Abstract
The previous studies on the RGD motif (aa403-405) within the SARS CoV-2 spike (S) protein receptor binding domain (RBD) suggest that the RGD motif binding integrin(s) may play an important role in infection of the host cells. We also discussed the possible role of two other integrin binding motifs that are present in S protein: LDI (aa585-587) and ECD (661-663), the motifs used by some other viruses in the course of infection. The MultiFOLD models for protein structure analysis have shown that the ECD motif is clearly accessible in the S protein, whereas the RGD and LDI motifs are partially accessible. Furthermore, the amino acids that are present in Epstein-Barr virus protein (EBV) gp42 playing very important role in binding to the HLA-DRB1 molecule and in the subsequent immune response evasion, are also present in the S protein heptad repeat-2. Our MultiFOLD model analyses have shown that these amino acids are clearly accessible on the surface in each S protein chain as monomers and in the homotrimer complex and bind to HLA-DRB1 β chain. Therefore, they may have the identical role in SARS CoV-2 immune evasion as in EBV infection. The prediction analyses of the MHC class II binding peptides within the S protein have shown that the RGD motif is present in the core 9-mer peptide IRGDEVRQI within the two HLA-DRB1*03:01 and HLA-DRB3*01.01 strong binding 15-mer peptides suggesting that RGD motif may be the potential immune epitope. Accordingly, infected HLA-DRB1*03:01 or HLA-DRB3*01.01 positive individuals may develop high affinity anti-RGD motif antibodies that react with the RGD motif in the host proteins, like fibrinogen, thrombin or von Willebrand factor, affecting haemostasis or participating in autoimmune disorders.
1 Introduction
The SARS CoV-2 induced COVID-19 has led to the greatest pandemic outbreak since the appearance of the H1N1 influenza virus in 1918. Despite the extensive research on the ability of SARS CoV-2 to trigger multiple pathological phenomena in infected hosts, like deregulated coagulation, hyper inflammation and autoimmune diseases, the many factors and mechanisms that are involved in these events are still unknown. An important role in virus infections have various integrins that are present on the target cells.
Integrins are heterodimeric transmembrane glycoproteins composed of α and β subunits that bind extracellular matrix, cell-surface, and soluble ligands. They serve as cell adhesion receptors for numerous ligands playing an important role in signalling processes during infection and inflammation as well as in immunity, cell adhesion, cell migration, angiogenesis and carcinogenesis (–). The RGD (arginine/glycine/aspartic acid) amino acid sequence is the most frequent motif that plays a key role in integrin binding, but other tripeptide motifs have been identified such as KGD, LDV, ECD and MVD ().
However, integrins may serve as entry receptors for a variety of different viruses including, coxsackie adenovirus, human cytomegalovirus, foot-and-mouth disease virus, Kaposi’s sarcoma-associated herpes virus, adenovirus, human papillomavirus-16, Hantaviruses (Sin Nombre virus), rotaviruses, echovirus-1, and others (). Furthermore, viruses such as HIV, herpes simplex virus, measles viruses and SARS CoV-2, use integrins as co-receptors for entry into the host cells, which may enhance virus infectivity and broaden the cell types or hosts susceptible to infection (, ). There are several integrin categories based on their ligand specificity: collagen-binding integrins: α1β1, α2β1, α10β1, and α11β1; RGD motif- recognising integrins: α5β1, αvβ1, αvβ3, αvβ5, αvβ6, αvβ8, and αIIbβ3; laminin-binding integrins: α3β1, α6β1, α7β1, and α6β4; and leukocyte-binding integrins: αLβ2, αMβ2, αXβ2, and αDβ2 ().
2 SARS CoV-2 spike protein and integrin binding motifs
2.1 The RGD integrin binding motif
The virus membrane proteins expressing the RGD motif are the most common integrin ligands contributing to the target cell entry by viral pathogens. Accordingly, the RGD motif plays a key role in virus infectivity and/or pathogenicity. For example, the RGD motif in Epstein-Barr virus (EBV) protein BMRF-2 is critical in infection of oral epithelial cells with EBV upon binding to β1 integrin subunit ().
Furthermore, it is known that the RGD motif binding integrins play a significant role in coagulation, innate immunity, inflammation and autoimmunity (). The RGD motif within plasma coagulation proteins such as fibrinogen, thrombin and von Willebrand factor (vWf) as well as within endothelial cell adhesion proteins fibronectin, laminin and vitronectin, binds to target integrins that are present on cells involved in coagulation, cell adhesion and/or immunity. The binding of fibrinogen to glycoprotein IIb/IIIa (GPIIb/IIIa), also known as platelet integrin αIIbβ3, plays a central role in platelet activation, haemostasis and arterial thrombosis. Integrin αIIbβ3 is expressed at a high level in platelets and their progenitors, where it plays the central role in platelet functions (). The two RGD motifs within fibrinogen alpha chain, and the carboxyl-terminus of the gamma chain represent the potential αIIbβ3 binding sites on agonist-activated platelets such as adenosine diphosphate (ADP). ADP is an important primary platelet agonist that induces the activation-dependent conformational change in integrin αIIbβ3, which allows the fibrinogen binding and subsequent platelet aggregation initiating the coagulation process ().
It is known that S protein from SARS-CoV-1 and SARS CoV-2 binds to the extracellular domain of angiotensin-converting enzyme 2 (ACE2) to infect the epithelial cells (, ). However, other cell entry mechanisms of SARS-CoV-2 have been strongly suggested (). The recently evolved SARS CoV-2 S protein RGD motif (aa403-405) within the receptor binding domain (RBD) has been proposed to bind platelet integrin αIIbβ3 (, ). The RGD motif is not present in the S proteins from any other known human or bat coronavirus, but the KGD motif (lysine/glycine/aspartic acid), which is located at position aa390-392 in the SARS CoV-1 S protein RBD (), is also able to bind αIIbβ3 integrin (). The KGD motif is present also in the S proteins from so-called “bat SARS-like” coronaviruses, such as, RaGT13, WVI1, RsSHC014, Rs3367, and HKU3 ().
Besides fibrinogen, other acute phase proteins such as prothrombin and vWF are integrin αIIbβ3 ligands, and they also use the RGD motif to bind activated platelets (). Fibrinogen also binds to integrin α5β1 on endothelial cells via the carboxyl-terminal RGD sequence (aa572-574) of α-chain with high affinity (Kd = 65 nM), which have broad biological implications (, ). Interestingly, Grobbelaar et al. () have shown that the addition of S1 protein to platelet-poor plasma induces structural changes of fibrinogen β and γ chains, complement C3, and thrombin as determined by mass spectrometry, which may cause dysregulation of the coagulation process and resistance to fibrinolysis in COVID-19 patients if it occurs in vivo. The RGD motif is also present in endothelial cell adhesion proteins fibronectin, laminin and vitronectin, which are playing an important role in cell migration and adhesion ().
The previous studies have shown that endothelial injury is caused directly by the SARS CoV-2 (), but the recent studies indicate that the expression of ACE2 was low or undetectable in non-COVID-19 pulmonary endothelial cells (). The cells expressing low levels of ACE2 such as those in younger children (), are more resistant to the SARS CoV-2 infection (). Nader et al. () suggested that SARS-CoV-2 has a higher infection rate due to the ability of the S protein to bind αvβ3 integrin on vascular endothelium via the RGD motif. However, Beaudoin et al. () have performed the computational analysis of the protein structure and suggested that the binding of the RGD motif to integrins is very difficult in spite of the S protein unfolding and the subsequent conformational changes induced upon binding to ACE2 and that the S protein interacts with integrins independent of the RGD sequence. Our MultiFOLD model analysis of the experimental protein structure of the SARS CoV-2 S protein complex (UniProt ID - P0DTC2; PDB ID - 6VXX) shows that the RGD motif is partially accessible in each chain of the homotrimer complex (Figure 1A). But, if spike protein is able to bind integrins αIIbβ3 or αvβ3, the virus attachment to endothelial cells via S protein integrin binding motif(s) could lead to their infection and activation followed by dysregulation of the coagulation process and by excessive systemic inflammatory response. Thus, it is necessary to perform more extensive studies to clarify the possible role of the S protein RGD motif in COVID-19 pathogenesis.
Figure 1
Besides viruses, the malarial parasite Plasmodium falciparum uses the sporozoite surface Thrombospondin-related anonymous protein (TRAP; P16893) RGD motif (aa307-309) to interact directly with the host receptor integrin αvβ3, but it requires the contribution from vWF A domain (–). Furthermore, red blood cells (RBC) infected with Plasmodium falciparum exhibit erythrocyte membrane protein 1 (PfEMP1) that is synthesised during the parasite’s blood stage after the manifestation of clinical symptoms. PfEMP1 is also the ligand responsible for adhesion of RBC to endothelial cells via integrin αvβ3 that is thought to play a key role in the virulence of Plasmodium falciparum. These interactions can be inhibited in vitro by cyloRGDFV peptide, an antagonist of RGD-binding integrins ().
An example of RGD motif-independent virus interactions with β3 subunit in αIIbβ3 and αvβ3 integrins is infection of endothelial cells with segmented negative-stranded RNA viruses, Hantaviruses NY-1 and Sin Nombre virus (). After infection of endothelial cells, both viruses replicate primarily in the pulmonary endothelium causing Hantavirus cardiopulmonary syndrome (HCPS) with symptoms indistinguishable from those appearing in the initial phase of SARS CoV-2 infection in COVID-19 patients. Accordingly, the potential binding of SARS CoV-2 S protein to αIIbβ3 or αvβ3 integrin may induce identical pathological events in COVID-19 that are described in HCPS (). Since the infection of endothelial cells with HCPS-associated Hantaviruses is inhibited by antibodies to β3 integrin subunit, the blocking of β3-integrins is the possible pharmacologic intervention in the initial phase of SARS CoV-2 infection.
The RGD motif-based peptide ligands have been tested in biomedical studies as low-molecular-weight integrin antagonists to treat the primary tumours and their metastases and for the control of inflammation, as well as for thrombosis inhibition (–). The RGD mimetic therapeutic antagonists, already on the market, have targeted integrins αIIbβ3 and αLβ2: Eptifibatide/Integrilin prevents platelet aggregation by inhibiting binding to fibrinogen in acute coronary syndrome and thrombotic cardiovascular events, and Lifitegrast prevents lymphocyte adhesion, thereby reducing T cell-mediated inflammation (). Unfortunately, some current RGD motif-based anti-integrin drugs that are tested as agonists may trigger potentially fatal immune response and undesirable cell adhesion.
Therefore, it is necessary to perform further extensive studies that may confirm or reject the hypothesis that the S protein RGD motif plays an important role in COVID-19 pathology. If confirmed, it may bring solutions for more efficient COVID-19 therapy.
2.2 The LDV/I integrin binding motif
In addition to the RGD motif, other integrin-binding motifs like LDV (leucine, aspartic acid, valine) that binds to α4β1 integrin (very late antigen-4; VLA-4). This integrin is expressed on the cell surfaces of stem cells, progenitor cells, T and B cells, monocytes, natural killer cells, eosinophils, but not on neutrophils (). The primary VLA-4 ligands are the vascular cell adhesion molecule-1 (VCAM-1) and the fibronectin connecting segment-1 (CS1) region during chronic inflammatory diseases, such as rheumatoid arthritis. VCAM-1 is an essential component of the endothelial cells activation cascade upon they express the VLA-4 integrin after stimulation by inflammatory cytokines, tumour necrosis factor alpha (TNF-α) and interferon-γ (IFN-γ). The VLA-4 integrin recognises the LDV motif within the sequence EILDVPST in the fibronectin CS1 region (aa2100-2107) promoting the inflammatory response and the movement of T lymphocytes to the site of inflammation (–).
The RBD within SARS CoV-1, CoV-2 and all bat SARS CoV-like spike proteins contains the EILDI sequence (aa583-587). Since Liu et al. () provided evidence that SARS CoV-2 S protein RBD also binds to broadly expressed integrin α5β1 with high affinity, the binding could be mediated by the S protein LDI motif, which enables SARS CoV-2 to infect ACE2 negative cells upon integrin activation after the initial ACE2 mediated infection of the lung epithelium. The LDI motif is also recognised by some non-RGD binding integrins, which indicates that besides the RGD motif an even broader range of integrins may be involved in the virus host-cell entry and in SARS-CoV-2 induced pathology (, ). Furthermore, the surface of the SARS CoV-2 S protein chain A complex shows the key accessible residues of the LDI motif (aa585-587) more clearly, and the LDI motif is also observed to be partially accessible in the homotrimer complex, Figure 1C.
Since the conservative amino acid replacement rarely results in dysfunction of the corresponding protein (), it could be assumed that the conservative amino acid replacement of valine (V) with isoleucine (I) within SARS CoV-2 S protein RBD did not impact the LDI motif binding to α4β1 and/or α5β1 integrin. Similarly, it has been previously shown that the LDV/LDI switch within human immunodeficiency virus-1 gp120 could not change the binding affinity to target integrin, and even higher HIV-1 infectivity has been reported (). The LDV/I motif encoded in the V2-loop of HIV-1 gp120 binds preferentially to integrin α4β7 (), the lymphocyte receptor in the gut-associated lymphoid tissues, and the authors suggested that the LDI motif switch was linked to the successful epidemic dissemination of HIV-1 subtype C in South America, and to the other expanding non-B subtypes in Europe and Asia ().
Therefore, it could be assumed that the S protein can act as an agonist and interferes with fibronectin binding to integrin α4β1 (VLA-4) or α5β1 promoting the inflammatory response by assisting in the movement of leukocytes to damaged tissue.
2.3 The ECD motif
Adamalysins, ADAM (A Disintegrin and Metalloproteinase) and ADAMTS (A Disintegrin and Metalloproteinase with Thrombospondin Motifs), are proteins characterised by their activity as zinc metalloproteinases and by disintegrin-like integrin receptor-binding domains (, ). Some of the ADAM proteins, like ADAM17, ADAM12 and ADAMTS13, have diverse roles in inflammation, vascular biology (fibrosis and thrombosis) and in virus entry into the cells. Particularly, ADAM17 (P78536) plays an important role in several human inflammatory autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. Except its role in inflammation, ADAM17 is able to shed the surface platelet glycoprotein Ib alpha chain (GP-Ibα) allowing the platelet adhesion and plug formation at sites of vascular injury after binding to the vWF A1 domain on endothelium cells (). The ADAM17 protein, also cleaves the TNF-alpha membrane-bound precursor to its active soluble form (, ). Furthermore, ADAM17, ADAM12 and ADAMTS13 have been found to be involved in COVID-19 pathogenesis (). Since ADAM17 is found to be involved in the proteolytic processing of ACE2 (), it may represent a novel molecular target for the drug development, as suggested by Schreiber et al. ().
The integrin-binding amino acid sequence RGD within the disintegrin-like domain of many known ADAM proteins is employed in integrin-ligand interactions (). However, some ADAMs, such as ADAM17, contain ECD (glutamic acid, cysteine, aspartic acid) or xCD motifs within the disintegrin-like domain that are involved in integrin-ligand interactions (, ). There is evidence that ADAM17 may act as one of α5β1 integrin ligands, and the integrin binding site is located within the disintegrin/cysteine-rich region that includes ECD motif (, ).
An example of the presumable ECD motif mediated ligand binding to target molecule was presented by Wang (). Wang has shown that Acurhagin (Q9W6M5), an ECD disintegrin isolated from the snake Agkistrodon acutus venom, is able to induce apoptosis via caspase-3 activation in human umbilical vein endothelial cells in vitro after binding to αvβ3 integrin. Equally, purified αvβ3 integrin also binds to immobilised Acurhagin. These data suggest that the cell death induced by antagonist binding to αvβ3 integrin results in an apoptotic signal that is different from the apoptotic signal induced by programmed cell death (). Most probably, the ECD motif plays an important role in binding to αvβ3 integrin that may activate caspase-3 and induce apoptosis as described previously for synthetic peptides containing the RGD motif ().
Additionally, an ECD motif is present in S protein from SARS CoV-2 (aa661-663), SARS CoV-1 and bat SARS-like CoVs as well as in MERS S protein S1-C terminal domain (aa382-384), Table 1. The position of the ECD motif within the disulphide bond in each spike protein is very similar to the position of ECD motif in Acurhagin (Figure 1A), and the accessibility of the motif suggests that the S protein could also bind the αvβ3 integrin and cause caspase-3 activation and subsequent apoptosis in endothelial cells. The ECD motif is also present in pandemic influenza haemagglutinins H1 (UniProt ID: Q9WFX3) and H2 (UniProt ID: P03451), but not in H3 and H5 (Table 1). There is evidence that pandemic influenza A(H1N1) type causes more complications compared to other influenza virus subtypes, i.e., patients with A (H1N1) were admitted more often to the intensive care unit and died more often compared to A (H3N2) (). However, the ECD accessibility, both in the S protein and in H1 as shown in Figure 1, means that the binding of both viruses to αvβ3 integrin on endothelial cells is possible and may induce apoptosis in infected endothelial cells. Therefore, if that assumption can be experimentally proven, it can explain the cause of the endothelial dysfunction associated with apoptosis after infection with SARS CoV or with influenza H1N1virus ().
Table 1
| Proteins | Amino acid sequence | Position |
|---|---|---|
| Acurhagin | ECDPAEHCTGQSSECPADVFHKNGEPCLDNYGYC | 466-499 |
| Haemagglutinin HA1 | CNIAGWLLGNPECD | 72-85 |
| Haemagglutinin HA2 | CSIAGWLLGNPECD | 70-83 |
| Haemagglutinin HA3 | CTLIDALLGDPHCD | 80-93 |
| Haemagglutinin HA5 | CSVAGWLLGNPMCD | 71-84 |
| SARS Cov-2 S protein | ECDIPIGAGIC | 661-671 |
| SARS Cov-1 | ECDIPIGAGIC | 647-657 |
| Bat SARS-like CoV WIV1 | ECDIPIGAGIC | 648-658 |
| Bat SARS-like CoV Rp3/2004 | ECDIPIGAGIC | 633-643 |
| Bat SARS-like CoV RaTG13 | ECDIPIGAGIC | 661-671 |
| Bat SARS-like CoV 279/2005 | ECDIPIGAGIC | 633-643 |
| Bat SARS-like CoV HKU3 | ECDIPIGAGIC | 634-644 |
| Zaria bat CoV | ECQFSLGLDTC | 688-698 |
| Bat Cov HKU9 | TCAMPIGNSLC | 650-660 |
| Rousettus bat coronavirus | VCEMPIGNSLC | 666-676 |
| Eidolon bat CoV/Kenya/KY24 | DCSLLLGDSYC | 647-657 |
| MERS CoV (K9N5Q8) | ECDFSPLLSGTPPQVYNFKRLVFTNC | 382-407 |
| Bat CoV HKU4/2004 | ECDFSPMLTGVAPQVYNFKRLVFSNC | 387-412 |
| Bat CoV HKU5/2005 | ECDFTPMLTGTPPPIYNFKRLVFTNC | 391-415 |
| Bat CoV/133/2005 | ECDFSPMLTGVAPQVYNFKRLVFSNC | 388-412 |
| Hypsugo bat CoV HKU25 | ECDFSPMLTGTPPQVYNFRRLVFTDC | 389-404 |
| Bat Hp-CoV/Zhejiang2013 | ECPFQSLINVTEATIPSPAFWRRHYVRNC | 356-384 |
The amino acid sequences within the disulfide bond adjacent to the ECD motif.
The amino acid sequences within disulfide bond adjacent to the ECD motif within in Acurhagin, influenza virus haemagglutinins and in spike proteins from SARS CoV-2, SARS CoV-1, bat SARS-like CoVs, MERS CoV and bat CoVs. The cysteine amino acids (C) within ECD motif forming the disulphide bridge (bold letters) in Acurhagin (Q9W6M5), influenza virus hemagglutinin HA1 (Q9WFX3), HA2 (Q67143), HA3 (O11283) and HA5 (P09345) and in the spike proteins from different human and mouse coronaviruses are shown. All amino acid sequences from the UniProt data base ().
2.4 The accessibility of the RGD, LDIand ECD motifs
We have analysed the accessibility of RGD, LDI and ECD motifs within SARS CoV-2 S protein as well as the accessibility of such motifs in proteins that use these motifs to bind the target molecules using MultiFOLD analyses ().
Figure 1 shows the surface views of the experimental structures in the PDB with the best resolution and highest coverage for the SARS CoV-2 spike protein complex (UniProt ID - P0DTC2; PDB ID - 6VXX) and influenza haemagglutinin H1 complex (UniProt ID - Q9WFX3; PDB ID - 4GXX) () , and the MultiFOLD models of ADAM17 metalloproteinase (UniProt ID - P78536) and Acurhagin disintegrin (UniProt ID - Q9W6M5), which are confidently predicted (plDDT ⪞0.7 and pTM ⪞0.5, indicating that the predicted folds are likely to be correct). MulitFOLD is our new tertiary and quaternary structure modelling pipeline that has been independently verified to outperform both AlphaFold2 () and AlphaFold2-Multimer (). The RGD motif in the SARS CoV-2 spike protein (aa403-405) is shown to be partially accessible in each chain of the homotrimer complex, Figure 1A. The side view of the SARS CoV-2 spike protein complex also shows that the ECD motif residues (aa661-663) are clearly accessible in each chain, Figure 1B. Furthermore, the surface of chain A of the SARS CoV-2 spike complex shows the key accessible residues of the LDI motif (aa585-587) more clearly, Figure 1C. The LDI motif is also observed to be partially accessible in the homotrimer. The ECD motif residues are shown to be accessible on the surface of both the ADAM17 metalloproteinase and the zinc metalloproteinase-disintegrin-like acurhagin MultiFOLD models (Figures 1D, E), as well as on the surface of the experimental structure of influenza haemagglutinin H1 complex () (Figure 1F). The top 5 predicted conformations for the targets in Figures 1D, E are shown in Supplementary Figures 1A, B respectively.
Interestingly, besides the RGD motif, which is present only in the SARS CoV-2 S protein, the LDI and ECD motifs exist in SARS CoV-1 and all bat SARS-like CoVs that generally share about 75% amino acid sequence identity with the SARS CoV-2 S protein (Figure 2). An exception is the ECD motif, which is also present in the MERS CoV S protein and in some bat CoVs (Table 1). The pairwise sequence alignment of the SARS CoV-2 S and M protein with the S and M proteins from SARS CoV-1, bat SARS-like CoVs and human and bat corona viruses (CoVs), revealed about 75% identity with the S protein from SARS CoV-1 and bat SARS-like CoVs, except for bat RaGT13 CoV with 97.4%, whereas the identity level with known human and bat CoVs as well as with MERS CoV varied from 23.3% with human CoV-NL63 to 32.4% with bat CoV-HKU4. The amino acid sequence alignment regarding the M protein showed the similar results, but identity was generally much higher in comparison to the S protein, Figure 2.
Figure 2
3 The SARS CoV-2 S protein and autoimmunity
3.1 The SARS CoV-2 S protein and virus immune evasion strategy
Viruses often target the host’s innate immune system to bypass the immune response after infection using numerous evasion strategies (
SARS CoV-2 has also developed multiple strategies to avoid appropriate immune response by reduction of fully protective immunity and by debilitation of long-lasting immune protection or by induction of an excessive immune response causing systemic inflammation and severe tissue damage after infection (78, 79). Similar to EBV gp42, heptad repeat-1 (HR1) and heptad repeat-2 (HR2) within the SARS CoV-2 S protein play an important role in virus-target cell interaction mediating viral fusion and host cell entry (80). Both, HR1 and HR2 have the most conserved sequences in the S protein, and HR2 is critical in viral entry (81). Interestingly, the amino acids within EBV gp42, R154, N155, R157 and E160 that are included in the binding to HLA class II molecules (
Figure 3

The alignments of EBV gp42 HLA-DRB1 binding domain sequence with the SARS CoV-2 and SARS CoV-1 S protein HR2 sequence as well with the HR2 sequences from different human and bat coronaviruses. The contact domain to the HLA-DRB1 b chain in the EBV gp42 protein including the binding amino acids: R154, N155, R157 and E160 (
Table 2
| MHC DRB alleles | 15-mer peptide | Core 9-mer peptide | % Rank EL | |
|---|---|---|---|---|
| A) SARS CoV-2 RBD a | ||||
| HLA-DRB1*03.01 | ADSFVIRGDEVRQIA | IRGDEVRQI | 1.83 | 7.80* |
| DSFVIRGDEVRQIAP | 0.98 | 8.75* | ||
| SFVIRGDEVRQIAPG | 0.73 | 8.81* | ||
| FVIRGDEVRQIAPGQ | 1.67 | 15.89* | ||
| VIRGDEVRQIAPGQT | 4.16 | 29.30* | ||
| HLA.DRB3*01.01 | ADSFVIRGDEVRQIA | IRGDEVRQI | 1.54 | 13.81* |
| DSFVIRGDEVRQIAP | 0.79 | 10.90* | ||
| SFVIRGDEVRQIAPG | 0.62 | 9.22* | ||
| FVIRGDEVRQIAPGQ | 1.52 | 18.94* | ||
| VIRGDEVRQIAPGQT | 4.11 | 35.51* | ||
| B) SARS CoV-2 HR2 a | ||||
| HLA-DRB3*03.01 | RLNEVAKNLNESLID | VAKNLNESL | 1.79 | |
| LNEVAKNLNESLIDL | VAKNLNESL | 2.49 | ||
| HLA-DRB3*02.01 | RLNEVAKNLNESLID | VAKNLNESL | 3.77 | |
| HLA-DRB3*01.01 | RLNEVAKNLNESLID | VAKNLNESL | 21.58 | |
The prediction analysis of MHC class II binding peptides within SARS CoV-2 spike protein RBD and HR2.
A) The predicted HLA-DRB1*03.01 and HLA-DRB*01.013 alleles binding peptides in the receptor binding domain of the SARS CoV-2 and Omicron variants BA.5 spike protein with mutation D405N*. B) The HLA-DRB3*03.01 strong binding peptides predicted in SARS CoV-2 HR2. The HLA-DRB binding peptides are predicted using the NetMHCIIpan-4.0 method for HighQ HLA molecules (82). The output results show the Eluted Ligand mass spectrometry (EL) % Rank scores for the SARS CoV-2 spike protein RBD (P0DTC2) and for Omicron variant BA.5 with mutation D405N (viralzone.expasy.org/9556). Threshold EL % Rank value for strong binders was 1, and for weak binders was 5. * EL % Rank values for Omicron BA.5 D405N mutation. The protein sequence data from UniProt data base (
Figure 4A shows the surface views of the MultiFOLD model of the C-terminus region from aa1158 of the SARS CoV-2 spike protein homotrimer (UniProt ID - P0DTC2, SPIKE_SARS2). The key residues (K1191, N1192, N1194, E1195) are shown to be accessible on the surface in each chain as monomers and in the homotrimer complex. The top 5 alternative conformations of the model in Figure 4A are shown in Supplementary Figure 2A. In Figure 4B, the EBV gp42 protein (magenta) is shown to be interacting with chain B (cyan) of the HLA-DR1 complex (UniProt IDs - P01903, P01911, P03437, P03205; PDB ID - 1KG0). The key residues of the gp42 (R154, N155, N157 and E160) are shown to be accessible on the surface at the site of interaction with HLA-DR1. The interaction site is shown in more detail in Supplementary Figure 3A. Furthermore, the top MultiFOLD models show that HLA-DRB1 and HLA-DRB3 bind with the SARS CoV-2 spike protein homotrimer at the sites of the key residues indicated in Figures 4C, D. The top 5 predicted conformations for the targets in Figures 4C, D are shown in Supplementary Figures 2B, C respectively, and the interactions are shown in more detail in Supplementary Figures 3A, B respectively.
Figure 4

The 3D structures of the C-terminus of the SARS CoV-2 spike protein (P0DTC2, SPIKE_SARS2) and Epstein-Barr Virus (EBV) gp42 protein bound to the MHC class II Receptors HLA-DRB1 (P01911, DRB1_HUMAN) and HLA-DRB3 (P79483, DRB3_HUMAN) β-chains. The surface views are shown with the key residues labelled and highlighted in blue. (A) MultiFOLD model of the SARS CoV-2 spike (P0DTC2 - SPIKE_SARS2) homotrimer complex C-terminus region from residue 1194 onward (plDDT=0.751, pTM=0.599). (B) Crystal structure of EVB gp42 (magenta) bound to the HLA-DR1 complex (PDB ID - 1KG0). (C) MultiFOLD model of the SARS CoV-2 spike (P0DTC2 - SPIKE_SARS2) homotrimer complex C-terminus bound to HLA-DRB1 (P01911, DRB1_HUMAN) (plDDT=0.651, pTM= 0.497).(D) MultiFOLD model of the SARS CoV-2 spike (P0DTC2 - SPIKE_SARS2) homotrimer complex C-terminus bound to HLA-DRB3 (P79483, DRB3_HUMAN) (plDDT=0.627, pTM=0.485). Images of models were rendered using PyMOL (http://www.pymol.org/).
However, it is not clear whether the binding of these amino acids to HLA-DRB1 molecule has the same role in immune response evasion and in virus fusion like soluble gp42 in EBV infection. It is necessary to confirm this assumption by further studies.
3.2 The SARS CoV-2 S protein and autoimmune manifestations
An immune response to some viruses may induce autoantibodies that cross-react with self-proteins and initiate an autoimmune disease. This mainly occurs by the mechanism of molecular mimicry, when viral and host proteins share structural similarities to an extent that results in an immune attack against autoantigens due to the breakdown of self-tolerance (84, 85). The autoimmune manifestations are associated with a wide spectrum of autoantibodies that are responsible for multisystem inflammatory syndrome, i.e., severe life-threatening disease. The homology regions amongst human and viral proteins may be the main cause of pathogen-induced autoimmunity, which induce severe health conditions in COVID-19 patients, or in patients with hypersensitivity pneumonitis (86). Unfortunately, some vaccines are able to stimulate formation of autoantibodies (87). Therefore, homology between human and viral proteins is a critically important issue in vaccine development that must be solved to prevent vaccine-induced autoimmunity. Since the great majority of vaccines used for immunisation against SARS CoV-2 are based on entire S protein or on its RBD domain, one may assume that the vaccine developers have not performed detailed studies on the potential occurrence of autoimmune phenomena after vaccination, especially after multiple boosters.
There is even more evidence that SARS CoV-2 infection deregulates the immune response against virus that often supports the development of autoimmune phenomena in COVID-19 patients (88). The deregulated immune response provoked by SARS-CoV-2 infection is characterised by hyper inflammation, coagulopathy and autoimmunity (89, 90). Although the majority of individuals infected with SARS CoV-2 are asymptomatic or with mild symptoms, a certain proportion of infected patients in intensive care units develop severe coagulopathy, hyperinflammation and autoimmunity (91). Unfortunately, multiple autoantibodies have been also reported after vaccination (92–94).
Autoantibodies are also detected in patients with post-COVID syndrome (95). When authors analysed sera from hundred patients with post-COVID syndrome and the presence of latent autoimmunity and poly-autoimmunity has been detected in 83% and 62% of patients, respectively. SARS-CoV-2 specific IgG antibodies were present in > 85% of patients, and they correlated positively with latent autoimmunity. Similar results presented Moody et al. (96).
However, it is not clear whether autoantibodies originate from a strong immune response to the S protein that potentiate a higher production of pre-existing autoantibodies or from an immune response against cross-reactive epitope(s) within the S protein or other SARS CoV-2 proteins. The most likely candidate that could induce cross-reactive antibodies is the RGD motif within the SARS CoV-2 S protein RBD. The RGD motif is known to support binding of coagulation proteins, such as fibrinogen and thrombin, to target integrin αIIbβ3 on platelets and their progenitors (97), but also binding of adhesion protein fibronectin to integrins exposed on endothelial cells (
3.3 The SARS CoV-2 S protein and autoimmunity in relation to HLA Class II alleles
We assume that the majority of autoimmune diseases that appear in COVID-19 and post-COVID syndrome may be linked to the single or multiple HLA alleles, and individuals with such an allele have and increased risk of developing an autoimmune disease (98). The HLA system plays key roles in the immune response, and predisposition to certain autoimmune disease is strongly associated with some of the HLA alleles that control the antigen presentation to T cells (99), and most frequently for ancestral haplotype-1 (AH8.1): HLA-A*01:01-C*07:01-B*08:01-DRB1*03:01-DQA1*05:01-DQB1*02:01. The HLA-DRB1*03 allele is a common allele in European populations and is the most frequent HLA allele included in AH8.1 (100, 101). AH8.1 has been found as a genetic factor responsible for susceptibility to several autoimmune diseases that are characterised by the low level of IgG2 type antibodies during the immune response to pathogens (102).
Candore et al. (103) have shown that individuals with A*01-B*08-DR3 haplotype have a defect in early T-cell activation and decreased production of IL2, IFNγ and IL12 as well as decreased natural killer cell activity (104). Moreover, the HLA-DRB3 allele, one of the most polymorphic HLA-DRB gene, is also linked to some autoimmune diseases (105) and to high responders against human platelet antigen-1a (HPA-1a) (106, 107).
The prediction of B- and T-cell epitopes within the known protein amino acid sequence by bioinformatics analysis and their confirmation by various bioassays in vitro is very important issue in vaccine development against the specific pathogen (108). After analysis, potential epitopes that could induce cross-reactive antibodies, i.e., epitopes that may cause an autoimmune response should not be included in the vaccine formulation. Vaccines that are not checked for such epitopes could cause autoimmune manifestations in vaccinated individuals, especially in individuals previously exposed to pathogen, e.g., SARS CoV-2 (91).
Recently published data on association of anti-SARS CoV-2 vaccine and myositis-related auto-antibodies that are reported after vaccination showed that HLA-DRB3.01 allele was one of the most prevalent alleles in affected patients (109). However, there are certainly other epitopes within SARS CoV-2 proteins, especially within S protein, which may be involved in triggering of an autoimmune response, both after infection and after vaccination, especially after multiple boosters.
Several autoimmune diseases are associated with HLA-DRB1*03.01 allele (110–112), but also with hyper immunoreactivity and rapid progression to the acquired immunodeficiency syndrome in HIV-1 infected patients (113). Furthermore, the HLA-DRB3* 01.01 allele indicates a predisposition to immunisation against human platelet antigen-1a (HPA-1a) in foetal and neonatal alloimmune thrombocytopenia (114) and its association with autoimmune disorders affecting the coagulation system during COVID-19 could be also assumed.
An initial step in the development of an adaptive immune response following infection with pathogens like SARS CoV-2 is the CD4+ T cell activation after recognition of antigenic peptides presented by HLA class II molecules on antigen presenting cells (APC). Activation of CD4+ T cells helps B cells to undergo isotype switching and develop antibodies with a higher affinity than those generated after T cell-independent activation (115, 116). Therefore, we assume that infected or vaccinated individuals could develop T-cell dependent antibody response to RGD motif within S protein RBD if it is included in an HLA class II binding peptide that is presented to B-cells by APCs.
We performed predictive analyses of HLA class II allele binding peptides within SARS CoV-2 S protein RBD for HLA-DRB1*03 and HLA-DRB3*01 alleles using improved NetMHCIIpan-4.0 method (117), which has been evaluated as an accurate method (118), such as NN-align and the IEDB consensus methods (119). The HLA class II allele binding peptide prediction analysis detected two identical strong binding and two weak binding HLA-DRB1*03:01 and HLA-DRB3*01.01 specific 15-mer peptides, which included the RGD motif in the core 9-mer peptide IRGDEVRQI, Table 2. It is known that the 9-mer core region within the 15-mer HLA class II binding peptide largely determines its binding affinity and specificity (119). The Eluted Ligand mass spectrometry (EL %) values of the SARS CoV-2 S protein RBD strong binding 15-mer peptides have shown high binding affinity to HLA-DRB1*03:01 and DRB3*01.01. Interestingly, the binding affinity of these peptides is significantly decreased and the predicted % Rank EL values were not in a positive range when the peptides included the D405N mutation in Omicron BA.2, BA.4 or BA.5 variants (viralzone.expasy.org/9556), Table 2.
3.4 Antibodies to the RGD motif in infection
The RGD motif is present in coagulation proteins such as fibrinogen and thrombin, as well as in other proteins involved in the coagulation process like fibronectin and vWF, and when developed, the RGD specific antibodies may interfere with the binding to target integrin αIIbβ3 on platelets and deregulate the coagulation process (97). According to the HLA class II binding peptide prediction results presented in Table 2, primarily the RGD motif specific antibodies may be expected in HLA-DRB1*01.03 or HLA-DRB3*01 positive individuals.
The antigenicity of the RGD motif has been evaluated by Yano et al. (120). They have shown that RGD motif remarkably enhanced peptide immunogenicity characterised on average by a 10x increase in antibody titre, when incorporated into the peptide sequence of a candidate vaccine. These data on the RGD motif antigenicity strongly support our prediction results for HLA class II binding peptides, Table 2.
Furthermore, Mohri et al. (121) have shown that anti-fibrinogen polyclonal antibody was capable of increasing the fibrinogen binding affinity to platelet αIIbβ3 integrin, which caused subsequent platelet activation and aggregation in vitro. Similarly, Althaus et al. (122) demonstrated that IgG fraction from severe COVID-19 patients was able to induce the FcγIIa receptor dependent procoagulant platelets that may contribute to the thromboembolic complications, but the antibody specificity and target epitope(s) were not determined in this study. However, it is not clear if these antibodies could affect the coagulation process and inflammatory response in vivo. One possibility is that fibrinogen/RGD antibody immune complexes bind to the platelet low-affinity receptor FcγRIIa via IgG Fc fragment (123, 124). This has been observed in infection with influenza virus H1N1 where the platelet activation occurs through stimulation of FcγRIIA receptor and thrombin generation (125). Therefore, we assume that the engagement of FcγRIIa receptor after antibody binding and triggering of the platelet activation and aggregation may be causally linked to the thromboembolic events in COVID-19 patients and in some vaccinees if they develop the RGD motif specific antibodies.
Interestingly, the RGD motif specific IgG antibodies have been previously detected in commercial intravenous immunoglobulin (IVIg) preparations (126). The authors used the RGD sequence-containing peptide AVTGRGDSPA to determine the antibody specificity. These antibodies are either innate antibodies or they originate from an immune response to the RGD motif present in the protein epitopes from other human viruses. Thrombotic events are also an increasingly recognised complication of treatment with IVIg preparation (127, 128), especially in patients with autoimmune disorders (129). Accordingly, since 2013 all commercial IVIg products have a safety warning about the potential risk of thromboembolic events after treatment.
Fibrinogen is also involved in inflammation as well in the promotion of autoimmune diseases such as rheumatoid arthritis (RA), chronic obstructive pulmonary disease, vasculitis and some other autoimmune disorders (97, 130, 131). Besides RA, ankylosing spondylitis and lupus nephritis are also associated with the disorder of the coagulation system and antibodies against citrullinated fibrinogen are frequently present in RA patients, and activation of the coagulation and fibrinolytic processes in the joints and in the circulation induce the inflammatory joint disease (132–135). It is possible that mainly SARS CoV-2 infected HLA-DRB1*03:01 and/or HLA-DRB3*01.01 positive patients develop RGD motif specific antibodies with higher affinity that react with fibrinogen or thrombin RGD motif and cause severe hypercoagulability complications during the coagulation process and fibrinolysis. Consequently, since fibrinogen and thrombin also play an important role in inflammation and autoimmunity (136), the deregulated coagulation process may also significantly contribute to inflammation and autoimmunity in COVID-19.
The role of HLA in COVID-19 pathogenesis is strongly supported by the findings showing a significant positive correlation of the HLA-A*: 01:01g-B*08:01g-C*07:01g-DRB1*03:01g haplotype with both COVID-19 incidence and mortality in the Italian population (suggestive of susceptibility), whereas haplotype HLA-A*02.01g-B*18.01g-C*07.01g-DRB1*11.04g showed a negative significant correlation (suggestive of protection) (137).
3.5 Antibodies to the RGD motif following vaccination
Long-lived high-affinity antibodies are the essential requirement for the successful vaccination strategies that could induce an effective defence against a particular pathogen. However, much attention has to be paid to possible autoimmune manifestations following vaccination, especially when infection with a target pathogen causes the appearance of autoantibodies (95).
The entire immune response to SARS CoV-2 vaccines depends on the presenting form of the S protein in a particular vaccine formulation. Therefore, antibodies to the S protein RGD motif immune epitope could be expected after vaccination with unmodified wild type S protein with the exposed RGD motif located on the loop surface of the RBD domain.
Rarely, following vaccination, some vaccinees experienced coagulation events that are very similar to what is described for heparin induced thrombocytopenia, including thrombosis in atypical sites caused by antibodies against platelet factor 4 (138–140). However, the existence of the RGD motif specific antibodies in COVID-19 patients and in vaccinees with thromboembolic complication needs to be proven, and the possible role of the HLA- DRB1*03 and DRB3*01 alleles in susceptibility to thromboembolic complications and autoimmune manifestations in SARS CoV-2 infected patients as well as in vaccinated individuals should be extensively investigated.
4 Discussion
We have discussed the hypothesis that the integrin binding motifs RGD, LDI and ECD within the SARS CoV-2 S protein bind to target integrins present on the host platelets and endothelial cells in the course of infection and play an important role in deregulated coagulation, inflammation, and autoimmune manifestations in COVID-19. On the basis of previous data and our analyses of protein structures using MultiFOLD models and multimers of known stoichiometry (
Table 3
| Motif | Position | Target integrin (s) | Target cells/molecules | COVID-19 pathology |
|---|---|---|---|---|
| RGD | aa403-405 | αIIbβ3 ( α5β1 ( αvβ3 ( | Platelets Endothelial cells Vitronectin | Coagulation disorders Infection of ACE2 negative cells |
| LDI | aa585-587 | α4β1 ( α5β1 ( α4β7 ( | Fibronectin CS1 region Endothelial cells CD4+ lymphocytes | Uncontrolled inflammatory response |
| ECD | aa661-663 | αvβ3 ( α5β1 ( | Endothelial cells | Inflammation Apoptosis ADAM-17 activation |
The summary of the possible SARS CoV-2 spike protein motifs interaction with the cell membrane integrins in COVID-19 pathology.
The most important references supporting the hypothesis are shown.
Furthermore, based on the prediction analysis of HLA class II binding peptides within the S protein RBD domain, an antibody response against the S protein RGD motif may be directed also against the RGD motif in the host plasma proteins that play an important role in coagulation process like fibrinogen or thrombin causing deregulation of their function. However, the most intriguing finding is the presence of amino acids within the S protein HR2 that are identical to those previously shown to be crucial in binding of the soluble EBV gp42 to HLA-DRB1 molecules, which plays an important role in EBV immune response evasion (
Statements
Data availability statement
The original contributions presented in the study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author.
Author contributions
All authors listed have made a substantial, direct, and intellectual contribution to the work, and approved it for publication.
Funding
This work was supported by the Biotechnology and Biological Sciences Research Council (BBSRC) (BB/T018496/1 to LM).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2023.1177691/full#supplementary-material
References
1
BarczykMCarracedoSGullbergD. Integrins. Cell Tissue Res (2010) 339:269–80. doi: 10.1007/s00441-009-0834-6
2
Kasirer-FriedeAKahnMLShattilSJ. Platelet integrins and immunoreceptors. Immunol Rev (2007) 218:247–64. doi: 10.1111/j.1600-065X.2007.00532.x
3
SeguinLDesgrosellierJCWeisSMChereshDA. Integrins and cancer: regulators of cancer stemness, metastasis, and drug resistance. Trends Cell Biol (2015) 25:234–40. doi: 10.1016/j.tcb.2014.12.006
4
HynesRO. Integrins: versatility, modulation, and signalling in cell adhesion. Cell (1992) 69:11–25. doi: 10.1016/0092-8674(92)90115-S
5
StewartPLNemerowGR. Cell integrins: commonly used receptors for diverse viral pathogens. Trends Microbiol (2007) 15:500–7. doi: 10.1016/j.tim.2007.10.001
6
HusseinHAMWalkerLRAbdel-RaoufUMDesaukySAMontasserAKMAkulaSM. Beyond RGD: virus interactions with integrins. Arch Virol (2015) 160:2669–81. doi: 10.1007/s00705-015-2579-8
7
SigristCJBridgeALe MercierP. A potential role for integrins in host cell entry by SARS-CoV-2. Antiviral Res (2020) 177:104759. doi: 10.1016/j.antiviral.2020.104759
8
Mezu-NdubuisiOJMaheshwariA. The role of integrins in inflammation and angiogenesis. Pediatr Res (2021) 89:1619–26. doi: 10.1038/s41390-020-01177-9
9
XiaoJPalefskyJMHerreraRBerlineJTugizovSM. The Epstein-Barr virus BMRF-2 protein facilitates virus attachment to oral epithelial cells. Virology (2008) 370:430–42. doi: 10.1016/j.virol.2007.09.012
10
HuangJLiXShiXZhuMWangJHuangXet al. Platelet integrin αIIbβ3: signal transduction, regulation, and its therapeutic targeting. J Hematol Oncol (2019) 12:26. doi: 10.1186/s13045-019-0709-6
11
BennettJS. Platelet-fibrinogen interactions. Ann N Y Acad Sci (2001) 936:340–54. doi: 10.1111/j.1749-6632.2001.tb03521.x
12
WallsACParkY-JTortoriciMAWallAMcGuireATVeeslerD. Structure, function, and antigenicity of the SARS-CoV-2 spike glycoprotein. Cell (2020) 180:1–12.
13
YanRZhangYLiYXiaLGuaoYZhouQ. Structural basis for the recognition of SARS-CoV-2 by full-length human ACE2. Science (2020) 367:1444–8. doi: 10.1126/science
14
SimonsPRinaldiDABonduVKellAMBradfuteSLidkeDSet al. Integrin activation is an essential component of SARS-CoV-2 infection. Sci Rep (2021) 11:20398. doi: 10.1038/s41598-021-99893-7
15
MakowskiLOlson-SidfordWWWeiselJ. Biological and clinical consequences of integrin binding via a rogue RGD motif in the SARS CoV-2 spike protein. Viruses (2021) 13:146. doi: 10.3390/v13020146
16
RotaPAObersteMSMonroeSSNixWACampagnoliRIcenogleJPet al. Characterization of a novel coronavirus associated with severe acute respiratory syndrome. Science (2003) 300:1394–9. doi: 10.1126/science.1085952
17
The UniProt Consortium. UniProt: the universal protein knowledgebase in 2021. Nucleic Acids Res (2021) 49:D1. doi: 10.1093/nar/gkaa1100
18
PlowEFHaasTAZhangLLoftusJSmithJW. Ligand binding to integrins. J Biol Chem (2000) 275:21785–8. doi: 10.1074/jbc.R000003200
19
ChereshDASmithJWCooperHMQurantaV. Recognition of distinct adhesive sites on fibrinogen by related integrins on platelets and endothelial cells. Cell (1989) 58:945–53. doi: 10.1016/0092-8674(89)90946-X
20
SuehiroKMizuguchiJNishiyamaKIwanagaSFarrellDHOhtakiS. Fibrinogen binds to integrin alpha5beta1 via the carboxyl-terminal RGD site of the aalpha-chain. J Biochem (2000) 128:705–10. doi: 10.1093/oxfordjournals
21
GrobbelaarLMVenterCVlokMNgoepeMLaubscherGJLourensPJet al. SARS-CoV-2 spike protein S1 induces fibrin(ogen) resistant to fibrinolysis: implications for microclot formation in COVID-19. Biosci Rep (2021) 41:BSR20210611. doi: 10.1042/BSR20210611
22
HammingITimensWBulthuisMLCLelyATvan GoorH. Tissue distribution of ACE2 protein, the functional receptor for SARS coronavirus. A first step understanding SARS pathogenesis. J Pathol (2004) 203:631–7. doi: 10.1002/path.1570
23
KloudaTHaoYKimHKimJOlejnikJHumeAJet al. Interferon-alpha or -beta facilitates SARS-CoV-2 pulmonary vascular infection by inducing ACE2. Angiogenesis (2022) 25:225–40. doi: 10.1007/s10456-021-09823-4
24
PatelABVermaA. Nasal ACE2 levels and COVID-19 in children. JAMA (2020) 323:2386–7. doi: 10.1001/jama.2020.8946
25
NicosiaRFLigrestiGCaporarelloNAkileshSRibattiD. COVID-19 vasculopathy: mounting evidence for an indirect mechanism of endothelial injury. Am J Pathol (2021) 191:1374–84. doi: 10.1016/j.ajpath.2021.05.007
26
NaderDFletcherNCurleyGFKerriganSW. SARS-CoV-2 uses major endothelial integrin αvβ3 to cause vascular dysregulation in-vitro during COVID-19. PloS One (2021) 16:e0253347. doi: 10.1371/journal.pone.0253347
27
BeaudoinCAHamaiaSWHuangCL-HBlundellTLJacksonAP. Can the SARS-CoV-2 spike protein bind integrins independent of the RGD sequence? Front Cell Infect Microbiol (2021) 11:765300. doi: 10.3389/fcimb.2021.765300
28
RobsonKJHallJRJenningsMWHarrisTJMarshKNewboldCIet al. A highly conserved amino-acid sequence in thrombospondin, properdin and in proteins from sporozoites and blood stages of a human malaria parasite. Nature (1988) 335:79–82. doi: 10.1038/335079a0
29
SianoJPGradyKKMilletPWickTM. Plasmodium falciparum: cytoadherence to alpha(v)beta3 on human microvascular endothelial cells. Am J Trop Med Hyg (1998) 59:77–9. doi: 10.4269/ajtmh.1998.59.77
30
DundasKShearsMYSunYHoppCSCrosnierCMetcalfTet al. Alpha-v-containing integrins are host receptors for the plasmodium falciparum sporozoite surface protein, TRAP. PNAS USA (2018) 115:4477–82. doi: 10.1073/pnas.1719660115
31
ChesnokovOMerrittJTcherniukSOMilmanNOleinikovAV. Plasmodium falciparum infected erythrocytes can bind to host receptors integrins αVβ3 and αVβ6 through DBLδ1_D4 domain of PFL2665c PfEMP1 protein. Sci Rep (2018) 8:17871. doi: 10.1038/s41598-018-36071-2
32
GavrilovskayaINShepleyMShawRGinsbergMHMackowER. Beta3 integrins mediate the cellular entry of hantaviruses that cause respiratory failure. PNAS USA (1998) 95:7074–9. doi: 10.1073/pnas.95.12.7074
33
JoyceAKOliverTTKofmanADTalkerDLSafaeianSBarcliftDPet al. Hantavirus disease and COVID-19: evaluation of the hantavirus 5-point screen in 139 COVID-19 patients. Am J Clin Pathol (2022) 157:470–5. doi: 10.1093/ajcp/aqab155
34
HumphriesJDByronAHumphriesMJ. Integrin ligands at a glance. J Cell Sci (2006) 119:3901–3. doi: 10.1242/jcs.03098
35
MeyerAAuernheimerJModlingerAKesslerH. Targeting RGD recognizing integrins: drug development, biomaterial research, tumor imaging and targeting. Curr Pharm Des (2006) 12:2723–47. doi: 10.2174/138161206777947740
36
AlipourMBaneshiMHosseinkhamiSMahmoudiRArabzadehAJAkramiMet al. Recent progress in biomedical applications of RGD-based ligand: from precise cancer theranostics to biomaterial engineering: a systematic review. J Biomed Mater Res A. (2020) 108:839–50. doi: 10.1002/jbm.a.36862
37
ZhaoJSantinoFGiacominiDGentilucciL. Integrin-targeting peptides for the design of functional cell-responsive biomaterials. Biomedicines (2020) 8:307. doi: 10.3390/biomedicines8090307
38
SlackRJMacdonaldSJFRoperJAJenkinsRGHatleyRJD. Emerging therapeutic opportunities for integrin inhibitors. Nat Rev Drug Discov (2022) 21:60–78. doi: 10.1038/s41573-021-00284-4
39
ChakrabortySHuS-YWuS-HKarmenianAChiouA. The interaction affinity between vascular cell adhesion molecule-1 (VCAM-1) and very late antigen-4 (VLA-4) analyzed by quantitative FRET. PloS One (2015) 10:e0121399. doi: 10.1371/journal.pone.0121399
40
KomoriyaAGreenLJMervicMYamadaSSYamadaKMHumphriesMJ. The minimal essential sequence for a major cell type-specific adhesion site (CS1) within the alternatively spliced type III connecting segment domain of fibronectin is leucine-aspartic acid-valine. J Biol Chem (1991) 266:15075–9. doi: 10.1016/S0021-9258(18)98588-1
41
LobbRRHemlerMR. The pathophysiologic role of alpha 4 integrinsin vivo. J Clin Invest (1994) 94:1722–8. doi: 10.1172/JCI117519
42
ImaiYShimaokaMKurokawaM. Essential roles of VLA-4 in the hematopoietic system. Int J Hematol (2010) 91:569–75. doi: 10.1007/s12185-010-0555-3
43
HuoYHafezi-MoghadamALeyK. Role of vascular cell adhesion molecule-1 and fibronectin connecting segment-1 in monocyte rolling and adhesion on early atherosclerotic lesions. Circ Res (2000) 87:153–9. doi: 10.1161/01.RES.87.2.153
44
LiuJLuFChenYPlowEQinJ. Integrin mediates cell entry of the SARS-CoV-2 virus independent of cellular receptor ACE2. J Biol Chem (2022) 298:101710. doi: 10.1016/j.jbc.2022.101710
45
TresoldiISangiuoloCFManzariVModestiA. SARS-COV-2 and infectivity: possible increase in infectivity associated to integrin motif expression. J Med Virol (2020) 92:1741–2. doi: 10.1002/jmv.25831
46
EpsteinCJ. Non-randomness of ammo-acid changes in the evolution of homologous proteins. Nature (1967) 215:355–9. doi: 10.1038/215355a0
47
HaitSHSoaresEASprinzEArthosJMachadoESSoaresMA. Worldwide genetic features of HIV-1 env a4b7 binding motif: the local dissemination impact of the LDI tripeptide. J Acq Immun Def Synd (2015) 70:463–71.
48
ArthosJCicalaCMartinelliEMacleodKVan RykDWeiD. HIV-1 envelope protein binds to and signals through integrin alpha4beta7, the gut mucosal homing receptor for peripheral T cells. Nat Immunol (2008) 9:301–9. doi: 10.1038/ni1566
49
RichardsonSIGrayESMkhizeNNShewardDJLambsonBEWibmerCKet al. South African HIV-1 subtype c transmitted variants with a specific V2 motif show higher dependence on α4β7 for replication. Retrovirology (2015) 12:54. doi: 10.1186/s12977-015-0183-3
50
SealsDFCourtneidgeSA. The ADAMs family of metalloproteases: multidomain proteins with multiple functions. Genes Dev (2003) 17:7–30. doi: 10.1101/gad.1039703
51
EdwardsDRHandsleyMMPenningtonCJ. The ADAM metalloproteinases. Mol Aspects Med (2008) 29:258–89. doi: 10.1016/j.mam.2008.08.001
52
GardinerEEKarumakaranDShenYArthurJFAndrewsRKBerndtMC. Controlled shedding of platelet glycoprotein (GP)VI and GPIb-IX-V by ADAM family metalloproteinases. J Thromb Haemost (2007) 5:1530–7. doi: 10.1111/j.1538-7836.2007.02590
53
MossMLJinSLMillaMFBicketDMBurkhardWCarterHLet al. Cloning of a disintegrin metalloproteinase that processes precursor tumour-necrosis factor-alpha. Nature (1997) 385:733–6. doi: 10.1038/385733a0
54
HikitaATanakaNYamaneSIkedaYFurukawaHTohmaSet al. Involvement of a disintegrin and metalloproteinase 10 and 17 in shedding of tumor necrosis factor-alpha. Biochem Cell Biol (2009) 87:581–93. doi: 10.1139/o09-015
55
de Seabra Rodrigues DiasIRCaoZKwokHF. Adamalysins in COVID-19 - potential mechanisms behind exacerbating the disease. Biomed Pharmacother (2022) 150:112970. doi: 10.1016/j.biopha.2022.112970
56
HeurichAHofmann-WinklerHGiererSLiepoldTJahnOPohlmannS. TMPRSS2 and ADAM17 cleave ACE2 differentially and only proteolysis by TMPRSS2 augments entry driven by the severe acute respiratory syndrome coronavirus spike protein. J Virol (2014) 88:1293–307. doi: 10.1128/JVI.02202-13
57
SchreiberBPatelAVermaA. Shedding light on COVID-19: ADAM17 the missing link? Am J Therap (2021) 28:e358-e360. doi: 10.1097/MJT.0000000000001226
58
BlobelCPWhiteJM. Structure, function and evolutionary relationship of proteins containing a disintegrin domain. Curr Opin Cell Biol (1992) 4:760–5. doi: 10.1016/09550674(92)90098-w
59
ZigrinoPSteigerJFoxJWLoffekSSchildANischtRet al. Role of ADAM-9 disintegrin-cysteine-rich domains in human keratinocyte migration. J Biol Chem (2007) 282:30785–93. doi: 10.1074/jbcM701658200
60
ZhongSKhalilRA. A disintegrin and metalloproteinase (ADAM) and ADAM with thrombospondin motifs (ADAMTS) family in vascular biology and disease. Biochem Pharmacol (2019) 164:188–204. doi: 10.1016/j.bcp.2019.03.033
61
BaxDVMessentAJTartJvan HoangMKottJMaciewiczRAet al. Integrin α5β1 and ADAM-17 interact in vitro and Co-localize in migrating HeLa cells. J Biol Chem (2004) 279:22377–86. doi: 10.1074/jbc.M400180200
62
GoozPDangYHigashiyamaSRwalWOHaycraftCJGoozM. A disintegrin and metalloenzyme (ADAM) 17 activation is regulated by α5β1 integrin in kidney mesangial cells. PloS One (2012) 7:e33350. doi: 10.1371/journal.pone.0033350
63
WangWJ. Acurhagin-c, an ECD disintegrin, inhibits integrin alphavbeta3-mediated human endothelial cell functions by inducing apoptosis via caspase-3 activation. Br J Pharmacol (2010) 160:1338–51. doi: 10.1111/j.1476-5381.2010.00781
64
BrassardDLMaxwellEMalkowskiMNagabhushanTLKumarCCArmstrongL. Integrin alpha(v) beta (3)-mediated activation of apoptosis. Exp Cell Res (1999) 2:33–45. doi: 10.1006/excr.1999.4559
65
BuckleyCDPillingDHenriquezNVParsonageGThrellfallKScheel-ToellnerDet al. RGD peptides induce apoptosis by direct caspase-3 activation. Nature (1999) 397:534–9. doi: 10.1038/17409
66
CainiSKronemanMWiegersTEl Guerche-SeblainCPagetJ. Clinical characteristics and severity of influenza infections by virus type, subtype, and lineage: a systematic literature review. Influenza Other Respir Viruses (2018) 12:780–92. doi: 10.1111/irv.12575
67
ArmstrongSMDarwishILeeWL. Endothelial activation and dysfunction in the pathogenesis of influenza a virus infection. Virulence (2013) 4:537–42. doi: 10.4161/viru.25779
68
McGuffinLJEdmundsNSGencAGAlharbiSMASaleheBRAdiyamanR. Prediction of protein structures, functions and interactions using the IntFOLD7, MultiFOLD and ModFOLDdock servers. Nucleic Acids Res (2023), gkad297. doi: 10.1093/nar/gkad297
69
TsibaneTPearceMTiveyARNBasutkarPLeeJEdbaliOet al. Influenza human monoclonal antibody 1F1 interacts with three major antigenic sites and residues mediating human receptor specificity in H1N1 viruses. PloS Pathog (2012) 8:e1003067–e1003067. doi: 10.1371/journal.ppat.1003067
70
JumperJWangQHuangHHuangWChenYMcGarveyPBet al. Highly accurate protein structure prediction with AlphaFold. Nature (2021) 596:583–9. doi: 10.1038/s41586-021-03819-2
71
MadeiraFPearceMTiveyARNBasutkarPLeeJEdbaliOet al. Search and sequence analysis tools services from EMBL-EBI in 2022. Nucleic Acids Res (2022), gkac240. doi: 10.1093/nar/gkac240
72
WangYWangQHuangHHuangWChenYMcGarveyPBet al. UniProt Consortium. A crowdsourcing open platform for literature curation in UniProt. PloS Biol (2021) 19:e3001464. doi: 10.1371/journal.pbio.3001464
73
NelemansTKikkertM. Viral innate immune evasion and the pathogenesis of emerging RNA virus infections. Viruses (2019) 11:961. doi: 10.3390/v11100961
74
KikkertM. Innate immune evasion by human respiratory RNA viruses. J Innate Immun (2020) 12:4–20. doi: 10.1159/000503030
75
SpriggsMKEkiertIAKrauseJCMartinezOCroweJEJrWilsonIAet al. The extracellular domain of the Epstein-Barr virus BZLF2 protein binds the HLA-DR beta chain and inhibits antigen presentation. J Virol (1996) 70:5557–63. doi: 10.1128/jvi.70.8.5557-5563.1996
76
MullenMMHaanKMLongneckerRJardetzkyTS. Structure of the Epstein-Barr virus gp42 protein bound to the MHC class II receptor HLA-DR1. Mol Cell (2002) 9:375–85. doi: 10.1016/s1097-2765(02)00465-3
77
RessingMEHorstDGriffinBDTellamJZuoJKhannaRet al. Epstein-Barr Virus evasion of CD8(+) and CD4(+) T cell immunity via concerted actions of multiple gene products. Semin Cancer Biol (2008) 18:397–408. doi: 10.1016/j.semcancer.2008.10.008
78
van der HoekL. Human coronaviruses: what do they cause? Antivir Ther (2007) 12(4 Pt B):651–8. doi: 10.1177/135965350701200S01.1
79
LiXGengMPengYMengLLuS. Molecular immune pathogenesis and diagnosis of COVID-19. J Pharm Anal (2020) 10:102–8. doi: 10.1016/j.jpha.2020.03.001
80
LiuSXiaoGChenYHeYNiuJEscalanteCet al. Interaction between heptad repeat 1 and 2 regions in spike protein of SARS-associated coronavirus: implications for virus fusogenic mechanism and identification effusion inhibitors. Lancet (2004) 363:938–47. doi: 10.1016/S0140-6736(04)15788-7
81
CeligoyJRamirezBCaffreyM. SARS-CoV heptad repeat 2 is a trimer of parallel helices. Protein science: Publ Protein Soc (2011) 20:2125–9. doi: 10.1002/pro.736
82
ReynissonBBarraCKaabinejadianSHildebrandWHPetersBNielsenM. Improved prediction of MHC II antigen presentation through integration and motif deconvolution of mass spectrometry MHC eluted ligand data. J Proteome Res (2020) 19(6):2304–15. doi: 10.1021/acs.jproteome.9b00874
83
AhmedSFQuadeerAAMcKayMR. Preliminary identification of potential vaccine targets for the COVID-19 coronavirus (SARS-CoV-2) based on SARS-CoV immunological studies 2020. Viruses (2020) 12:254. doi: 10.3390/v12030254
84
GettsDRChastainEMLTerryRLMillerSD. Virus infection, antiviral immunity, and autoimmunity. Immunol Rev (2013) 255:197–209. doi: 10.1111/imr.12091
85
HusseinHMRahalEA. The role of viral infections in the development of autoimmune diseases. Crit Rev Microbiol (2019) 45:394–412. doi: 10.1080/1040841X.2019.1614904
86
Buendía-RoldánISantiago-RuizLPerez-RubioGMejiaMRojas-SerranoJAmbrocio-OrtizEet al. A major genetic determinant of autoimmune diseases is associated with the presence of autoantibodies in hypersensitivity pneumonitis. Eur Respir J (2020) 56:1901380. doi: 10.1183/13993003.01380-2019
87
Agmon-LevinNPazZIsraeliEShoenfeldY. Vaccines and autoimmunity. Nat Rev Rheumatol (2009) 5:648–52. doi: 10.1038/nrrheum.2009.196
88
QinCZhouLHuZZhangSYangSTaoYet al. Dysregulation of immune response in patients with coronavirus 2019 (COVID-19) in wuhan, China. Clin Infect Dis (2020) 71:762–8. doi: 10.1093/cid/ciaa248
89
ChangSEFengAMengWApostolidisSAMackEArtandiMet al. New-onset IgG autoantibodies in hospitalized patients with COVID-19. Nat Commun (2021) 12:5417. doi: 10.1038/s41467-021-25509-3
90
TayMZPohCMReniaLMacAryPNgLFP. The trinity of COVID-19: immunity, inflammation and intervention. Nat Rev Immunol (2020) 20:363–74. doi: 10.1038/s41577-020-0311-8
91
Lyons-WeilerJ. Pathogenic priming likely contributes to serious and critical illness and mortality in COVID-19 via autoimmunity. J Transl Autoimmun (2020) 9:100051. doi: 10.1016/j.jtauto.2020.100051
92
Luchetti GentiloniMMFerrariSMEliaGRagusaFPaparoSRMazziVet al. SARS-COV-2 infection, vaccination, and immune-mediated diseases: results of a single-center retrospective study. Front Immunol (2022) 13:859550. doi: 10.3389/fimmu.2022.859550
93
PatrizioAFerrariSMEliaGRagusaFPaparoSRMazziVet al. Graves’ disease following SARS-CoV-2 vaccination: a systematic review. Vaccines (Basel) (2022) 10:1445. doi: 10.3390/vaccines10091445
94
ChenYXuZWangPLiX-MShuaiZ-WYeD-Qet al. New-onset autoimmune phenomena post-COVID-19 vaccination. Immunology (2022) 165:386–401. doi: 10.1111/imm.13443
95
RojasMRodriguezYAcosta-AmpudiaYMonsalveDMZhuCLiQ-Zet al. Autoimmunity is a hallmark of post-COVID syndrome. J Transl Med (2022) 20:129. doi: 10.1186/s12967-022-03328-4
96
MoodyRSondaSJohnstonFHSmithKJStephensNMcPhersonMet al. Antibodies against spike protein correlate with broad auto-antigen recognition 8 months post SARS-CoV-2 exposure, and anti-calprotectin autoantibodies associated with better clinical outcomes. Front Immunol (2022) 13:945021. doi: 10.3389/fimmu.2022.945021
97
Sánchez-CortésJMrksichM. The platelet integrin alphaIIb/beta3 binds to the RGD and AGD motifs in fibrinogen. Chem Biol (2009) 16:990–1000. doi: 10.1016/j.chembiol.2009.08.012
98
McDevittH. The discovery of linkage between the MHC and genetic control of the immune response. Immunol Rev (2002) 185:78–85. doi: 10.1034/j.1600-065x.2002.18509.x
99
MosaadYM. Clinical role of human leukocyte antigen in health and disease. Scand J Immunol (2015) 82:283–306. doi: 10.1111/sji.12329
100
Sanchez-MazasANunesJMMiddletonDSauterJBuchlerSMcCabeAet al. Common and well-documented HLA alleles over all of Europe and within European sub-regions: a catalogue from the European federation for immunogenetics. HLA (2017) 89:104–13. doi: 10.1111/tan.12956
101
PricePWittCAllockRSayerDGarleppMKokCCet al. The genetic basis for the association of the 8.1 ancestral haplotype (Al, B8, DR3) with multiple immunopathological diseases. Immunol Rev (1999) 167:257–74. doi: 10.1111/j.1600-065X.1999.tb01398.x
102
CandoreGCampagnaAMCuppariIDi CarloDMineoCCarusoCet al. Genetic control of immune response in carriers of the 8.1 ancestral haplotype: correlation with levels of IgG subclasses: its relevance in the pathogenesis of autoimmune diseases. Ann NY Acad Sci (2007) 1110:151–8. doi: 10.1196/annals.1423.017
103
CandoreGCignaDTodaroMDe MariaRStassiGGiordanoCet al. T-Cell activation in HLA-B8, DR3-positive individuals. Early antigen Expression defect vitro. Hum Immunol (1995) 42:289–94. doi: 10.1016/0198-8859(94)00103-w
104
CandoreGCignaDGervasiFColucciAModicaMACarusoCet al. In vitro cytokine production by HLA-B8, DR3 positive subjects. Autoimmunity (1994) 18:121–32. doi: 10.3109/08916939409007985
105
BoehmBOKuhnlPManfrasBJChenMLeeJCHolzbergerGet al. HLA-DRB3 gene alleles in Caucasian patients with graves’ disease. Clin Investig (1992) 70:956–60. doi: 10.1007/BF00180447
106
L’AbbéDTremblayLFilionMBusqueLGoldmanMDecaryFet al. Alloimmunization to platelet antigen HPA-1a (PIA1) is strongly associated with both HLA-DRB3∗0101 and HLA-DQB1∗0201. Hum Immunol (1992) 34:107–14. doi: 10.1016/0198-8859(92)90036-M
107
Kjeldsen-KraghJOlsenKJ. Risk of HPA-1a-immunization in HPA-1a-negative women after giving birth to an HPA-1a-positive child. Transfusion (2019) 59:1344–52. doi: 10.1111/trf.15152
108
HamlexIW. Peptides for vaccine development. ACS Appl Bio Mater (2022) 5:905–44. doi: 10.1021/acsabm.1c01238
109
García-BravoLCalle-RubioMFernandes-ArqueroMMohamedKMGuerra-GalanTGuzman-FulgencioMet al. Association of anti-SARS-COV-2 vaccine with increased incidence of myositis-related anti-RNA-synthetases auto-antibodies. J Transl Autoimmun (2022) 5:160. doi: 10.1016/j.jtauto.2022.100160
110
ArangoMTPerriconeCKivitySCiprianoECeccarelliFValesiniGet al. HLA-DRB1 the notorious gene in the mosaic of autoimmunity. Immunol Res (2017) 65:82–98. doi: 10.1007/s12026-016-8817-7
111
Zawadzka-StarczewskaKTymoniukBStasiakBLewinskiAStasiakM. Actual associations between HLA haplotype and graves’ disease development. J Clin Med (2022) 11:2492. doi: 10.3390/jcm11092492
112
GambinoMAielloAAccardiGCarusoCCandoreG. Autoimmune diseases and 8.1 ancestral haplotype: an update. HLA (2018) 92:137–43. doi: 10.1111/tan.13305
113
KaslowRAvanRadenMFriedmanHDuquesnoyRMarrariMKingsleyLet al. A1, Cw7, B8, DR3 HLA antigen combination associated with rapid decline of T-helper lymphocytes in HIV-1 infection. A Rep Multicenter AIDS Cohort Study. Lancet (1990) 335:927–30. doi: 10.1016/0140-6736(90)90995-H
114
Wienzek-LischkaSKonigIRPapenkortE-MHacksteinHSantosoSSachsUJet al. HLA-DRB3*01:01 is a predictor of immunization against human platelet antigen-1a but not of the severity of foetal and neonatal alloimmune thrombocytopenia. Transfusion (2017) 57:533–40. doi: 10.1111/trf.13950
115
RudolphMGStanfieldRLWilsonIA. How TCRs bind MHCs, peptides, and coreceptors. Annu Rev Immunol (2006) 24:419–66. doi: 10.1146/annurev.immunol.23
116
StockingerBBourgeoisCKassiotisG. CD4+ memory T cells: functional differentiation and homeostasis. Immunol Rev (2006) 211:39–48. doi: 10.1111/j.0105-2896.2006.00381x
117
AndreattaMTrolleTYanZGreenbaumJAPetersBNielsenM. An automated benchmarking platform for MHC class II binding prediction methods. Bioinformatics (2018) 34:1522–8. doi: 10.1093/bioinformatics/btx820
118
WangPSidneyJDowCMotheBSetteAPetersB. A systematic assessment of MHC class II peptide binding predictions and evaluation of a consensus approach. PloS Comput Biol (2008) 4:e1000048. doi: 10.1371/journal.pcbi.1000048
119
AndreattaMKarosieneERasmussenMStryhnABuusSNielsenM. Accurate pan-specific prediction of peptide-MHC class II binding affinity with improved binding core identification. Immunogenetics (2015) 11-12:641–50. doi: 10.1007/s00251-015-0873-y
120
YanoAOnozukaAMatinKImaiSHanadaNNisizawaT. RGD motif enhances immunogenicity and adjuvanicity of peptide antigens following intranasal immunization. Vaccine (2003) 22:237–43. doi: 10.1016/S0264-410X(03)00561-9
121
MohriHTanabeJFujitaHKanamoriHOhkuboT. Anti-fibrinogen antibody mediates fibrinogen binding to platelet membrane glycoprotein IIb-IIIa. Br J Haematol (1993) 85:341–7. doi: 10.1111/j.1365-2141.1993.tb03176.x
122
AlthausKMariniIZlamalJPelzlLSinghAHaberleHet al. Antibody-induced procoagulant platelets in severe COVID-19 infection. Blood (2021) 137:1061–71. doi: 10.1182/blood.2020008762
123
QiaoJAl-TaminiMBakerRIAndrewsRKGardinerEE. The platelet fc receptor, FcγRIIa. Immunol Rev (2015) 268:241–52. doi: 10.1111/imr.12370
124
AnaniaJCChenowethAMWinesBDHogarthPM. The human FcγRII (CD32) family of leukocyte FcR in health and disease. Front Immunol (2019) 10:464. doi: 10.3389/fimmu.2019.00464
125
BoilardEPareGRousseauMCloutierNDubucILevesqueTet al. Influenza virus H1N1 activates platelets through FcγRIIA signaling and thrombin generation. Blood (2014) 123:2854–63. doi: 10.1182/blood-2013-07-515536
126
VassilevTLKazatchkineMDVan HuyenDMekracheMBonninEManiJCet al. Inhibition of cell adhesion by antibodies to arg-Gly-Asp (RGD) in normal immunoglobulin for therapeutic use (intravenous immunoglobulin, IVIg). Blood (1999) 93:3624–31. doi: 10.1182/blood.V93.11.3624
127
ParanDHerishanuYElkayamOShopinLBen-AmiR. Venous and arterial thrombosis following administration of intravenous immunoglobulins. Blood Coagulation Fibrinolysis (2005) 16:313–8. doi: 10.1097/01.mbc.0000172694.85233.a8
128
AmmannEMJonesMPLinkBKCarnahanRMWinieckiSKTornerJCet al. Intravenous immune globulin and thromboembolic adverse events in patients with hematologic malignancy. Blood (2016) 127:200–7. doi: 10.1182/blood-2015-05-647552
129
MarieIMaureyGHerveFHellotM-FLevesqueH. Intravenous immunoglobulin-associated arterial and venous thrombosis; report of a series and review of the literature. Br J Dermatol (2006) 155:714–21. doi: 10.1111/j.1365-2133.2006.07390
130
DavalosDAkassoglouK. Fibrinogen as a key regulator of inflammation in disease. Semin Immunopathol (2012) 34:43–62. doi: 10.1007/s00281-011-0290-8
131
RyuJPetersenMAMurraySGBaetenKMMeyer-FrankeAChanJPet al. Blood coagulation protein fibrinogen promotes autoimmunity and demyelination via chemokine release and antigen presentation. Nat Commun (2015) 6:8164. doi: 10.1038/ncomms91644
132
SoAKVariscoP-AKemkes-MatthesBHerkenne-MorardCChobaz-PechatVGersterJ-Cet al. Arthritis is linked to local and systemic activation of coagulation and fibrinolysis pathways. J Thromb Haemost (2003) 1:2510–5. doi: 10.1111/j.1538-7836.2003.00462.x
133
XueLTaoLLiXWangYWangBZhangYet al. Plasma fibrinogen, d-dimer, and fibrin degradation product as biomarkers of rheumatoid arthritis. Sci Rep (2021) 11:16903. doi: 10.1038/s41598-021-96349-w
134
HejblumBPCuiJLaheyLJCaganASparksJASokoloveJet al. Association between anti-citrullinated fibrinogen antibodies and coronary artery disease in rheumatoid arthritis. Arthritis Care Res (Hoboken) (2018) 70(7):1113–7. doi: 10.1002/acr.23444
135
Van BeersJJBCRaijmakersRAlexanderL-EStammen-VogelzangsJLokateAMCHeckAJRet al. Mapping of citrullinated fibrinogen b-cell epitopes in rheumatoid arthritis by imaging surface plasmon resonance. Arthritis Res Ther (2010) 12:R219. doi: 10.1186/ar3205
136
GőbelKEichlerSWiendlHChavakisTKleinschnitzCMeuthSGet al. The coagulation factors fibrinogen, thrombin, and factor XII in inflammatory disorders – a systematic review. Front Immunol (2018) 9:1731. doi: 10.3389/fimmu.218.01731
137
PisantiSDeelenJGallinaAMCaputoMCitroMAbateMet al. Correlation of the two most frequent HLA haplotypes in the Italian population to the differential regional incidence of covid-19. J Transl Med (2020) 18:352. doi: 10.1186/s12967-020-02515-5
138
HuynhAKeltonJGArnoldDMDakaMNazyI. Antibody epitopes in vaccine-induced immune thrombotic thrombocytopaenia. Nature (2021) 596:565–9. doi: 10.1038/s41586-021-03744-4
139
EMA ReportPharmacovigilance Risk Assessment Committee (PRAC). Signal assessment report on embolic and thrombotic events (SMQ) with COVID-19 vaccine (ChAdOx1-s[recombinant]) – vaxzevria (previously COVID-19 vaccine AstraZeneca) (Other viral vaccines). EMA (European Medicinal Agency) (2022).
140
ZuoYEstesSKAliRAGandhiAAYalavarthiSShiHet al. Prothrombotic autoantibodies in serum from patients hospitalized with COVID-19. Sci Transl Med (2020) 12:eabd3876. doi: 10.1126/scitranslmed.abd3876
141
BugattiAFillipiniFMessaliSGiovanettiMRavelliCZaniAet al. The D405N mutation in the spike protein of SARS-CoV-2 omicron BA.5 inhibits Spike/Integrins interaction and viral infection of human lung microvascular endothelial cells. Viruses (2023) 15(2):332. doi: 10.3390/v15020332
142
KharoufFKenigABohbotERubinLPelegHShamrizO. Increased rates of idiopathic inflammatory myopathies during the COVID-19 pandemic: a single-centre experience. Clin Exp Rheumatol (2023) 41(2):316–21. doi: 10.55563/clinexprheumatol/970881
143
De MarcoGGiryesSWilliamsKAlcornNSladeMFittonJet al. A Large cluster of new onset autoimmune myositis in the Yorkshire region following SARS-CoV-2 vaccination. Vaccines (2022) 10(8):1184. doi: 10.3390/vaccines10081184
Summary
Keywords
SARS CoV-2 spike protein, integrin binding motifs, COVID-19, deregulated coagulation, immune evasion, autoimmunity, MultiFOLD model
Citation
Gerencer M and McGuffin LJ (2023) Are the integrin binding motifs within SARS CoV-2 spike protein and MHC class II alleles playing the key role in COVID-19?. Front. Immunol. 14:1177691. doi: 10.3389/fimmu.2023.1177691
Received
01 March 2023
Accepted
22 May 2023
Published
10 July 2023
Volume
14 - 2023
Edited by
Rebeca Alonso-Arias, Central University Hospital of Asturias, Spain
Reviewed by
Abraam Yakoub, University of North Dakota, United States; Francisco Garcia-Cozar, University of Cádiz, Spain
Updates

Check for updates
Copyright
© 2023 Gerencer and McGuffin.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Marijan Gerencer, margerencer@gmail.com
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.