ORIGINAL RESEARCH article

Front. Immunol., 01 March 2024

Sec. Vaccines and Molecular Therapeutics

Volume 15 - 2024 | https://doi.org/10.3389/fimmu.2024.1369890

Construction of an aerolysin-based multi-epitope vaccine against Aeromonas hydrophila: an in silico machine learning and artificial intelligence-supported approach

  • 1. Department of Biology, College of Science, Imam Mohammad Ibn Saud Islamic University (IMSIU), Riyadh, Saudi Arabia

  • 2. Department of Clinical Laboratory Sciences, College of Applied Medical Sciences, Shaqra University, Al-Quwayiyah, Saudi Arabia

Abstract

Aeromonas hydrophila, a gram-negative coccobacillus bacterium, can cause various infections in humans, including septic arthritis, diarrhea (traveler’s diarrhea), gastroenteritis, skin and wound infections, meningitis, fulminating septicemia, enterocolitis, peritonitis, and endocarditis. It frequently occurs in aquatic environments and readily contacts humans, leading to high infection rates. This bacterium has exhibited resistance to numerous commercial antibiotics, and no vaccine has yet been developed. Aiming to combat the alarmingly high infection rate, this study utilizes in silico techniques to design a multi-epitope vaccine (MEV) candidate against this bacterium based on its aerolysin toxin, which is the most toxic and highly conserved virulence factor among the Aeromonas species. After retrieval, aerolysin was processed for B-cell and T-cell epitope mapping. Once filtered for toxicity, antigenicity, allergenicity, and solubility, the chosen epitopes were combined with an adjuvant and specific linkers to create a vaccine construct. These linkers and the adjuvant enhance the MEV’s ability to elicit robust immune responses. Analyses of the predicted and improved vaccine structure revealed that 75.5%, 19.8%, and 1.3% of its amino acids occupy the most favored, additional allowed, and generously allowed regions, respectively, while its ERRAT score reached nearly 70%. Docking simulations showed the MEV exhibiting the highest interaction and binding energies (−1,023.4 kcal/mol, −923.2 kcal/mol, and −988.3 kcal/mol) with TLR-4, MHC-I, and MHC-II receptors. Further molecular dynamics simulations demonstrated the docked complexes’ remarkable stability and maximum interactions, i.e., uniform RMSD, fluctuated RMSF, and lowest binding net energy. In silico models also predict the vaccine will stimulate a variety of immunological pathways following administration. These analyses suggest the vaccine’s efficacy in inducing robust immune responses against A. hydrophila. With high solubility and no predicted allergic responses or toxicity, it appears safe for administration in both healthy and A. hydrophila-infected individuals.

Introduction

Aeromonas hydrophila (A. hydrophila) is a gram-negative, motile, non-sporulating, coccobacillus or rod-shaped, oxidase-positive, H2S-positive, indole-positive, facultative anaerobe bacteria that belongs to the family Aeromonadaceae (1). On blood agar, it results in beta-hemolysis and has the ability to ferment carbohydrates, producing gas and acid (2). While its presence in soil has also been observed, it is primarily found in the aquatic environment, both fresh and marine waters (3). A. hydrophila is an inhabitant of fish, amphibians, and reptiles (4). Fish in rivers, estuaries, and saltwater are the main reservoirs (2). Additionally, it has proven possible to separate it from chlorinated water sources. The list of potential contaminants for developing water-borne diseases maintained by the United States Environmental Protection Agency includes Aeromonas species (5).

A. hydrophila species, which initially emerged from human feces in 1937 (3), not only infects aquatic creatures but is also linked to a variety of infectious disorders that affect both infants and adults. Geographically, infections with A. hydrophila happen everywhere, and it has been reported in more than 20 countries on six continents (6). The majority of A. hydrophila infections occur in tropical and semitropical countries, with only a small number of occurrences in temperate locations (7). As mentioned, fishes are the main reservoirs, and when these fishes are eaten by locals, it can cause a variety of infections in them. This bacterium releases a number of toxins into the water that is readily available to humans in the form of drinking water and seafood, including aerolysin, hemolysin, proteases, lipases, lecithinases, amylases, and DNases (1). The infections include septic arthritis, diarrhea (traveler’s diarrhea), gastroenteritis, skin and wound infections, meningitis, fulminating septicemia, enterocolitis, peritonitis, endocarditis, urinary tract infections (UTIs), hematologic malignancy, hepatic cirrhosis, ocular infection, pneumonia, tonsillitis, endocarditis, osteomyelitis, epiglottitis, liver abscess, pleural empyema, cholangitis, thrombophlebitis, and hemolytic uremic syndrome (HUS) (6). The incubation period of this bacterium is 1–2 days, and mortality among the population is 25%–30% (8).

A. hydrophila virulence factors are what determine its pathogenicity. Aerolysin is the most important toxin that contributes significantly to a range of infections in people infected by A. hydrophila (9). When furin protease activates aerolysin, which is produced as an inactive precursor, the toxin diffuses toward the cell and creates a homo-heptameric pore on the target cells, which can cause cell death (10). Pores formed by aerolysin cause osmotic imbalances in target cells, G-protein activation, and cell lysis (11). This toxin consists of two subunits and is composed of 493 amino acids, and strains lacking the aerolysin-encoding gene showed a significant reduction in infectivity (12). Epithelial cells are mostly vulnerable to this toxin, but studies show that erythrocytes, fibroblast cells, lymphocytes, and granulocytes are also easily destroyed (13).

Antibiotic misuse fuels the fire of bacterial resistance, of which Aeromonas hydrophila is a prime example. This globally pervasive bacterium has developed multi-resistance to a formidable arsenal of antibiotics, including penicillins, cephalosporins, lincosamides, and nalidixic acid. Particularly alarming is the high prevalence of extended-spectrum cephalosporin resistance in A. hydrophila, jeopardizing a critical line of defense against severe infections (14).

It is well known that the use of vaccines has saved millions of people against many fatal infections in the past by boosting their immune systems against those causative pathogens (15). Keeping in view the increasing ratio of A. hydrophila infections and the increased rate of antibiotic resistance across the community, vaccine production should be considered a primary and important step to overcome this problem. Traditional vaccine production takes years to synthesize an effective vaccine and is much more expensive, which can lead to late and less availability to the population, resulting in increased infection and resistance rates (16).

Modern techniques are being introduced to synthesize effective vaccine candidates in less time using bioinformatics approaches (17). Recently, the deadly pandemic of coronavirus was successfully controlled by the introduction of a vaccine against it in less than a year using bioinformatics approaches (18). The use of essential microbial proteins to map epitopes complementary to human immune receptors is known as “in silico vaccine designing”, which is a fairly novel technique (19). Some epitopes have the ability to stimulate the immune system when they are introduced into the body, which will help fight off the associated microbes (18). To date, thousands of vaccine candidates are designed against many deadly pathogens using these techniques (20). These methods are cost-effective and have reduced production time to a great extent. Keeping this importance in mind, our study focuses on the production of a potential vaccine candidate against A. hydrophila using bioinformatics approaches so that the community could be saved from this fatal pathogen.

This study was initiated by designing a multi-epitope vaccine (MEV) against the aerolysin toxin of A. hydrophila. As mentioned, aerolysin is the most potent virulence factor of A. hydrophila, and it is produced in most infections (10). Studies have also suggested that strains lacking the genes responsible for aerolysin production are noninfectious and nonpathogenic (21). Keeping in mind the importance of aerolysin and its destructive effects, designing a MEV against it could reduce the infection rate in the community by evoking the immune system in the form of cell-mediated and humoral immunity.

MEV development starts by retrieving the data of aerolysin toxin in the form of amino acid sequence and subjecting it to B-cell epitope prediction. The obtained epitopes were processed for MHC-II and MHC-I epitope prediction, and the resulting epitopes were processed for essentiality analysis using different bioinformatics tools. Furthermore, the structure was predicted for the vaccine candidate, and its binding efficiency was checked with the major immune receptors of humans, i.e., MHC-I, MHC-II, and TLR4, and the docked complexes were processed for simulation. At last, the vaccine was produced via in silico cloning using the SnapGene tool. Our work shows accepting results that this vaccine will work efficiently and will suppress the onset and progression of A. hydrophila infection in healthy and infected individuals.

Research workflow

To secure our aim, a consistent, step-by-step process was employed, as shown in Figure 1.

Figure 1

Data mining, retrieval, homology, and conservancy check

The study starts by selecting aerolysin as the potential candidate to synthesize a MEV against it. The virulence of aerolysin was confirmed via an online tool called the Virulence Factor Database (VFDB) (22). This database consists of thousands of virulence factors associated with different known pathogens. Furthermore, clinical case studies and the role of aerolysin in causing different infections in humans were confirmed by PubMed and UniProt (23). The amino acid sequence of aerolysin was obtained from the UniProt database, and the structure was obtained from the Protein Database (PDB) with ID (1PRE). Obtained sequences were processed for homology checks against Homo sapiens, Lactobacillus rhamnosus, Lactobacillus casei, and Lactobacillus johnsonni by using BLASTp from the NCBI server (24). This was done to check that the aerolysin sequence does not have any similarity with the human and normal flora proteome. If similarity was shown, the study would not proceed because the obtained epitopes may provoke autoimmunity (25). Additionally, a conservancy analysis was conducted on aerolysin using the Blastp tool (24) to assess the occurrence of this virulence factor in other strains of the Aeromonas family. The findings from this analysis will enhance the significance of aerolysin-based MEV if the majority of strains harbor this gene in their genome. Consequently, such a MEV could confer broad immunity against all strains of Aeromonas that possess aerolysin.

Immune Epitope Prediction analysis

The obtained sequence of aerolysin was subjected to epitope prediction. The Immune Epitope Prediction (IEDB) database is a unique platform that consists of millions of known and predicted epitopes related to critical immune cell receptors, i.e., TLR4, BCR, MHC-II, MHC-I, etc. (26, 27). The system operates on machine learning algorithms to predict epitopes from the query sequence, leveraging the chosen alleles as a basis. This methodology allows for the accurate identification of epitopes tailored to specific alleles, enhancing the precision and effectiveness of the MEV candidate. The MEV designed from the predicted epitopes has demonstrated success across multiple vaccine design projects when tested experimentally (2830). This validation underscores the efficacy and versatility of the MEV approach, further supporting its potential as a promising solution in vaccine development (31). Our study focuses on B-cell epitope prediction, and the obtained epitopes were separately processed for MHC-I and MHC-II epitope prediction. For the prediction of MHC-II and MHC-I epitopes, all known alleles representing the entire human population were selected. This approach ensures that the predicted epitopes encompass a broad spectrum of alleles related to the immune system, thereby enhancing the versatility and applicability of the MEV for experimental approaches (32). The resulting epitopes were selected on the basis of low percentile ranking because a lower ranking score resulted in the maximum binding of the epitopes to immune receptors (33, 34).

Antigenicity, toxicity, solubility, and allergenicity analyses of the predicted epitopes

The obtained epitopes were subjected to a series of analyses so that filtered epitopes could be obtained and used as part of MEV. Antigenicity and toxicity were checked for each epitope using Vexigen 2.0 (35) and the ToxinPred tool (36). Epitopes with no toxicity and an antigenicity value of less than or equal to 0.4 underwent additional solubility analysis. Each epitope’s solubility was assessed using the Innovagen Peptide Calculator, and those with good water solubility were processed further (37). To check for allergic reactions, filtered epitopes were examined using the Allertop 2.0 tool. Only those epitopes that were negative for allergenicity were further processed (38).

Finalizing vaccine candidate sequence and its immune simulation

The vaccine construct was assembled by sequentially linking the filtered epitopes. An adjuvant was initially conjugated to the first epitope via an EAAAK linker. Subsequently, GPGPG linkers were utilized to connect each subsequent epitope in a tandem array (39). The purpose of adding an adjuvant was to enable the MEV to elicit a strong immunological response, and the objectives of adding linkers were to stabilize the vaccine and prevent self-complementary binding of its sequences (40). The resulting construct’s physiochemical properties were also anticipated to verify its theoretical PI, solubility in water, stability, and other properties. Immune simulation tests were conducted for the vaccine construct using the c-IMMSIMM tool in order to evaluate immune responses (cellular and humoral) against the vaccine candidate (41).

MEV structure prediction, refinement, and stability analysis

A three-dimensional structure was predicted for the MEV via an online structure modeling tool known as iTESSOR (42). iTESSOR uses a hierarchical approach that combines threading, structural refinement, and template-based fragment assembly (43). It uses particular methods to further enhance the structure after making a forecast. Because of this combined method, iTESSOR is now at the forefront of protein structure prediction, allowing for reliable structure prediction for a wide range of protein folds and sequences (44). The obtained model was further processed for refinement via the GALAXY refine tool in order to minimize steric clashes among the amino acids and increase the stability of the MEV by transforming coils into suitable helix structures (45). The final stability of the MEV was checked via an online tool known as ERRAT (46) and PDBsum, where a Ramachandran plot was obtained for the predicted MEV (47, 48).

Molecular docking, interaction analysis, and simulations

Molecular docking was used to evaluate the MEV’s ability to bind to immune cell receptors. Using the ClusPro server, the vaccine construct was docked with MHC-I (PDB ID: 1I1Y), MHC-II (PDB ID: 1KG0), and TLR4 (PDB ID: 4G8A) receptors (49). The complexes were further visualized via the UCSF Chimera tool (50), and the PDBsum tool was used to analyze the kinds and quantities of interactions among the docked complexes (51). Furthermore, the docked complexes were processed through molecular dynamic simulation (MDS), which is a method employed to comprehend molecular behavior and characteristics at the atomic level. It proves effective in assessing the binding stability of a complex, such as a ligand protein, within a dynamic environment. The AMBER 20 package was used, in which the system underwent 500 steps of steepest descent and 500 stages of conjugate gradient minimization (52). Position constraints with a force constant of kcal mol−1 Å−2 were used to keep the protein stable. Subsequently, there were 2,000 more steepest descent stages and 2,000 more conjugate gradient minimization phases, respectively. Secondly, the system was heated to the target temperature of 300 K for 20 ps under weak positional constraints on the protein atoms (force constant of 10 kcal mol−1 Å−2) and constant volume periodic boundary conditions (NVT). After that, the system was calibrated by running a production simulation for 100 ns while maintaining the same pressure and temperature (NPT) for roughly 40 ns. Using isotropic position scaling and a relaxation duration of 2 ps, an average pressure of 1 atm was maintained. Langevin dynamics with a collision frequency of one ps-1 were used to control the temperature (53). The Particle Mesh Ewald (PME) method was utilized to handle nonbonded interactions and long-range electrostatic interactions, with a 10-Å limit (54). The numerical integration time step was 2 fs, and the SHAKE method was utilized to limit all bonds containing hydrogen (55). VMD and the PTRAJ program from the Amber11 package were used to analyze the simulation results (56). For receptor–binder complex systems, the binding free energy (ΔGbinding) was calculated using molecular mechanics with a generalized Born and surface area solvation (MM/GBSA) approach (57). Throughout the simulation trajectory, 1,000 pictures were captured at 20 ns intervals in order to calculate the MM/GBSA free energy difference.

Codon optimization and in silico cloning

The designed MEV showing all the important properties of a common vaccine was subjected to in silico cloning (58). This was achieved by performing codon optimization of the MEV via an online tool called Jcat (59). Jcat tool sets the sequence of the MEV according to the codon usage of the expression system used in in silico cloning (Escherichia coli K-12 was used as an expression system). The processed sequence was inserted into a well-known vector named pet28+(a) via the SnapGene tool (60). Due to its T7 promoter, several cloning sites, His-tag fusion (polyhistidine that makes it easier to purify the produced protein), and a selectable marker, this vector is primarily utilized in cloning techniques (61). This process will yield accurate data that experimentalists may use to allow manufacturing at the industrial level.

Results

Data retrieval

The VFDB showed that aerolysin is among the most essential virulence factors of A. hydrophila and plays important roles in human-related infections. The sequence was obtained from the UniProt database, and the structural ID for aerolysin was obtained from PDB, as shown in Table 1.

Table 1

Virulence factor/PDB ID/NCBI ID/residuesSequence
Aerolysin OS=Aeromonas hydrophila/WP_098980947.1/1PRE/493MQKIKLTGLSLIISGLLMAQAQAAEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQSVKSN
IVGMMGQWQISGLANGWVIMGPGYNGEIKPGTASNTWCYPTNPVTGEIPTLSALDIPDGD
EVDVQWRLVHDSANFIKPTSYLAHYLGYAWVGGNHSQYVGEDMDVTRDGDGWVIRGNNDG
GCDGYRCGDKTAIKVSNFAYNLDPDSFKHGDVTQSDRQLVKTVVGWAVNDSDTPQSGYDV
TLRYDTATNWSKTNTYGLSEKVTTKNKFKWPLVGETELSIEIAANQSWASQNGGSTTTSL
SQSVRPTVPARSKIPVKIELYKADISYPYEFKADVSYDLTLSGFLRWGGNAWYTHPDNRP
NWNHTFVIGPYKDKASSIRYQWDKRYIPGEVKWWDWNWTIQQNGLSTMQNNLARVLRPVR
AGITGDFSAESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGF
NNVSLSVTPAANQ

The amino acid sequence of aerolysin, along with its PDB ID and residue number.

Homology and conservancy check

Each virulence factor was separately aligned via BLASTp tool against the human proteome and important normal flora bacteria, i.e., Lactobacillus rhamnosus, Lactobacillus casei, and Lactobacillus johnsonni, in order to check if there is sequence similarity or not. The sequence of each organism showed no such similarity with the virulence factor, and it was safe to use for further analysis. This was done because, while constructing such a vaccine candidate, one should keep in mind that the sequence used in constructing MEV should not resemble the sequence of these organisms because it may lead to autoimmune disorders or abnormal killing of the normal flora of the human body because our adaptive immunity can be provoked against our own body and normal flora. Secondly, sequence alignment of aerolysin with all known strains of the Aeromonas family reveals that the selected virulence factor is present in all those strains of Aeromonas known for causing serious infections in the human population. Supplementary Table S1 shows that aerolysin is present in 17 strains of A. hydrophila, 39 strains of Aeromonas spp., three strains of A. salmonicida, and each strain of A. bestiarum, A. piscicola, A. caviae, and A. dhakensis, respectively. Alignment scores of the aerolysin with the mentioned strains showed a maximum result of 95%–100%, which clearly illustrates that these genes are exactly present in these mentioned strains.

B-cell epitope prediction phase

The chosen proteins were ranked in order of priority for immunological epitope prediction. This was accomplished by first predicting the B-cell epitope and then the T-cell epitope. To find T-cell epitopes, additional processing was done on the B-cell epitopes. B cells, macrophages, and cytotoxic T lymphocytes are all stimulated by helper T lymphocytes. On the other hand, antigens can be directly recognized by cytotoxic T cells (62). Conversely, B cells can develop into plasma cells, which produce antibodies (63). Aerolysin was subjected to B-cell epitope prediction. The sequence was filtered and spliced into 14 linearly predicted B-cell epitopes shown in Table 2. All the epitopes were also presented schematically in Figure 2, which showed that epitopes present in the yellow region above the threshold value of 0.5 are considered B-cell epitopes, while sequences below the threshold present in the green region do not belong to the B-cell epitope category (26). Out of 493 amino acids of aerolysin, 262 amino acids (selected from each chain, i.e., A and B of aerolysin) were further processed separately for MHC-II and MHC-I epitope prediction. All 262 epitopes of B cells were used for T-cell epitope prediction. The first MHC-II epitopes were predicted, followed by MHC-I epitope prediction. For MHC-II epitope prediction, the IEDB-recommended method was used for epitope prediction (64), and all the known alleles of MHC-II molecules were selected. This was done because the selection of more alleles results in diverse epitopes that could be present in a high percentage of people. Epitopes with a percentile score of ≤ 10.0 were selected, and the remaining were rejected because a lower percentile score results in more efficient binding. For MHC-I epitope prediction, the same IEDB-recommended method was used (64), and all the known alleles for MHC-I were selected. Two filtration thresholds were set for choosing the best epitopes, i.e., top 1% epitopes and epitopes having a percentile score of ≤ 1.0 were selected. Top 1% was selected because this would filter those epitopes that are common in all the selected alleles, and the lowest percentile score results in better binding with the immune receptors. The obtained epitopes of MHC-II and MHC-I are shown in Table 3.

Table 2

ProteinProtein lengthEpitope location (amino acid positions)Epitope length (number of amino acids)
Aerolysin493aa24–56; 68–72; 85–94; 102–131; 155–189; 206–214; 230–236; 244–255; 262–265; 268–275; 284–299; 347–361; 369–394; 429–48033aa; 5aa; 10aa; 30aa; 35aa; 9aa; 7aa; 12aa; 4aa; 8aa; 16aa; 15aa; 26aa; 52aa
Total = 262
Residues detail w.r.t epitope length
AEPVYPDQLRLFSLGQGVCGDKYRPVNREEAQS
WQISG
NGEIKPGTAS
NPVTGEIPTLSALDIPDGDEVDVQWRLVHD
HSQYVGEDMDVTRDGDGWVIRGNNDGGCDGYRCGD
SFKHGDVTQ
DSDTPQS
YDTATNWSKTNT
VTTK
FKWPLVGE
ANQSWASQNGGSTTTS
WGGNAWYTHPDNRPN
GPYKDKASSIRYQWDKRYIPGEVKWW
AESQFAGNIEIGAPVPLAADSKVRRARSVDGAGQGLRLEIPLDAQELSGLGF

The table shows detailed information about the B-cell epitopes, i.e., their location in the protein structure plus their length and residues.

Figure 2

Table 3

MHC-II epitopesPercentile scoreMHC-I epitopesPercentile score
VPLAADSKVRRARSV0.2EPVYPDQLRL0.18
REEAQSWQISGNGEI3.6IEIGAPVPL0.23
LVHDHSQYVGEDMDV4.5KDKASSIRY0.4
DEVDVQWRLVHDHSQ2.7KPGTASNPV0.19
GDSFKHGDVTQDSDT1.3KTNTVTTKF0.01
NIEIGAPVPLAADSK6.5KYRPVNREE0.11
NGEIKPGTASNPVTG2.6NTVTTKFKW0.01
APVPLAADSKVRRAR0.01QDSDTPQSY0.03
QWRLVHDHSQYVGED0.11REEAQSWQI0.1
ISGNGEIKPGTASNP5.0TQDSDTPQSY0.03
HGDVTQDSDTPQSYD2.7
PVNREEAQSWQISGN4.0
VRRARSVDGAGQGLR8.3
AADSKVRRARSVDGA8.8
DTATNWSKTNTVTTK9.5
SQYVGEDMDVTRDGD3.8
DSKVRRARSVDGAGQ2.5
HGDVTQDSDTPQSYD1.8
VCGDKYRPVNREEAQ0.01
HSQYVGEDMDVTRDG1.4

Obtained epitopes for MHC-II (15 mers) and MHC-I (9–10 mers) along with their percentile scores.

Epitope filtration phase

Out of a multitude of possibilities, only the most promising epitopes made the cut for our vaccine design. After undergoing rigorous assessments for toxicity, solubility, allergenicity, and antigenicity, only a select few emerged victorious. Table 4 showcases these epitopes, ready to serve as the building blocks of our MEV.

Table 4

Selected epitopesAntigenicitySolubilityAllergenicityToxicity
VPLAADSKVRRARSVAntigenWater solubleNonallergenNontoxin
REEAQSWQISGNGEI
LVHDHSQYVGEDMDV
DEVDVQWRLVHDHSQ
GDSFKHGDVTQDSDT
NIEIGAPVPLAADSK
NGEIKPGTASNPVTG
APVPLAADSKVRRAR
QWRLVHDHSQYVGED
ISGNGEIKPGTASNP
HGDVTQDSDTPQSYD
PVNREEAQSWQISGN
VRRARSVDGAGQGLR
AADSKVRRARSVDGA
DTATNWSKTNTVTTK
SQYVGEDMDVTRDGD
DSKVRRARSVDGAGQ
HGDVTQDSDTPQSYD
VCGDKYRPVNREEAQ
HSQYVGEDMDVTRDG
TQDSDTPQSY
EPVYPDQLRL
IEIGAPVPL
KDKASSIRY
KPGTASNPV
KTNTVTTKF
KYRPVNREE
NTVTTKFKW
QDSDTPQSY
REEAQSWQI

Filtered epitopes for vaccine construct.

Vaccine construction phase

In total, 30 unique epitopes were chosen from the list of combined epitopes after the aforementioned analyses. One of the main problems was resolved by creating a multi-epitope-based vaccination construct by joining different kinds of designated epitopes with certain GPGPG linkers. Furthermore, the EAAAK linker was used to link the epitope peptide and the adjuvant for the cholera toxin B component. Because GPGPG linkers can effectively block junctional folding and initiate an immunological response involving T-helper cells, they were placed between epitopes (65). EAAAK is a stiff, stable α-helical peptide linker with an intramolecular hydrogen bond and a closed-packed backbone. Consequently, in a fusion protein, the EAAAK linker serves as a domain spacer (66). Additionally, linkers facilitate the union of epitopes to form a significant structure with a polytope shape (67). Cholera toxin B was used as an adjuvant because it significantly increased the synthesis of IgA in the mucosa and other immune responses (68). The reason behind this is that it is nontoxic and has the ability to attach itself to the monosialotetrahexosylganglioside (GM1) receptor. This receptor can be found in the cytosols and on the membranes of various cells, such as B cells, macrophages, dendritic cells, gut epithelial cells, and antigen-presenting cells (69). In a similar vein, the adjuvant employed is risk-free and produces strong immune responses that are particular to the antigen with which it is coupled (70). Figures 3A, B and Table 5 present the MEV construct and its significant attributes, respectively.

Figure 3

Table 5

Molecular weightNo. of amino acidsInstability IndexTheoretical PIGRAVY scoreAntigenicityHalf-life
Vaccine construct68,266.7766631.795.60−0.815Antigen>20 h

Essential characteristics of the vaccination and its half-life within the human body.

Immune simulations

The immunological reactions to the MEV were analyzed using the C-ImmSim server to ascertain if the epitopes would be sufficient to produce immunity (41). By employing this technique, it is also possible to determine the emergence of immunological interactions between the epitopes and specific targets. The ability of the MEV construct to elicit potent cellular and humoral immune responses is shown in Figure 3C. An increase in the development of adaptive responses, such as IgG and IgM antibodies, was seen in a C-immune simulation analysis carried out 35 days after the human immune system was virtually exposed to the highest dosage of vaccine antigen. Similarly, robust cellular immune responses were evident by significant production of interferon-gamma, interleukin (IL)-10, and IL-2 observed within 5 days postadministration. These findings highlight the MEV’s ability to stimulate potent immune responses, indicating its potential as an effective vaccine candidate (7173).

Vaccine structure modeling, refinement, and stability analysis

The MEV construct was modeled for structure prediction. In order to do this, the final MEV construct’s amino acid was uploaded in FASTA format to the iTESSOR program, and an ab initio modeling technique was used to predict the structure (42). Five different structures were forecast in total, and the one with the highest confidence score was chosen. The modeled structure was refined by reducing steric clashes among the residues, making it stable and suitable for further analysis (46, 74, 75). The stability of the MEV structure was predicted, and it showed acceptable values of stability. Two algorithms were used to predict the stability, i.e., the Ramachandran plot and the ERRAT plot. The Ramachandran plot illustrates the division and placement of the amino acids in the MEV construct into distinct areas, each of which denotes a distinct stability level (76). The four zones in this plot are the most favored areas (red), the additional permitted areas (brown), the generously allowed regions (yellow), and the disallowed regions (pale). Following the placement of the MEV construct residues in these areas, the combined stability was computed. Based on each residue’s phi and psi angles, which are shown on the plot’s x-axis and y-axis, residues are arranged in these regions. The majority of the MEV construct’s residues were found to be in the allowed region (75.5%), which was followed by the generously allowed zone (1.3%), the additional allowed regions (19.8%), and the disallowed region (2.4%) (Table 6). Our MEV construct is stable, as evidenced by the presence of more residues in the permitted regions and fewer in the prohibited zone (Figure 3D). The ERRAT score for structure stability also lies in the acceptable range of 70%, respectively.

Table 6

Vaccine
No. of residuesPercentage
Most favored regions (A, B, C)32575.5%
Additional allowed regions (a, b, l, p)9119.8%
Generously allowed regions (~a, ~b, ~1, ~p)61.3%
Disallowed regions (XX)112.4%
Non-glycine and nonproline residues460100%
End-residues (excl. Gly and pro)2
Glycine residues121
Proline residues83
Total number of residues666

Statistical data from the Ramachandran plot.

Molecular docking and interaction analysis

Docking is an essential method for assessing how well two molecules bind together. The MEV candidate was bound to the most important receptors of the human immune system, i.e., MHC-I, MHC-II, and TLR4 in order to predict its binding efficiency. The pdb structures of the immune receptors were retrieved from the Protein Data Bank (PDB) (77) and were separately docked with the MEV, and binding free energies were calculated where the obtained values clearly demonstrate maximum binding (Table 7). Furthermore, the PDBsum tool was used to verify the kinds and quantities of interactions. The MEV exhibited effective binding with TLR4, MHC-I, and MHC-II, with the highest number of contacts. In addition, hydrogen bonds were observed among the complexes, providing additional evidence of maximal binds. Figure 4 displays the structure of docked complexes as well as the quantity, kind, and number of interacting residues.

Table 7

Docked complexClusterMembersBinding energy
MHC I—VACCINETOP 184−923.2 kcal/mol
MHC II–VACCINETOP 1110−988.3 kcal/mol
TLR 4–VACCINETOP 128−1,023.4 kcal/mol

The top 1 clusters of the docked complexes are displayed, together with the number of members engaged in the interaction and the binding energies of the complexes.

Figure 4

In silico cloning

The predicted MEV was ultimately subjected to in silico cloning, as it was predicted to be the most promising candidate for evoking immune responses and preventing A. hydrophila infection in individuals. To facilitate cloning, the vaccine construct was optimized using a codon adaptation tool tailored for the E. coli K-12 expression system (59). Results indicated that approximately 95% of the codons were successfully modified to align with the expression system’s codon usage, suggesting that the MEV would be efficiently expressed in E. coli (Figure 5A). Codon optimization is crucial because the expression efficiency of codons varies among organisms, depending on their specific codon usage patterns (78). The optimized vaccine construct was then successfully cloned into a specialized vector, pet28a(+), with modified restriction sites as depicted in Figure 5B, respectively (79).

Figure 5

Simulations of the docked complexes

All docked complexes subjected to simulations yielded acceptable results. The root mean square deviation (RMSD) plot in Figure 6A showed linear deviations for each complex, indicating stability upon ligand binding and an absence of extreme deviations across the timeframe. This is a kind of ideal situation for our docked complexes. Root mean square fluctuation (RMSF) results in Figure 6B further clarify that amino acids within the active sites exhibit effective fluctuations conducive to efficient engagement and binding with their respective ligands. Molecular Mechanics Generalized Born Surface Area (MM-GBSA) and Molecular Mechanics Poisson–Boltzmann Surface Area (MM-PBSA) analyses demonstrated the stability of each complex upon binding (Table 8). Notably, the obtained energy values were significantly low, signifying maximal stability and efficient binding potentials of the MEV with the immune receptors.

Figure 6

Table 8

ParameterVaccine-TLR-4 complex (kcal/mol)Vaccine-MHC-I complex (kcal/mol)Vaccine-MHC-II complex (kcal/mol)
MMGBSA
Van der Waals energy term−218.24−157.01−166.29
Electrostatic energy term−78.19−55.06−22.34
Gas phase energy term−296.43−212.07−188.63
Solvation energy term25.9718.1710.54
Net energy term−270.46−193.9−178.09
MMPBSA
Van der Waals energy term−218.24−157.01−166.29
Electrostatic energy term−78.19−55.06−22.34
Gas phase energy term−296.43−212.07−188.63
Solvation energy term30.2921.5711.59
Net energy term−266.14−190.5−177.04

Intermolecular binding energies estimated by MMPGBSA/MMGBSA methods.

Discussion

A. hydrophila dwells in freshwater and enrages people with its toxic substance, aerolysin (80). This bacterium casts a wide net of illnesses, ranging from sepsis and meningitis to bloody diarrhea and necrotizing wounds (81). Its lethality increases in susceptible groups, taking lives with a terrifying 50% mortality rate in conditions such as septicemia, leaving glaring reminders of its formidable menace (82). To stop this aquatic threat from affecting human health, prompt medical attention, careful water cleaning, and effective vaccine production techniques are required.

The main aim of this study was to design a MEV against A. hydrophila based on its virulence factor (aerolysin toxin) because virulence factors are important proteins associated with bacteria that help it induce and promote serious fatal infections in living organisms (83). Without essential factors, bacteria can be weak or no longer pathogenic (84). Numerous researchers have created MEVs against a wide range of diseases caused by bacteria while taking into account their virulence factors. In a recent work, for instance, a MEV construct was created using Staphylococcus aureus superantigens (85). Another study focused on designing a MEV against Helicobacter pylori (86). Additionally, MEV constructions targeting coronavirus spike proteins have been developed, with encouraging outcomes (38). Designed MEVs not only show robust immune responses virtually, but many studies have proved that these MEVs also induce robust immune responses in in vivo models. According to a study by Ramirez-Salinas et al. (31), the MEV construct against influenza A demonstrated a robust generation of neutralizing antibodies in mouse models. Additionally, Agallou et al. (28) presented a study in which BALB mice receiving a MEV construct made to target Leishmania infantum proteins produced a large number of interferons and interleukins.

As mentioned, aerolysin is among the most important virulence factors of A. hydrophila that actively contributes to the active killing of target cells in the human body (13). It is also a highly conserved gene present in different strains of A. hydrophila and other strains of the Aeromonas family. Osman et al. (87) isolated 17 strains of A. hydrophila, where three strains consist of the aerolysin gene upon analysis. Baloda et al. (88) conducted a research study where 89 strains of A. hydrophila and A. sobria were declared positive for the presence of an aerolysin gene upon PCR analysis. The construction of aerolysin-based MEVs against A. hydrophila will evoke the immune system of individuals when introduced into their bodies and will protect them from the effects of this deadly toxin. The sequence of aerolysin was extracted from UniProt, and structure was confirmed from PDB. Aerolysin was subjected to homology check by aligning its sequence with the human and normal flora bacteria proteome, which resulted in no significant match, which clarifies that there will be no occurring of autoimmune diseases due to the use of the designed vaccine. Alsubaiyel and Bukhari (89) used the same concept while designing MEVs against Chlamydia psittaci. Furthermore, a conservancy analysis of the aerolysin gene across all strains of Aeromonas species revealed that the majority of strains within the Aeromonas family possess the exact same aerolysin gene. This finding enhances the significance and diversity of our study, as the development of a MEV based on aerolysin would potentially provide coverage against almost all pathogenic strains of A. hydrophila and other pathogenic Aeromonas species.

The goal of the highly specialized, active acquired immune responses is to eradicate or stop the growth of infections (90). Memory B cells produced by adaptive immunity recognize the organism on future contacts following the initial recognition. Adaptive immunity’s immunological memory serves as the foundation for vaccination (91). Within the adaptive immune system, the main job of B- and T-lymphocyte cells is to create antibody-dependent cellular immunity against foreign invaders (92). The aerolysin sequence was utilized to identify the MHC-I, MHC-II, and B-cell epitopes. Aerolysin was found to have 14 B-cell epitopes of variable lengths, which were then processed to predict MHC-I and MHC-II epitopes. Epitopes with the lowest percentile scores were prioritized and selected because such epitopes ensure maximum binding with the immune receptors (93).

A total of 71 and 54 epitopes were predicted for MHC-I and MHC-II receptors, respectively. Each epitope underwent rigorous screening for allergenicity, solubility, toxicity, and antigenicity, resulting in 20 and 10 final candidates for MHC-II and MHC-I, respectively. These chosen epitopes were then joined via linkers to enhance the MEV’s stability and prevent self-binding. Linkers are used in multiple studies of MEV design because they provide integrity and effectivity to the vaccine candidate (9496) To strengthen immune activation, cholera toxin B, an adjuvant, was also incorporated. Raheem et al. (97) also used cholera toxin B as an adjuvant in designing a MEV against Vibrio cholera. The final MEV consists of 666 amino acids and a molecular weight of 68,266.77 kDa. Its impressive stability is reflected in the low instability index value of 31.79 (98). Additionally, with a theoretical PI of 5.60 and a slightly higher abundance of negative residues, the vaccine candidate exhibits an acidic character. The hydrophilic character of the protein was indicated by its negative GRAVY score of −0.815, indicating that it functions normally within the body (99). According to antigenic studies, the vaccine has a half-life in the body of more than 20 h, which is typical for maximal proteins and indicates that it is highly antigenic.

As mentioned, the structure of MEV was predicted and refined to make it stable and suitable for docking. The refined structure was evaluated for stability through ERRAT and Ramachandran plots, which resulted in promising outcomes. The Ramachandran plot is divided into four regions, where each region explains a specific level of stability based on the arrangement of phi (angles between alpha carbon and nitrogen) and psi (angles between alpha carbon and carboxyl carbon) angles of each residue of MEV. Exploring each region: the most preferred area, or red region, is made up of amino acids with angle values (phi and psi) that do not exhibit steric hindrance, meaning that their molecules do not hinder one another (100). More amino acids in favored regions imply improved stability and docking flexibility (48). Secondly, in addition to the allowed regions, the dark brown zone also represents the flexibility of proteins. High processing difficulties are indicated by the yellow, or generously allowed region, which strongly impedes phi and psi angles. Steric hindrance severely limits the rotation of Phi and Psi angles in the pale yellow, or forbidden zone. The modeled MEV in the present study shows the maximum amino acids present in allowed regions, giving a combined value of 97.6% that shows the maximum stability of MEV.

In order to elicit a strong immunological response, the MEV must bind as much as possible to key immune cell receptors. MEV was paired with TLR4, MHC-I, and MHC-II, respectively. The maximum number of amino acids were implicated in the binding of both proteins, and the binding energies were more significant. Vaccine-TRL4-docked complex analysis revealed a binding energy of 1,023.4 kcal, 124 nonbonded contacts, 11 hydrogen bonds, and three disulfide bonds. There were a total of 28 residues implicated in these interactions. The binding energy of the docked complex of vaccine-MHC I was −923.2 kcal, and the number of bonded and nonbonded contacts was 289, with four hydrogen bonds, one disulfide bond, and four residues involved. The Vaccine-MHC II-docked complex revealed 110 residues implicated, four hydrogen bonds, and 200 nonbonded interactions.

Simulation studies for each complex were performed using AMBER. These are only performed to virtually check the behavior of complexes inside the body (101). A virtual environment is provided that is almost similar to the cellular environment, where the stability and performance of the complex are evaluated. This is a highly acceptable approach and can give researchers a clue to proceed with experimental applications (96). Amber is most widely used to simulate protein complexes effectively. The RMSD plot is widely used to check the overall stability of the protein complex with respect to a reference (102). It shows the combined deviations of residues in the protein complex, and extreme deviations in the structure demonstrate the instability of the complex. In our case, RMSD obtained for each complex showed acceptable residue deviations, which concludes that all the MEV–immune receptor complexes are stable and can perform well inside the body. Secondly, the results were supported by measuring energy values via the MM-GBSA and MM-PBSA approaches (57). The negative values of Vander Val forces and electrostatic energy conclude that the docked complexes have maximum interactions between their neutral and charged residues and have stable bindings. The energy of the gas phase showed high negative values for each complex, while the energy of solvation showed minute positive values that conclude that in the vacuumed phase, i.e., without a solvent environment, the complex has high stability and maximum bonding interactions, and upon exposure to a solvent environment, a minute input energy (energy of solvation) is required to adjust the complex to the introduced new environment. The overall net energy of each complex in both the MM-GBSA and MM-PBSA approaches has significant negative values in Table 8, which concludes that all the MEV–immune complexes have stable and maximum interactions in the cellular environment. Lastly, an RMSF plot was generated for the residues involved in the active site of the complexes, which demonstrates that each residue showed maximum fluctuations and concludes that all are actively involved in bindings and interactions (102).

As an exceptional MEV that satisfies all prerequisites, in silico cloning was guaranteed to virtually generate this MEV and make it accessible to the human race. In order to achieve this, we used the principles of recombinant DNA technology, which involved selecting an appropriate vector in order to insert the MEV sequence and re-express it using an expression system. Because E. coli has the highest rate of multiplication, it was chosen as the expression system, and the pet28a(+) vector was employed. The exponential increase of genomic data is a major factor in the rapid development of computational vaccine-designing strategies (103). Such analyses can direct the development of a safe vaccine against a variety of microbial pathogens and are extremely specific and efficient. All the requirements for a good vaccine were satisfied by the current vaccine design.

Conclusion

This study concludes that the lack of availability of potential vaccines against A. hydrophila has created an alarming situation across humanity, and the introduction of potential vaccines can hinder the onset and progression of A. hydrophila-related infections. We produced a MEV candidate based on the aerolysin toxin (virulence factor) of A. hydrophila by processing it through different bioinformatics tools, and we were assured that this vaccine would be effective against this bacterium.

Statements

Data availability statement

The original contributions presented in the study are included in the article/Supplementary Material. Further inquiries can be directed to the corresponding author.

Author contributions

AA: Writing – original draft. MA: Writing – review & editing.

Funding

The author(s) declare that financial support was received for the research, authorship, and/or publication of this article. This work was supported and funded by the Deanship of Scientific Research at Imam Mohammad Ibn Saud Islamic University (IMSIU) (grant number IMSIU-RG23073).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2024.1369890/full#supplementary-material

References

  • 1

    AhmedHAMohamedMEMRezkMMGhariebRMAAbdel-MaksoudSA. Aeromonas hydrophila in fish and humans; prevalence, virulotyping and antimicrobial resistance. Slov Vet Res. (2018) 55:113–24.

  • 2

    KoWCYuKWLiuCYHuangCTLeuHSChuangYC. Increasing antibiotic resistance in clinical isolates of Aeromonas strains in Taiwan. Antimicrob Agents Chemother. (1996) 40:1260–2. doi: 10.1128/AAC.40.5.1260

  • 3

    TrustTJChipmanDC. Clinical involvement of Aeromonas hydrophila. Can Med Assoc J. (1979) 120:942.

  • 4

    GoldWLSalitIE. Aeromonas hydrophila infections of skin and soft tissue: report of 11 cases and review. Clin Infect Dis. (1993) 16:6974. doi: 10.1093/clinids/16.1.69

  • 5

    HolmbergSDSchellWLFanningGRWachsmuthIKHickman-BrennerFWBlakePAet al. Aeromonas intestinal infections in the United States. Ann Intern Med. (1986) 105:683–9. doi: 10.7326/0003-4819-105-5-683

  • 6

    ZhiyongZXiaojuLYanyuG. Aeromonas hydrophila infection: clinical aspects and therapeutic options. Rev Res Med Microbiol. (2002) 13:151–62. doi: 10.1097/00013542-200210000-00002

  • 7

    NgugiCCOyoo-OkothEMuchiriM. Effects of dietary levels of essential oil (EO) extract from bitter lemon (C itrus limon) fruit peels on growth, biochemical, haemato-immunological parameters and disease resistance in Juvenile L abeo victorianus fingerlings challenged with Aeromonas hyd. Aquac Res. (2017) 48:2253–65. doi: 10.1111/are.13062

  • 8

    Nolla-SalasJCodina-CaleroJVallés-AnguloSSitges-SerraAZapatero-FerrándizAClimentMCet al. Clinical significance and outcome of Aeromonas spp. infections among 204 adult patients. Eur J Clin Microbiol Infect Dis. (2017) 36:1393–403. doi: 10.1007/s10096-017-2945-4

  • 9

    FivazMAbramiLTsitrinYvan der GootFG. Aerolysin from Aeromonas hydrophila and related toxins. Pore-forming toxins. (2001) 257:3552.

  • 10

    ZhangLMaLYangQLiuYAiXDongJ. Sanguinarine Protects Channel Catfish against Aeromonas hydrophila Infection by Inhibiting Aerolysin and Biofilm Formation. Pathogens. (2022) 11:323. doi: 10.3390/pathogens11030323

  • 11

    KrauseK-HFivazMMonodAvan der GootFG. Aerolysin induces G-protein activation and Ca2+ release from intracellular stores in human granulocytes. J Biol Chem. (1998) 273:18122–9. doi: 10.1074/jbc.273.29.18122

  • 12

    TomásJM. The main Aeromonas pathogenic factors. Int Sch Res Not. (2012) 2012:256261. doi: 10.5402/2012/256261

  • 13

    EppleHJMankertzJIgnatiusRLiesenfeldOFrommMZeitzMet al. Aeromonas hydrophila beta-hemolysin induces active chloride secretion in colon epithelial cells (HT-29/B6). Infect Immun. (2004) 72:4848–58. doi: 10.1128/IAI.72.8.4848-4858.2004

  • 14

    StratevDOdeyemiOA. Antimicrobial resistance of Aeromonas hydrophila isolated from different food sources: A mini-review. J Infect Public Health. (2016) 9:535–44. doi: 10.1016/j.jiph.2015.10.006

  • 15

    IslamMZZahanMK-EAl-BariMAA. Convergence between global BCG vaccination and COVID-19 pandemic. J Med Virol. (2021) 93:1496–505. doi: 10.1002/jmv.26450

  • 16

    ChumakovKAvidanMSBennCSBertozziSMBlattLChangAYet al. Old vaccines for new infections: Exploiting innate immunity to control COVID-19 and prevent future pandemics. Proc Natl Acad Sci. (2021) 118:e2101718118. doi: 10.1073/pnas.2101718118

  • 17

    MaríaRRArturoCJAliciaJ-APaulinaMGGerardoA-O. The impact of bioinformatics on vaccine design and development. In: Vaccines, vol. 2. (2017). p. 36.

  • 18

    ChukwudozieOSDuruVCNdiribeCCAborodeATOyebanjiVOEmikpeBO. The relevance of bioinformatics applications in the discovery of vaccine candidates and potential drugs for COVID-19 treatment. Bioinform Biol Insights. (2021) 15:11779322211002168. doi: 10.1177/11779322211002168

  • 19

    MahapatraSRDeyJRajTKMisraNSuarM. Designing a next-generation multiepitope-based vaccine against Staphylococcus aureus using reverse vaccinology approaches. Pathogens. (2023) 12:376. doi: 10.3390/pathogens12030376

  • 20

    De GrootASMoiseLTerryFGutierrezAHHindochaPRichardGet al. Better epitope discovery, precision immune engineering, and accelerated vaccine design using immunoinformatics tools. Front Immunol. (2020) 11:442. doi: 10.3389/fimmu.2020.00442

  • 21

    LiJMaSLiZYuWZhouPYeXet al. Construction and characterization of an aeromonas hydrophila multi-gene deletion strain and evaluation of its potential as a live-attenuated vaccine in grass carp. Vaccines. (2021) 9:451. doi: 10.3390/vaccines9050451

  • 22

    LiuBZhengDZhouSChenLYangJ. VFDB 2022: a general classification scheme for bacterial virulence factors. Nucleic Acids Res. (2022) 50:D912–7. doi: 10.1093/nar/gkab1107

  • 23

    ConsortiumU. UniProt: a worldwide hub of protein knowledge. Nucleic Acids Res. (2019) 47:D506–15. doi: 10.1093/nar/gky1049

  • 24

    MahramAHerbordtMC. NCBI BLASTP on high-performance reconfigurable computing systems. ACM Trans Reconfigurable Technol Syst. (2015) 7:120. doi: 10.1145/2629691

  • 25

    PersidisA. Autoimmune disease drug discovery. Nat Biotechnol. (1999) 17:1038. doi: 10.1038/13748

  • 26

    JespersenMCPetersBNielsenMMarcatiliP. BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. (2017) 45:W24–9. doi: 10.1093/nar/gkx346

  • 27

    DhandaSKMahajanSPaulSYanZKimHJespersenMCet al. IEDB-AR: immune epitope database—analysis resource in 2019. Nucleic Acids Res. (2019) 47:W502–6. doi: 10.1093/nar/gkz452

  • 28

    AgallouMAthanasiouEKoutsoniODotsikaEKaragouniE. Experimental validation of multi-epitope peptides including promising MHC class I-and II-restricted epitopes of four known Leishmania infantum proteins. Front Immunol. (2014) 5:268. doi: 10.3389/fimmu.2014.00268

  • 29

    FleriWPaulSDhandaSKMahajanSXuXPetersBet al. The immune epitope database and analysis resource in epitope discovery and synthetic vaccine design. Front Immunol. (2017) 8:278. doi: 10.3389/fimmu.2017.00278

  • 30

    LiuTShiKLiW. Deep learning methods improve linear B-cell epitope prediction. BioData Min. (2020) 13:113. doi: 10.1186/s13040-020-00211-0

  • 31

    Ramírez-SalinasGLGarcía-MachorroJRojas-HernándezSCampos-RodríguezRde OcaAC-MGomezMMet al. Bioinformatics design and experimental validation of influenza A virus multi-epitopes that induce neutralizing antibodies. Arch Virol. (2020) 165:891911. doi: 10.1007/s00705-020-04537-2

  • 32

    DeyJMahapatraSRLataSPatroSMisraNSuarM. Exploring Klebsiella pneumoniae capsule polysaccharide proteins to design multiepitope subunit vaccine to fight against pneumonia. Expert Rev Vaccines. (2022) 21:569–87. doi: 10.1080/14760584.2022.2021882

  • 33

    SidneyJAssarssonEMooreCNgoSPinillaCSetteAet al. Quantitative peptide binding motifs for 19 human and mouse MHC class I molecules derived using positional scanning combinatorial peptide libraries. Immunome Res. (2008) 4:114. doi: 10.1186/1745-7580-4-2

  • 34

    WangPSidneyJKimYSetteALundONielsenMet al. Peptide binding predictions for HLA DR, DP and DQ molecules. BMC Bioinf. (2010) 11:112. doi: 10.1186/1471-2105-11-568

  • 35

    DoytchinovaIAFlowerDR. VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinf. (2007) 8:17. doi: 10.1186/1471-2105-8-4

  • 36

    GuptaSKapoorPChaudharyKGautamAKumarRRaghavaGPS. Peptide toxicity prediction, in: Computational peptidology. Humana New York, NY: Springer (2015) p. 143–57.

  • 37

    LearSCobbSL. Pep-Calc. com: a set of web utilities for the calculation of peptide and peptoid properties and automatic mass spectral peak assignment. J Comput Aided Mol Des. (2016) 30:271–7. doi: 10.1007/s10822-016-9902-7

  • 38

    Abraham PeeleKSrihansaTKrupanidhiSAyyagariVSVenkateswaruluTC. Design of multi-epitope vaccine candidate against SARS-CoV-2: A in-silico study. J Biomol Struct Dyn. (2021) 39:3793–801. doi: 10.1080/07391102.2020.1770127

  • 39

    AraiRUedaHKitayamaAKamiyaNNagamuneT. Design of the linkers which effectively separate domains of a bifunctional fusion protein. Protein Eng. (2001) 14:529–32. doi: 10.1093/protein/14.8.529

  • 40

    ColerRNBaldwinSLShaverdianNBertholetSReedSJRamanVSet al. A synthetic adjuvant to enhance and expand immune responses to influenza vaccines. PloS One. (2010) 5:e13677. doi: 10.1371/journal.pone.0013677

  • 41

    CastiglioneFBernaschiM. (2004). C-immsim: playing with the immune response, in: Proceedings of the sixteenth international symposium on mathematical theory of networks and systems (MTNS2004).

  • 42

    WuSSkolnickJZhangY. Ab initio modeling of small proteins by iterative TASSER simulations. BMC Biol. (2007) 5:110. doi: 10.1186/1741-7007-5-17

  • 43

    YangJZhangY. Protein structure and function prediction using I-TASSER. Curr Protoc Bioinforma. (2015) 52:58. doi: 10.1002/0471250953.bi0508s52

  • 44

    XuDZhangJRoyAZhangY. Automated protein structure modeling in CASP9 by I-TASSER pipeline combined with QUARK-based ab initio folding and FG-MD-based structure refinement. Proteins Struct Funct Bioinforma. (2011) 79:147–60. doi: 10.1002/prot.23111

  • 45

    LeeGRWonJHeoLSeokC. GalaxyRefine2: simultaneous refinement of inaccurate local regions and overall protein structure. Nucleic Acids Res. (2019) 47:W451–5. doi: 10.1093/nar/gkz288

  • 46

    ShinW-HLeeGRHeoLLeeHSeokC. Prediction of protein structure and interaction by GALAXY protein modeling programs. Bio Des. (2014) 2:111.

  • 47

    LaskowskiRA. PDBsum 1: A standalone program for generating PDBsum analyses. Protein Sci. (2022) 31:e4473. doi: 10.1002/pro.4473

  • 48

    ParkSWLeeBHSongSHKimMK. Revisiting the Ramachandran plot based on statistical analysis of static and dynamic characteristics of protein structures. J Struct Biol. (2023) 215:107939. doi: 10.1016/j.jsb.2023.107939

  • 49

    KozakovDHallDRXiaBPorterKAPadhornyDYuehCet al. The ClusPro web server for protein–protein docking. Nat Protoc. (2017) 12:255–78. doi: 10.1038/nprot.2016.169

  • 50

    PettersenEFGoddardTDHuangCCCouchGSGreenblattDMMengECet al. UCSF Chimera—a visualization system for exploratory research and analysis. J Comput Chem. (2004) 25:1605–12. doi: 10.1002/jcc.20084

  • 51

    LaskowskiRAChistyakovVVThorntonJM. PDBsum more: new summaries and analyses of the known 3D structures of proteins and nucleic acids. Nucleic Acids Res. (2005) 33:D266–8. doi: 10.1093/nar/gki001

  • 52

    Salomon-FerrerRCaseDAWalkerRC. An overview of the Amber biomolecular simulation package. Wiley Interdiscip Rev Comput Mol Sci. (2013) 3:198210. doi: 10.1002/wcms.1121

  • 53

    PaquetEViktorHL. Molecular dynamics, monte carlo simulations, and langevin dynamics: a computational review. BioMed Res Int. (2015). doi: 10.1155/2015/183918

  • 54

    CheathamTEIIIMillerJLFoxTDardenTAKollmanPA. Molecular dynamics simulations on solvated biomolecular systems: the particle mesh Ewald method leads to stable trajectories of DNA, RNA, and proteins. J Am Chem Soc. (1995) 117:4193–4. doi: 10.1021/ja00119a045

  • 55

    AndersenHC. Rattle: A “velocity” version of the shake algorithm for molecular dynamics calculations. J Comput Phys. (1983) 52:2434. doi: 10.1016/0021-9991(83)90014-1

  • 56

    Lindorff-LarsenKPianaSPalmoKMaragakisPKlepeisJLDrorROet al. Improved side-chain torsion potentials for the Amber ff99SB protein force field. Proteins Struct Funct Bioinforma. (2010) 78:1950–8.

  • 57

    GenhedenSRydeU. The MM/PBSA and MM/GBSA methods to estimate ligand-binding affinities. Expert Opin Drug Discovery. (2015) 10:449–61. doi: 10.1517/17460441.2015.1032936

  • 58

    BhattacharyaMSharmaARPatraPGhoshPSharmaGPatraBCet al. A SARS-CoV-2 vaccine candidate: In-silico cloning and validation. Inf Med unlocked. (2020) 20:100394. doi: 10.1016/j.imu.2020.100394

  • 59

    GroteAHillerKScheerMMünchRNörtemannBHempelDCet al. JCat: a novel tool to adapt codon usage of a target gene to its potential expression host. Nucleic Acids Res. (2005) 33:W526–31. doi: 10.1093/nar/gki376

  • 60

    DanaHMahmoodi ChalbataniGGharagouzlooEMiriSRMemariFRasoolzadehRet al. In silico analysis, molecular docking, molecular dynamic, cloning, expression and purification of chimeric protein in colorectal cancer treatment. Drug Des Devel Ther. (2020), 309–29. doi: 10.2147/DDDT

  • 61

    LiLLiHTianQGeBXuXChiYet al. Expression and purification of soluble recombinant $β$-lactamases using Escherichia coli as expression host and pET-28a as cloning vector. Microb Cell Fact. (2022) 21:19. doi: 10.1186/s12934-022-01972-5

  • 62

    TupinEKinjoYKronenbergM. The unique role of natural killer T cells in the response to microorganisms. Nat Rev Microbiol. (2007) 5:405–17. doi: 10.1038/nrmicro1657

  • 63

    UmlaufBJHaralambievaIHOvsyannikovaIGKennedyRBPankratzVSJacobsonRMet al. Associations between demographic variables and multiple measles-specific innate and cell-mediated immune responses after measles vaccination. Viral Immunol. (2012) 25:2936. doi: 10.1089/vim.2011.0051

  • 64

    ReynissonBAlvarezBPaulSPetersBNielsenM. NetMHCpan-4.1 and NetMHCIIpan-4.0: improved predictions of MHC antigen presentation by concurrent motif deconvolution and integration of MS MHC eluted ligand data. Nucleic Acids Res. (2020) 48:W449–54. doi: 10.1093/nar/gkaa379

  • 65

    KollaHBTirumalasettyCSreeramaKAyyagariVS. An immunoinformatics approach for the design of a multi-epitope vaccine targeting super antigen TSST-1 of Staphylococcus aureus. J Genet Eng Biotechnol. (2021) 19:114. doi: 10.1186/s43141-021-00160-z

  • 66

    DongRChuZYuFZhaY. Contriving multi-epitope subunit of vaccine for COVID-19: immunoinformatics approaches. Front Immunol. (2020) 11:1784. doi: 10.3389/fimmu.2020.01784

  • 67

    VenkateswaruluTCShaikATMeduriDSDhusiaKPeeleA. In silico designing of a multitope vaccine against Rhizopus microspores. Arab Gulf J Sci Res. (2023). doi: 10.1108/AGJSR-11-2022-0274

  • 68

    HolmgrenJLyckeNCzerkinskyC. Cholera toxin and cholera B subunit as oral—mucosal adjuvant and antigen vector systems. Vaccine. (1993) 11:1179–84. doi: 10.1016/0264-410X(93)90039-Z

  • 69

    StratmannT. Cholera toxin subunit B as adjuvant—an accelerator in protective immunity and a break in autoimmunity. Vaccines. (2015) 3:579–96. doi: 10.3390/vaccines3030579

  • 70

    Ghaem-MaghamiMSimmonsCPDaniellSPizzaMLewisDFrankelGet al. Intimin-specific immune responses prevent bacterial colonization by the attaching-effacing pathogen Citrobacter rodentium. Infect Immun. (2001) 69:5597–605. doi: 10.1128/IAI.69.9.5597-5605.2001

  • 71

    TauGRothmanP. Biologic functions of the IFN-$γ$ receptors. Allergy. (1999) 54:1233. doi: 10.1034/j.1398-9995.1999.00099.x

  • 72

    GaffenSLLiuKD. Overview of interleukin-2 function, production and clinical applications. Cytokine. (2004) 28:109–23. doi: 10.1016/j.cyto.2004.06.010

  • 73

    IyerSSChengG. Role of interleukin 10 transcriptional regulation in inflammation and autoimmune disease. Crit Rev Immunol. (2012) 32:23–63. doi: 10.1615/CritRevImmunol.v32.i1

  • 74

    KaurRAroraNJamakhaniMAMalikSKumarPAnjumFet al. Development of multi-epitope chimeric vaccine against Taenia solium by exploring its proteome: an in silico approach. Expert Rev Vaccines. (2020) 19:105–14. doi: 10.1080/14760584.2019.1711057

  • 75

    RajVSSMonishaMParamasivamG. In-silico screening of synthetic inhibitors for human poly (Adp-ribose) polymerase 2 enzyme using patch dock software for ovarian cancer therapy. Rev GEINTEC-GESTAO Inov E Tecnol. (2021) 11:5910–23. doi: 10.47059/revistageintec

  • 76

    HollingsworthSAKarplusPA. A fresh look at the Ramachandran plot and the occurrence of standard structures in proteins. (2010). doi: 10.1515/bmc.2010.022

  • 77

    BurleySKBhikadiyaCBiCBittrichSChaoHChenLet al. RCSB Protein Data Bank (RCSB. org): delivery of experimentally-determined PDB structures alongside one million computed structure models of proteins from artificial intelligence/machine learning. Nucleic Acids Res. (2023) 51:D488–508.

  • 78

    JoshiAKrishnanSKaushikV. Codon usage studies and epitope-based peptide vaccine prediction against Tropheryma whipplei. J Genet Eng Biotechnol. (2022) 20:112. doi: 10.1186/s43141-022-00324-5

  • 79

    Al-KananyFNOthmanRM. Cloning and expression of pseudomonas aeruginosa alkB gene in E. coli J Pure Appl Microbiol. (2020) 14:389–97. doi: 10.22207/JPAM

  • 80

    DesaiBA. Diversity and virulence profile of aeromonas from potable water. Shodhgangotri, India (2015).

  • 81

    CamusACDurborowRMHemstreetWGThuneRLHawkeJP. Aeromonas bacterial infections-motile aeromonad septicemia. MS, USA: Southern Regional Aquaculture Center Stoneville (1998).

  • 82

    DaskalovH. The importance of Aeromonas hydrophila in food safety. Food Control. (2006) 17:474–83. doi: 10.1016/j.foodcont.2005.02.009

  • 83

    LeitãoJH. Microbial virulence factors. Int J Mol Sci. (2020) 21:5320. doi: 10.3390/ijms21155320

  • 84

    HendersonBPooleSWilsonM. Bacterial modulins: a novel class of virulence factors which cause host tissue pathology by inducing cytokine synthesis. Microbiol Rev. (1996) 60:316–41. doi: 10.1128/mr.60.2.316-341.1996

  • 85

    RahmanSSarkarKDasAK. Exploring staphylococcal superantigens to design a potential multi-epitope vaccine against Staphylococcus aureus: an in-silico reverse vaccinology approach. J Biomol Struct Dyn. (2023), 115. doi: 10.1080/07391102.2023.2171138

  • 86

    MezaBAscencioFSierra-BeltránAPTorresJAnguloC. A novel design of a multi-antigenic, multistage and multi-epitope vaccine against Helicobacter pylori: an in silico approach. Infect Genet Evol. (2017) 49:309–17. doi: 10.1016/j.meegid.2017.02.007

  • 87

    OsmanKAlyMKheaderAMabrokK. Molecular detection of the Aeromonas virulence aerolysin gene in retail meats from different animal sources in Egypt. World J Microbiol Biotechnol. (2012) 28:1863–70. doi: 10.1007/s11274-011-0915-z

  • 88

    BalodaSBKrovacekKErikssonLLinnéTMånssonI. Detection of aerolysin gene in Aeromonas strains isolated from drinking water, fish and foods by the polymerase chain reaction. Comp Immunol Microbiol Infect Dis. (1995) 18:1726. doi: 10.1016/0147-9571(94)E0001-A

  • 89

    AlsubaiyelAMBukhariSI. Computational exploration and design of a multi-epitopes vaccine construct against Chlamydia psittaci. J Biomol Struct Dyn. (2023), 117. doi: 10.1080/07391102.2023.2268173

  • 90

    ChaplinDD. Overview of the immune response. J Allergy Clin Immunol. (2010) 125:S3S23. doi: 10.1016/j.jaci.2009.12.980

  • 91

    MerloLMFMandik-NayakL. Adaptive immunity: B cells and antibodies. In: Cancer immunotherapy. Elsevier (2013). p. 2540.

  • 92

    OberholzerAOberholzerCMoldawerLL. Sepsis syndromes: understanding the role of innate and acquired immunity. Shock. (2001) 16:8396. doi: 10.1097/00024382-200116020-00001

  • 93

    KhanZSanjaiSHarshithaBVPatilS. In-silico multi-epitope vaccine candidate against type-1 parainfluenza virus. (2023). doi: 10.21203/rs.3.rs-2455059/v1

  • 94

    HajighahramaniNNezafatNEslamiMNegahdaripourMRahmatabadiSSGhasemiY. Immunoinformatics analysis and in silico designing of a novel multi-epitope peptide vaccine against Staphylococcus aureus. Infect Genet Evol. (2017) 48:8394. doi: 10.1016/j.meegid.2016.12.010

  • 95

    ShahidFZaheerTAshrafSTShehrozMAnwerFNazAet al. Chimeric vaccine designs against Acinetobacter baumannii using pan genome and reverse vaccinology approaches. Sci Rep. (2021) 11:115. doi: 10.1038/s41598-021-92501-8

  • 96

    NawazMUllahAAl-HarbiAIHaqMUHameedARAhmadSet al. Genome-Based Multi-Antigenic Epitopes Vaccine Construct Designing against Staphylococcus hominis Using Reverse Vaccinology and Biophysical Approaches. Vaccines. (2022) 10:1729. doi: 10.3390/vaccines10101729

  • 97

    RaheemSGSalhKKIbrahimKSGorjiAE. In-silico designing a multi-peptide vaccine: against vibrio cholera. Int J Pept Res Ther. (2021) 27:1541–53. doi: 10.1007/s10989-021-10190-3

  • 98

    GamageDGGunaratneAPeriyannanGRRussellTG. Applicability of instability index for in vitro protein stability prediction. Protein Pept Lett. (2019) 26:339–47. doi: 10.2174/0929866526666190228144219

  • 99

    GargVKAvashthiHTiwariAJainPARamketePWKayasthaAMet al. MFPPI–multi FASTA protParam interface. Bioinformation. (2016) 12:74. doi: 10.6026/bioinformation

  • 100

    ZhouAQO’HernCSReganL. Revisiting the Ramachandran plot from a new angle. Protein Sci. (2011) 20:1166–71. doi: 10.1002/pro.644

  • 101

    DeyDPaulPKAl AzadSAl MazidMFKhanAMSharifMAet al. Molecular optimization, docking, and dynamic simulation profiling of selective aromatic phytochemical ligands in blocking the SARS-CoV-2 S protein attachment to ACE2 receptor: an in silico approach of targeted drug designing. J Adv Vet Anim Res. (2021) 8:24. doi: 10.5455/javar.

  • 102

    da FonsecaAMCaluacoBJMadureiraJMCCabongoSQGaietaEMDjataFet al. Screening of potential inhibitors targeting the main protease structure of SARS-CoV-2 via molecular docking, and approach with molecular dynamics, RMSD, RMSF, H-bond, SASA and MMGBSA. Mol Biotechnol. (2023), 115. doi: 10.1007/s12033-023-00831-x

  • 103

    KhanFSrivastavaVKumarA. Computational identification and characterization of potential T-cell epitope for the utility of vaccine design against enterotoxigenic Escherichia coli. Int J Pept Res Ther. (2019) 25:289302. doi: 10.1007/s10989-018-9671-3

Summary

Keywords

immunoinformatics, epitopes, MD simulations, systems biology, vaccine, A. hydrophila

Citation

Alawam AS and Alwethaynani MS (2024) Construction of an aerolysin-based multi-epitope vaccine against Aeromonas hydrophila: an in silico machine learning and artificial intelligence-supported approach. Front. Immunol. 15:1369890. doi: 10.3389/fimmu.2024.1369890

Received

13 January 2024

Accepted

14 February 2024

Published

01 March 2024

Volume

15 - 2024

Edited by

Sajjad Ahmad, Abasyn University, Pakistan

Reviewed by

Faryal Mehwish Awan, The University of Haripur, Pakistan

Anam Naz, University of Lahore, Pakistan

Updates

Copyright

*Correspondence: Abdullah S. Alawam,

†ORCID: Abdullah S. Alawam, orcid.org/0000-0003-4844-1801; Maher S. Alwethaynani, orcid.org/0009-0007-8453-7305

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics