

We would like to thank the Flow Cytometry and Animal Core Facilities of the TRI and Peter MacCallum Cancer Centre for technical support during the optimization of these multiparametric panels and the in vivo vaccination experiments. We acknowledge financial support provided by TRI via access to the Symphony Reagent Support Fund. We also thank Andrew Lim (BD Biosciences) for assistance with panel design, technical support and troubleshooting, Vanessa Seelis (BD Biosciences) for providing advice and reagents, Nick Haas and Brian Gabrielli for the kind gift of cell lines.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2023.1127896/full#supplementary-material

Abbreviations

CTRL, Control; NK, Natural killer; NKT, natural killer T; FSC, Forward scatter; MPECs, Memory precursor cells; SLECs, Short lived effector cells; SSC, Side scatter; TAAs, Tumor associated antigens; TCM, Central memory T cells; Tconv, Conventional CD4+ T cells; TEFF/EM, Effector/effector memory T cells; TILs, Tumor infiltrating lymphocytes; TN, Naïve T cells; TNEs, Tailored NanoEmusions; TPEX, Precursors of exhausted T cells; Tregs, regulatory T cells.

References

  • 1

    HernandezRMalekTR. Fueling cancer vaccines to improve T cell-mediated antitumor immunity. Front Oncol (2022) 12:878377. doi: 10.3389/fonc.2022.878377

  • 2

    TanyiJLChiangCLChiffelleJThierryACBaumgartenerPHuberFet al. Personalized cancer vaccine strategy elicits polyfunctional T cells and demonstrates clinical benefits in ovarian cancer. NPJ Vaccines (2021) 6(1):36. doi: 10.1038/s41541-021-00297-5

  • 3

    KeskinDBAnandappaAJSunJTiroshIMathewsonNDLiSet al. Neoantigen vaccine generates intratumoral T cell responses in phase ib glioblastoma trial. Nature (2019) 565(7738):234–9. doi: 10.1038/s41586-018-0792-9

  • 4

    PisibonCOuertaniABertolottoCBallottiRCheliY. Immune checkpoints in cancers: From signaling to the clinic. Cancers (Basel) (2021) 13(18):4573. doi: 10.3390/cancers13184573

  • 5

    KirchhammerNTrefnyMPAuf der MaurPLäubliHZippeliusA. Combination cancer immunotherapies: Emerging treatment strategies adapted to the tumor microenvironment. Sci Transl Med (2022) 14(670):eabo3605. doi: 10.1126/scitranslmed.abo3605

  • 6

    BarnabaVT. Cell memory in infection, cancer, and autoimmunity. Front Immunol (2022) 12:811968. doi: 10.3389/fimmu.2021.811968

  • 7

    WangJPerryCJMeethKThakralDDamskyWMicevicGet al. UV-Induced somatic mutations elicit a functional T cell response in the YUMMER1. 7 Mouse melanoma Model Pigment Cell Melanoma Res (2017) 30(4):428–35. doi: 10.1111/pcmr.12591

  • 8

    ZengBMiddelbergAPGemiartoAMacDonaldKBaxterAGTalekarMet al. Self-adjuvanting nanoemulsion targeting dendritic cell receptor Clec9A enables antigen-specific immunotherapy. J Clin Invest (2018) 128(5):1971–84. doi: 10.1172/JCI96791

  • 9

    LiadserALjungbergKTufvessonHTazzariMRoosAKQuestAFet al. Intradermal DNA electroporation induces survivin-specific CTLs, suppresses angiogenesis and confers protection against mouse melanoma. Cancer Immunol Immunother (2010) 59(1):8192.

  • 10

    CiesielskiMJKozborDCastanaroCABaroneTAFenstermakerRA. Therapeutic effect of a T helper cell supported CTL response induced by a survivin peptide vaccine against murine cerebral glioma. Cancer Immunol Immunother (2008) 57(12):1827–35.

  • 11

    MennuniCUgelSMoriFCiprianiBIezziMPannelliniTet al. Preventive vaccination with telomerase controls tumor growth in genetically engineered and carcinogen-induced mouse models of cancer. Cancer Res (2008) 68(23):9865–74.

  • 12

    SiegelSWagnerASchmitzNZeisM. Induction of antitumour immunity using survivin peptide-pulsed dendritic cells in a murine lymphoma model. Br J Haematol (2003) 122(6):911–4.

  • 13

    YuGHeXLiXWuY. Driving neoantigen-based cancer vaccines for personalized immunotherapy into clinic: A burdensome journey to promising land. BioMed Pharmacother (2022) 153:113464. doi: 10.1016/j.biopha.2022.113464

  • 14

    KreiterSVormehrMvan de RoemerNDikenMLöwerMDiekmannJet al. Mutant MHC class II epitopes drive therapeutic immune responses to cancer. Nature (2015) 520(7549):692–6. doi: 10.1038/nature14426

  • 15

    ZhangJMarotelMFauteux-DanielSMathieuALVielSMarçaisAet al. T-Bet and eomes govern differentiation and function of mouse and human NK cells and ILC1. Eur J Immunol (2018) 48(5):738–50. doi: 10.1002/eji.201747299

  • 16

    LiJHeYHaoJNiLDongC. High levels of eomes promote exhaustion of anti-tumor CD8+ T cells. Front Immunol (2018) 9:2981. doi: 10.3389/fimmu.2018.02981

  • 17

    GacerezATSentmanCL. T-Bet promotes potent antitumor activity of CD4+ CAR T cells. Cancer Gene Ther (2018) 25(5-6):117–28. doi: 10.1038/s41417-018-0012-7

  • 18

    LongEOKimHSLiuDPetersonMERajagopalanS. Controlling natural killer cell responses: integration of signals for activation and inhibition. Annu Rev Immunol (2013) 31:227–58. doi: 10.1146/annurev-immunol-020711-075005

  • 19

    GillSVaseyAEDe SouzaABakerJSmithATKohrtHEet al. Rapid development of exhaustion and down-regulation of eomesodermin limit the antitumor activity of adoptively transferred murine natural killer cells. Blood (2012) 119(24):5758–68. doi: 10.1182/blood-2012-03-415364

  • 20

    ZhangPLeeJSGartlanKHSchusterISComerfordIVareliasAet al. Eomesodermin promotes the development of type 1 regulatory T (TR1) cells. Sci Immunol (2017) 2(10):eaah7152. doi: 10.1126/sciimmunol.aah7152

  • 21

    TayRERichardsonEKTohHC. Revisiting the role of CD4+ T cells in cancer immunotherapy-new insights into old paradigms. Cancer Gene Ther (2021) 28(1-2):517. doi: 10.1038/s41417-020-0183-x

  • 22

    KachlerKHolzingerCTrufaDISirbuHFinottoS. The role of Foxp3 and tbet co-expressing treg cells in lung carcinoma. Oncoimmunology (2018) 7(8):e1456612. doi: 10.1080/2162402X.2018.1456612

  • 23

    LuccaLEAxisaPPSingerERNolanNMDominguez-VillarMHaflerDA. TIGIT signaling restores suppressor function of Th1 tregs. JCI Insight (2019) 4(3):e124427. doi: 10.1172/jci.insight.124427

  • 24

    ChenFXuYChenYShanS. TIGIT enhances CD4+ regulatory T-cell response and mediates immune suppression in a murine ovarian cancer model. Cancer Med (2020) 9(10):3584–91. doi: 10.1002/cam4.2976

  • 25

    ShevyrevDTereshchenkoV. Treg heterogeneity, function, and homeostasis. Front Immunol (2020) 10:3100. doi: 10.3389/fimmu.2019.03100

  • 26

    PrajapatiKPerezCRojasLBPBurkeBGuevara-PatinoJA. Functions of NKG2D in CD8+ T cells: an opportunity for immunotherapy. Cell Mol Immunol (2018) 15(5):470–9. doi: 10.1038/cmi.2017.161

  • 27

    Akira ShibuyaKazukoS. DNAM-1 versus TIGIT: competitive roles in tumor immunity and inflammatory responses. Int Immunol (2021) 33(12):687–92. doi: 10.1093/intimm/dxab085

  • 28

    MinnieSAKunsRDGartlanKHZhangPWilkinsonANSamsonLet al. Myeloma escape after stem cell transplantation is a consequence of T-cell exhaustion and is prevented by TIGIT blockade. Blood (2018) 132(16):1675–88. doi: 10.1182/blood-2018-01-825240

  • 29

    FixemerJHummelJFArnoldFKloseCSNHofherrAWeissertKet al. Eomes cannot replace its paralog T-bet during expansion and differentiation of CD8 effector T cells. PloS Pathog (2020) 16(9):e1008870. doi: 10.1371/journal.ppat.1008870

  • 30

    LiuQSunZChenL. Memory T cells: strategies for optimizing tumor immunotherapy. Protein Cell (2020) 11(8):549–64. doi: 10.1007/s13238-020-00707-9

  • 31

    ImSJHashimotoMGernerMYLeeJKissickHTBurgerMCet al. Defining CD8+ T cells that provide the proliferative burst after PD-1 therapy. Nature (2016) 537(7620):417–21. doi: 10.1038/nature19330

  • 32

    AndersonACJollerNKuchrooVK. Lag-3, Tim-3, and TIGIT: Co-inhibitory receptors with specialized functions in immune regulation. Immunity (2016) 44(5):9891004. doi: 10.1016/j.immuni.2016.05.001

  • 33

    HuangCTWorkmanCJFliesDPanXMarsonALZhouGet al. Role of LAG-3 in regulatory T cells. Immunity (2004) 21(4):503–13. doi: 10.1016/j.immuni.2004.08.010

  • 34

    KurtulusSSakuishiKNgiowSFJollerNTanDJTengMWet al. TIGIT predominantly regulates the immune response via regulatory T cells. J Clin Invest (2015) 125(11):4053–62. doi: 10.1172/JCI81187

  • 35

    DasMZhuCKuchrooVK. Tim-3 and its role in regulating anti-tumor immunity. Immunol Rev (2017) 276(1):97111. doi: 10.1111/imr.12520

  • 36

    PreillonJCuendeJRabolliVGarneroLMercierMWaldNet al. Restoration of T-cell effector function, depletion of tregs, and direct killing of tumor cells: The multiple mechanisms of action of a-TIGIT antagonist antibodies. Mol Cancer Ther (2021) 20(1):121–31. doi: 10.1158/1535-7163.MCT-20-0464

  • 37

    ElTanboulyMAZhaoYNowakELiJSchaafsmaELe MercierIet al. VISTA is a checkpoint regulator for naïve T cell quiescence and peripheral tolerance. Science (2020) 367(6475):eaay0524. doi: 10.1126/science.aay0524

  • 38

    YuanLTatineniJMahoneyKMFreemanGJ. VISTA: A mediator of quiescence and a promising target in cancer immunotherapy. Trends Immunol (2021) 42(3):209–27. doi: 10.1016/j.it.2020.12.008

  • 39

    CreelanBCAntoniaSJ. The NKG2A immune checkpoint - a new direction in cancer immunotherapy. Nat Rev Clin Oncol (2019) 16(5):277–8. doi: 10.1038/s41571-019-0182-8

  • 40

    WalzerTBléryMChaixJFuseriNChassonLRobbinsSHet al. Identification, activation, and selective in vivo ablation of mouse NK cells via NKp46. Proc Natl Acad Sci USA. (2007) 104(9):3384–9. doi: 10.1073/pnas.0609692104

  • 41

    LiZYMormanREHegermillerESunMBartomETMaienschein-ClineMet al. The transcriptional repressor ID2 supports natural killer cell maturation by controlling TCF1 amplitude. J Exp Med (2021) 218(6):e20202032. doi: 10.1084/jem.20202032

  • 42

    MillerJSLanierLL. Natural killer cells in cancer immunotherapy. Annu Rev Cancer Biol (2019) 3(1):77103. doi: 10.1146/annurev-cancerbio-030518-055653

  • 43

    LeeSHFragosoMFBironCA. Cutting edge: a novel mechanism bridging innate and adaptive immunity: IL-12 induction of CD25 to form high-affinity IL-2 receptors on NK cells. J Immunol (2012) 189(6):2712–6. doi: 10.4049/jimmunol.1201528

  • 44

    LeongJWChaseJMRomeeRSchneiderSESullivanRPCooperMAet al. Preactivation with IL-12, IL-15, and IL-18 induces CD25 and a functional high-affinity IL-2 receptor on human cytokine-induced memory-like natural killer cells. Biol Blood Marrow Transplant (2014) 20(4):463–73. doi: 10.1016/j.bbmt.2014.01.006

  • 45

    GangMWongPBerrien-ElliottMMFehnigerTA. Memory-like natural killer cells for cancer immunotherapy. Semin Hematol (2020) 57(4):185–93. doi: 10.1053/j.seminhematol.2020.11.003

  • 46

    BlankCUHainingWNHeldWHoganPGKalliesALugliEet al. Defining ‘T cell exhaustion’. Nat Rev Immunol (2019) 19(11):665–74. doi: 10.1038/s41577-019-0221-9

  • 47

    SiddiquiISchaeubleKChennupatiVFuertes MarracoSACalderon-CopeteS. Intratumoral Tcf1+PD-1+CD8+ T cells with stem-like properties promote tumor control in response to vaccination and checkpoint blockade immunotherapy. Immunity (2019) 50(1):195211.e110. doi: 10.1016/j.immuni.2018.12.021

  • 48

    MotamediMXuLElahiS. Correlation of transferrin receptor (CD71) with Ki67 expression on stimulated human and mouse T cells: The kinetics of expression of T cell activation markers. J Immunol Methods (2016) 437:4352. doi: 10.1016/j.jim.2016.08.002

  • 49

    RenHCaoKWangM. A correlation between differentiation phenotypes of infused T cells and anti-cancer immunotherapy. Front Immunol (2021) 12:745109. doi: 10.3389/fimmu.2021.745109

  • 50

    MathewsDVDongYHigginbothamLBKimSCBreedenCPStobertEAet al. CD122 signaling in CD8+ memory T cells drives costimulation-independent rejection. J Clin Invest (2018) 128(10):4557–72. doi: 10.1172/JCI95914

  • 51

    ParkSLBuzzaiARautelaJHorJLHochheiserKEffernMet al. Tissue-resident memory CD8(+) T cells promote melanoma-immune equilibrium in skin. Nature (2019) 565(7739):366–71. doi: 10.1038/s41586-018-0812-9

  • 52

    MackayLKRahimpourAMaJZCollinsNStockATHafonMLet al. The developmental pathway for CD103(+)CD8+ tissue-resident memory T cells of skin. Nat Immunol (2013) 14(12):1294–301. doi: 10.1038/ni.2744

  • 53

    JoshiNSCuiWChandeleALeeHKUrsoDRHagmanJet al. Inflammation directs memory precursor and short-lived effector CD8(+) T cell fates via the graded expression of T-bet transcription factor. Immunity (2007) 27(2):281–95. doi: 10.1016/j.immuni.2007.07.010

  • 54

    BienvenuBMartinBAuffrayCCordierCBecourtCLucasB. Peripheral CD8+CD25+ T lymphocytes from MHC class II-deficient mice exhibit regulatory activity. J Immunol (2005) 175(1):246–53. doi: 10.4049/jimmunol.175.1.246

  • 55

    ChakrabortySBhattacharjeePPandaAKKajalKBoseSSaG. Providence of the CD25(+) KIR(+) CD127(-) FOXP3(-) CD8(+) T-cell subset determines the dynamics of tumor immune surveillance. Immunol Cell Biol (2018) 96(10):1035–48. doi: 10.1111/imcb.12166

  • 56

    KalliesAZehnDUtzschneiderDT. Precursor exhausted T cells: key to successful immunotherapy? nat. Rev Immunol (2020) 20:128–36. doi: 10.1038/s41577-019-0223-7

  • 57

    OhDYFongL. Cytotoxic CD4+ T cells in cancer: Expanding the immune effector toolbox. Immunity (2021) 54(12):2701–11. doi: 10.1016/j.immuni.2021.11.015

  • 58

    CachotABilousMLiuYCLiXSaillardMCenerentiMet al. Tumor-specific cytolytic CD4 T cells mediate immunity against human cancer. Sci Adv (2021) 7(9):eabe3348. doi: 10.1126/sciadv.abe3348

  • 59

    CurielTJ. Tregs and rethinking cancer immunotherapy. J Clin Invest (2007) 117(5):1167–74. doi: 10.1172/JCI31202

  • 60

    YuLYangFZhangFGuoDLiLWangXet al. CD69 enhances immunosuppressive function of regulatory T-cells and attenuates colitis by prompting IL-10 production. Cell Death Dis (2018) 9(9):905. doi: 10.1038/s41419-018-0927-9

  • 61

    AnzDMuellerWGolicMKunzWGRappMKoelzerVHet al. CD103 is a hallmark of tumor-infiltrating regulatory T cells. Int J Cancer (2011) 129(10):2417–26. doi: 10.1002/ijc.25902

  • 62

    ChangLYLinYCKangCWHsuCYChuYYHuangCTet al. The indispensable role of CCR5 for in vivo suppressor function of tumor-derived CD103+ effector/memory regulatory T cells. J Immunol (2012) 189(2):567–74. doi: 10.4049/jimmunol.1200266

  • 63

    ChengGYuanXTsaiMSPodackERYuAMalekTRet al. IL-2 receptor signaling is essential for the development of Klrg1+ terminally differentiated T regulatory cells. J Immunol (2012) 189(4):1780–91. doi: 10.4049/jimmunol.1103768

  • 64

    MuraroEComaroETalaminiRTurchetEMioloGScaloneSet al. Improved natural killer cell activity and retained anti-tumor CD8(+) T cell responses contribute to the induction of a pathological complete response in HER2-positive breast cancer patients undergoing neoadjuvant chemotherapy. J Transl Med (2015) 13:204. doi: 10.1186/s12967-015-0567-0

  • 65

    MuraroEFurlanCAvanzoMMartorelliDComaroERizzoAet al. Local high-dose radiotherapy induces systemic immunomodulating effects of potential therapeutic relevance in oligometastatic breast cancer. Front Immunol (2017) 8:1476.61. doi: 10.3389/fimmu.2017.01476

Summary

Keywords

immunomonitoring, polyfunctional T cell assay, multiparametric flow cytometry, cancer vaccines, mouse cancer models, cancer immunotherapy, immune checkpoints

Citation

Moi D, Zeng B, Minnie SA, Bhatt R, Wood J, Sester DP, Mazzieri R and Dolcetti R (2023) Multiparametric flow cytometry to characterize vaccine-induced polyfunctional T cell responses and T cell/NK cell exhaustion and memory phenotypes in mouse immuno-oncology models. Front. Immunol. 14:1127896. doi: 10.3389/fimmu.2023.1127896

Received

20 December 2022

Accepted

23 March 2023

Published

06 April 2023

Volume

14 - 2023

Edited by

Nargis Khan, University of Calgary, Canada

Reviewed by

Seong-Eun Kim, Pohang University of Science and Technology, Republic of Korea; Kim Klonowski, University of Georgia, United States

Updates

Copyright

*Correspondence: Riccardo Dolcetti,

†These authors have contributed equally to this work and share first authorship

‡These authors have contributed equally to this work and share senior authorship

This article was submitted to Vaccines and Molecular Therapeutics, a section of the journal Frontiers in Immunology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics