Abstract
Background:
Francisella tularensis is a category A potential thread agent, making the development of vaccines and countermeasures a high priority. Therefore, identifying new vaccine candidates and novel drug targets is essential for addressing this significant public health concern.
Methods:
This study presents an in silico analysis of two strategies against F. tularensis infection: the development of a multi-epitope vaccine (MEV) and the identification of novel drug targets. Outer membrane proteins (OMPs) were predicted using subcellular localization tools and immunogenicity was evaluated using a reverse vaccinology pipeline. Epitopes from these OMPs were combined to create candidate MEV for prophylactic protection. Concurrently, cytoplasmic proteins were subjected to rigorous analysis to identify potential novel drug targets.
Results:
Of 1,921 proteins, we identified 12 promising protein vaccine candidates from F. tularensis OMPs and proposed a multi-epitope vaccine (MEV) designed using seven immunodominant epitopes derived from four of these OMPs, including two hypothetical proteins (WP_003026145.1 and WP_003029346.1), an OmpA family protein (WP_003020808.1), and PD40 (WP_003021546.1). In addition, we proposed 10 novel drug targets for F. tularensis: Asp-tRNA (Asn)/Glu-tRNA (Gln) amidotransferase subunit GatC (WP_003017413.1), NAD(P)-binding protein (WP_042522581.1), 30S ribosomal protein S16 (WP_003023081.1), Class I SAM-dependent methyltransferase (WP_003022345.1), haloacid dehalogenase (WP_003014157.1), uroporphyrinogen-III synthase (WP_003022220.1), and four hypothetical proteins (WP_003017784.1, WP_003020080.1, WP_003020066.1, and WP_003022350.1).
Conclusion:
This study designed an MEV and proposed novel drug targets to address tularemia, offering broad protection against various F. tularensis strains. MEV, with favorable physicochemical properties, showed strong potential through molecular docking and dynamic simulations. Immune simulations suggest that it may elicit robust responses against pathogens. The identification of novel drug targets can lead to the discovery of new antimicrobial agents. However, further in vitro and in vivo studies are required to validate their efficacy and capability.
1 Introduction
Tularemia is an acute zoonotic disease caused by Francisella tularensis, a Gram-negative intracellular coccobacillus that poses a significant threat to human health (1). The disease is primarily caused by two subspecies: F. tularensis subsp. tularensis (type A) and F. tularensis subsp. holarctica (type B), with type A being the most virulent (2). Without antibiotic treatment, tularemia can lead to a mortality rate as high as 30% (3). Recognizing its potential as a bioweapon, the Centers for Disease Control and Prevention (CDC) classifies F. tularensis as a Category A bioterrorism agent, underscoring the urgent need for effective medical countermeasures (3). The main antibiotics used to treat tularemia include fluoroquinolones, tetracyclines, and aminoglycosides (4). However, F. tularensis exhibits resistance to several commonly used antibiotics including penicillin, polymyxin B, erythromycin, azithromycin, and carbapenems (4, 5). Given these challenges, ongoing research on novel molecular structures with unique mechanisms of action, supported by microbial genome analysis, is essential for identifying new drug targets, particularly for pathogens that are difficult to culture (6).
Despite extensive efforts, an approved vaccine for human tularemia remains elusive, primarily because of the complex immune evasion strategies employed by F. tularensis (7). Although B-cells generate antibodies, these are insufficient for complete protection. The intracellular nature of the bacterium significantly limits the effectiveness of the humoral response, emphasizing the critical role of T-cells, particularly the CD4+ and CD8+ subsets, in providing long-lasting immunity. T-cells contribute to bacterial clearance through cytokine production and the coordination of the immune response, underscoring the need for robust T-cell-mediated immunity. Given the limitations of traditional vaccines and the intricate immune response required to combat F. tularensis effectively, the development of a subunit vaccine that elicits strong coordinated T-cell and B-cell responses is essential. This strategy focuses on harnessing key immunodominant epitopes to activate both arms of the immune system to counteract the immune evasion mechanisms of bacteria and deliver comprehensive protection (8). Although conventional multi-antigen vaccines have limitations, peptide-based multi-epitope vaccines (MEVs) represent significant advancements. By leveraging in silico methods, MEVs can efficiently identify and target immunodominant epitopes, thereby addressing many shortcomings inherent in traditional vaccine approaches (9, 10). Traditional vaccine development is typically time-consuming and costly and requires extensive in vivo and in vitro testing (11). However, advances in computational biology and bioinformatics have revolutionized this process, enabling the rapid design of highly effective vaccine constructs and significantly reducing dependence on labor-intensive traditional laboratory methods (12). Reverse vaccinology is a transformative computational approach that leverages genomic data to design vaccine candidates, without the need for pathogen cultivation. By analyzing protein sequences, this method identifies multiple epitopes that trigger both cellular and humoral immune responses, while minimizing side effects (13, 14). Unlike traditional methods, it uncovers both known and novel antigens, opens new pathways for immune interventions, and enhances our understanding of pathogen-host interactions (15). Epitope-based immune-derived vaccines (IDVs) offer significant safety and efficacy advantages over conventional vaccines, particularly against complex pathogens, such as F. tularensis, which employs advanced immune evasion strategies. IDVs enhance T-cell responses, which are crucial for long-lasting immunity (16). Reverse vaccinology has successfully prioritized and designed vaccine targets for various pathogens (17–21). MEVs have emerged as effective solutions that incorporate key epitopes to stimulate stronger immune responses, thereby offering superior protection against infectious diseases (22).
In light of these considerations, our study proposes a comprehensive, two-pronged approach to combat tularemia. The first objective is to design an MEV that not only elicits a strong immune response but also effectively targets the unique challenges posed by this intracellular pathogen. By focusing on key immunodominant epitopes, we aimed to activate both T-cell and B-cell pathways, creating a balanced immune response that addresses the complexities of immune evasion by F. tularensis. The second objective was to identify new drug targets, potentially leading to novel therapeutic options for the treatment of tularemia. This integrated approach holds significant promise for the development of effective vaccines and therapeutics. By combining cutting-edge computational methods with deep immunological insights, our research aims to pave the way for innovative strategies for preventing and treating tularemia.
2 Materials and methods
2.1 Design of multi-epitope subunit
2.1.1 Genomic sequence retrieval
A total of 686 F. tularensis strains with complete genome sequences were retrieved from the GenBank database (https://www.ncbi.nlm.nih.gov/genbank/), and their proteomes were extracted for core/pan-genome analysis with BPGA software (Bacterial Pan Genome Analysis Tool), version 1.3 (23) based on the USEARCH algorithm. The BPGA analysis of these 686 strains revealed that F. tularensis had an open pan-genome and there was a significant genomic diversity within F. tularensis. Based on these findings, the F. tularensis strain 2017317779 was selected as the reference strain. This strain was classified as F. tularensis type A and was isolated from the lung tissue of a patient with tularemia in the USA in 2017 (24). The protein-coding sequences of this strain were annotated and used for further analysis.
2.1.2 Prediction of subcellular localization
The subcellular localization of all F. tularensis strain 2017317779 (GenBank: CP073122), used as a reference strain, was predicted using both of PSORTb v3.0.3 (www.psort.org/psortb/) and CELLO version 2.5 (http://cello.life.nctu.edu.tw/) for more accuracy. The results were confirmed with the TMHMM Server v2.0 web tool (https://services.healthtech.dtu.dk/service.php?TMHMM-2.0) (25–27). At this stage, only the surface-exposed proteins including extracellular and outer membrane proteins (OMPs) of F. tularensis strain 2017317779 (GenBank: CP073122) were considered for further analysis.
2.1.3 Determination of the overall antigenicity and allergenicity
The antigenicity of the putative immunogenic targets was assessed using the VaxiJen web tool (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html), with a cutoff value of ≥ 0.5. This tool utilizes Auto-Cross Covariance (ACC) transformation, converts sequences into uniform vectors based on the chemical properties of proteins, and provides predictions with an accuracy ranging from 70% to 89% (28). To evaluate allergenicity, we employed the AlgPred 2.0 server (https://webs.iiitd.edu.in/raghava/algpred2/batch.html), using a cutoff value of ≥ 0.5. This server integrates six distinct methodologies: (i) IgE mapping, (ii) MEME/Mast motif analysis, (iii) support vector machine (SVM) modules based on both amino acid and dipeptide compositions, (iv) BLAST searches against allergen-representative proteins (ARPs), and (v) a hybrid approach that combines all parameters. While MEME/Mast analysis, BLAST, and IgE mapping indicated non-allergenicity, the SVM modules and hybrid approach suggested potential allergenicity. To ensure a comprehensive evaluation, we performed an additional allergenicity assessment using AllerTOP v2.0 (https://www.ddg-pharmfac.net/AllerTOP/), which corroborated the non-allergenic nature of these proteins. Based on the combined results from both servers, we concluded that vaccine candidates are likely non-allergenic (29, 30).
2.1.4 Homology analysis of immunogenic targets against the human proteome
All selected proteins were analyzed for sequence similarity to the human proteome (Homo sapiens, Taxid: 9606) using the PSI-BLAST tool in the BLASTp database (https://blast.ncbi.nlm.nih.gov/Blast.cgi?SIDE=protein). Proteins with significant similarities were excluded to prevent cross-reactivity.
2.1.5 Prevalence of putative immunogenic targets among F. tularensis strains
The prevalence and conservation of proteins among these strains were assessed to induce a strong immune response against all F. tularensis strains. Homologs of each immunogenic target in the 686 F. tularensis strains were retrieved using BLASTp and aligned using MegaX software (31). Proteins with a prevalence > 90% were selected for further analysis (32).
2.1.6 Linear B-cell, T-cell epitopes, and quartile scoring
The VICMpred database (https://webs.iiitd.edu.in/raghava/vicmpred/submission.html) was used to categorize the functional roles of the proteins into four distinct classes: virulence, cellular processes, metabolic molecules, and unknown (33). To identify linear B-cell epitopes in the selected proteins, we used the BepiPred-2.0 tool (https://services.healthtech.dtu.dk/service.php?BepiPred-2.0), with a threshold of ≥ 0.6 (34). The B-cell epitope ratio was calculated by dividing the number of amino acids in the identified epitopes by the total amino acid count for each protein. Subsequently, TepiTool (http://tools.iedb.org/tepitool/), a resource from the Immune Epitope Database (IEDB), was used to predict binding sites for human MHC I and MHC II. For MHC I, binding sites were chosen from the top 5% of peptides, prioritizing those prevalent in the reference HLA allele set for the normal human population (35). The MHC II binding site ratio was calculated by dividing the number of MHC II binding sites by the total amino acid content in each protein. A quartile scoring method was then applied to evaluate each protein based on three indicators: functional class, MHC II binding site ratio, and B-cell epitope ratio. The overall score for each protein was calculated by summing the individual scores of these indicators. Finally, proteins in the top quartile with the highest cumulative scores were selected.
2.1.7 Protein domain search and predicting of physiochemical characteristics of immunogenic targets
The Conserved Domain Database (CDD) (https://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml) and EggNOG (http://eggnog5.embl.de/#/app/home) were used to identify the functional domains and classification of the proteins. CDD, a part of the NCBI Entrez query system, annotates the location of conserved domains in protein sequences (36, 37). The Expasy ProtParam online tool (https://web.expasy.org/protparam/) was used to calculate the molecular weights and theoretical isoelectric points of the selected proteins (38).
2.1.8 Tertiary structure prediction and characterization of the conformational B-cell epitopes
The Swiss Model (https://swissmodel.expasy.org/) was used to predict the 3D structures of the selected proteins (39). To assess and validate the quality and stability of these models, we used the ProSA-web server (https://prosa.services.came.sbg.ac.at/prosa.php) and ERRAT (https://saves.mbi.ucla.edu/results?Job%20=1243713,%20p=errat) to detect potential errors (40, 41). Conformational B-cell epitopes were identified using the ElliPro server (http://tools.iedb.org/ellipro/) at a threshold of ≥ 0.8. The predicted epitopes were then visualized on the protein surface using Jmol software, with each epitope represented by different colors for clarity (42).
2.1.9 Analysis of protein-protein interactions
The STRING software (https://string-db.org/) server was used to analyze the interaction network of proteins with unknown functions (43). In this analysis, interactions with high confidence scores > 0.7 were considered to minimize false-positive and false-negative results (44).
2.1.10 Prediction and selection of optimal epitopes for vaccine target
B-lymphocytes are crucial in humoral immunity and produce antibodies that detect and neutralize pathogens. To identify potential vaccine targets, the selected protein sequences were scanned for linear B-cell epitopes using the Kolaskar-Tongaonkar algorithm within the Antibody Epitope Prediction tool hosted on the Immune Epitope Database (IEDB) analysis server (http://tools.iedb.org) (35). The predicted B-cell epitopes were evaluated for MHC I processing compatibility, focusing on the most prevalent HLA alleles in Iran, using the IEDB server (35). The VaxiJen web tool (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html) was used to predict the antigenicity of putative immunogenic epitopes, with a cut-off value of ≥ 0.5. Additionally, AlgPred 2.0 serve (https://webs.iiitd.edu.in/raghava/algpred2/batch.html) was employed with a cut-off value ≥ 0.5 to investigate the allergenicity of these epitopes. Epitope conservation and hydropathicity were determined using the IEDB analysis server (http://tools.iedb.org/conservancy/). Epitopes that were antigenic and non-allergenic showed > 90% conservation, and the lowest hydropathicity scores were selected as potential candidates for subunit vaccine development.
2.1.11 Structural construction and validation of the vaccine candidate
Effective vaccine design requires appropriate antigenic peptide folding and linker incorporation to maintain epitope integrity, prevent unintended junctional epitopes, and enhance immunogenicity. Without suitable linkers, multi-epitope vaccines may generate unwanted proteins or epitopes, reducing their effectiveness and stability (45). To construct an MEV against F. tularensis, linear B-cell epitopes were fused using flexible GPGPG linkers. These flexible linkers, composed of small amino acids, such as glycine and serine, ensure adequate separation between epitope domains and minimize junctional epitope formation, allowing the protein domains to move freely and facilitating proper protein folding. Flexible linkers are also advantageous for enhancing antibody accessibility to epitopes and improving the folding efficiency (46, 47). To optimize antigenicity, epitope shuffling techniques were used to identify the best epitope arrangement with the highest antigenicity score. The 3D structures of the selected proteins were predicted using the Swiss Model (https://swissmodel.expasy.org/) (39). The quality and stability of the 3D models were further evaluated using the ProSA-web (https://prosa.services.came.sbg.ac.at/prosa.php) and ERRAT (https://saves.mbi.ucla.edu/results?Job%20=1243713,%20p=errat) servers to detect structural errors (40, 41). Furthermore, the affinities of the multi-epitope vaccine against human Toll-like receptor 2 (TLR2, PDB: 2Z7X), human Toll-like receptor 4 (TLR4 PDB: 3FXI), HLA-DR-B (PBD: 3PDO_B), and HLA-A chain A (PDB:8XG2_A) were evaluated using the HDOCK web tool (http://hdock.phys.hust.edu.cn/) (48). The interactions of the docked complexes were visualized and validated using the PDBsum server (https://www.ebi.ac.uk/thornton-srv/databases/pdbsum/) (49).
2.1.12 Evaluation of allergenicity, antigenicity, solubility, and physicochemical properties of MEV
To assess the allergenicity of the vaccine construct, we utilized the AlgPred 2.0 server (https://webs.iiitd.edu.in/raghava/algpred2/batch.html) with a cut-off value ≥ 0.5. Allergenicity analysis was performed using AllerTOP v. 2.0 (https://www.ddg-pharmfac.net/AllerTOP/). Both tools consistently indicated that the vaccine construct is non-allergenic, thus mitigating the risk of allergic reactions during vaccination protocols (29, 30). Next, we evaluated the antigenicity of MEV using the VaxiJen server tool (http://www.ddg-pharmfac.net/vaxijen/VaxiJen/VaxiJen.html) (28). Subsequently, the Protein-Sol server (https://protein-sol.manchester.ac.uk/) was employed to predict the solubility of the engineered MEV, where scores above 0.45 indicate solubility (50). Further characterization of MEV included the prediction of major physicochemical characteristics using the ExPASy ProtParam web tool (https://web.expasy.org/protparam/) (38). This tool provides insights into the molecular weight (Mw), theoretical isoelectric point (pI), amino acid composition, in vitro and in vivo protein half-life, aliphatic index, instability index, and grand average of hydropathicity (GRAVY) score (51). These parameters are essential to understand the stability, solubility, and potential effectiveness of MEVs as vaccine candidates.
2.1.13 Reverse translation and in silico cloning
To ensure codon compatibility and optimize the vaccine construct for expression, we used the Java Codon Adaptation Tool (https://www.jcat.de/) (52). This tool refines codon usage specifically for expression in Escherichia coli K12, following the recommended guidelines. For optimal expression, it is important that the protein sequence maintains a GC content between 30–70% and achieves a Codon Adaptation Index (CAI) value above 0.8 (52). Once the sequence was optimized, we performed in silico cloning of the finalized MEV model using the SnapGene v7.2 software (https://www.snapgene.com/resources). This software enabled a virtual cloning process, allowing insertion of the optimized vaccine construct into a vector suitable for expression studies and preparation for experimental validation.
2.1.14 Simulations for evaluating the immune response of the vaccine construct
The C-ImmSim tool (https://kraken.iac.rm.cnr.it/C-IMMSIM/) employs position-specific scoring matrices to simulate and predict the intensity of immune responses triggered by vaccines over different time intervals (53). This model helps researchers to understand how vaccine timing and administration influence immune dynamics, which is crucial for optimizing vaccination strategies and evaluating the effectiveness of vaccine candidates.
2.1.15 Molecular dynamics simulation
Molecular dynamics (MD) simulations provide crucial insights into the structural stability and functionality of vaccines in a simulated cytosolic environment. In this study, we explored the interactions between MEV, TLR2, and TLR4 using a 100-nanosecond MD simulation conducted using GROMACS version 2018. The MEV and receptors were situated in a dodecahedral solvent box containing TIP3P water molecules. To simulate physiological conditions, some water molecules were randomly substituted with sodium (Na+) and chloride (Cl-) ions. The system was then subjected to energy minimization, followed by equilibration under constant volume (NVT) and pressure (NPT) conditions to ensure system stability. Throughout the simulation, the particle mesh Ewald (PME) method was employed to compute electrostatic interactions, and LINCS constraints were applied to maintain the hydrogen bond lengths. This methodology enabled us to accurately simulate the interactions between MEV and TLRs over 100 nanoseconds (54).
2.2 Identification of novel drug targets
2.2.1 Detection of cytoplasmic protein sequences
Cytoplasmic protein sequences of F. tularensis strain 2017317779 were determined using PSORTb version 3.0.3 (http://www.psort.org/psortb/) and CELLO v. 2.5 (http://cello.life.nctu.edu.tw/) (25–27). Given their crucial roles in cellular processes, cytoplasmic proteins are promising targets for small-molecule drug targeting (55).
2.2.2 Selecting human non-similar protein sequences
The homology of the selected proteins to the human proteome (Homo sapiens, taxid:9606) was evaluated using PSI-BLAST (https://blast.ncbi.nlm.nih.gov/) to identify proteins similar to those in humans. Proteins that demonstrated significant similarities were excluded from further analysis. Additionally, the MITOMASTER database (http://mammag.web.uci.edu/twiki/bin/view/Mitomaster) was used to assess the similarity between selected proteins and human mitochondrial proteins (55). This precaution ensured that the chosen proteins were distinct from those present in human mitochondria, reinforcing their potential as candidates for further investigation.
2.2.3 Identification of unique metabolic pathway proteins
The KAAS server from the Kyoto Encyclopedia of Genes and Genomes (KEGG) database (https://www.genome.jp/kaas-bin/kaas_main) and BLASTp analysis were employed to identify non-homologous to host proteins that are crucial for the study (56). Protein sequences with distinct pathways from the host were selected for analysis, ensuring that only the proteins involved in specific host pathways were included. This approach focuses on unique biological interactions and processes.
2.2.4 Detection of essential proteins
The DEG 15.2 server contains all crucial proteins involved in key functions of bacterial life, as determined by experimental studies (57). Essential proteins were identified using Genome BLAST with a coverage > 90% and an identity > 80% from the DEG database (http://origin.tubic.org/deg/public/index.php/index).
2.2.5 Identifying novel therapeutic targets
To highlight the uniqueness of the selected proteins as pharmacological targets, we analyzed the remaining candidates from earlier stages using the DrugBank database (https://www.drugbank.ca/structures/search/bonds/sequence) (58). This evaluation assessed their druggability and reinforced their potential as novel therapeutic candidates based on well-established criteria. The proteins were systematically screened against all known drug targets in DrugBank and those didn’t exhibit any proposed drugs, were classified as novel drug targets.
2.2.6 Identification of proteins non-similar to the host microbiome
The aim of examining the lack of similarity between the F. tularensis metabolic pathway proteins and those from beneficial host microorganisms was to ensure their distinctiveness. We used the NCBI BLAST server for sequence comparisons (See Supplementary Data 1 for details on gut microbiota) (59). Proteins exhibiting significant similarities with the host microbiome proteins were excluded from the study.
2.2.7 Prediction of functional domains of novel drug targets
Functional domains of the proteins were identified using the Conserved Domain Database (CDD) (https://www.ncbi.nlm.nih.gov/Structure/cdd/cdd.shtml) based on the NCBI Entrez query and EggNOG (http://eggnog5.embl.de/#/app/home) (36, 37).
2.2.8 Analysis of protein-protein interactions
To analyze the interaction network of hypothetical proteins related to distinct drug targets, STRING 11.5 server (https://string-db.org) was employed (43). Interactors with high confidence scores > 0.7 were included in the protein network to mitigate false-positive and false-negative results. Eliminating the query protein resulted in changes in the number of edges (interconnections) and nodes (interconnected proteins), highlighting its influence on biological processes in the organism (44).
3 Results
3.1 Design of MEV
3.1.1 Sequence retrieval
The core-to-pan protein ratio was low and the core-pan plot appeared almost open (Figure 1A). Consequently, using the core proteome was deemed unsuitable, leading to the decision to utilize the entire genome of the F. tularensis strain 2017317779 (24). The KEGG distribution plot demonstrated that most core, accessory, and unique genes were involved in the metabolism of this pathogen (Figure 1B). Based on these findings, the proteome of the F. tularensis strain 2017317779 was retrieved from the UniProt database (http://www.uniprot.org/). The workflow for identifying new immunogenic targets and designing multi-epitope vaccines against F. tularensis is illustrated in Figure 2A.
Figure 1
Figure 2
3.1.2 Prediction of subcellular localization
All 1,921 proteins in the reference strain were analyzed using PSORTb, CELLO, and TMHMM. In total, 361 proteins were identified as OMPs located in the extracellular space.
3.1.3 Prediction of antigenicity and allergenicity
A total of 123 antigenic proteins were identified, of which 116 were determined to be non-allergenic.
3.1.4 Selecting non-homologous proteins from the human proteome
All 116 proteins were evaluated for homology with Homo sapiens (taxid: 9606). This analysis revealed that 101 proteins were non-homologous, while 15 proteins were homologous; thus, 15 homologous proteins were excluded.
3.1.5 Prevalence of putative immunogenic targets among circulating F. tularensis strains
The frequency of 101 selected proteins was assessed in the 686 F. tularensis strains. Five proteins exhibited a low prevalence (< 90%) among these strains and were subsequently excluded from the study.
3.1.6 Quartile score-refined proteins: their conserved domains and physicochemical properties
Using the quartile method, 12 immunogenic targets were identified from the 96 candidate proteins (Figure 3). These targets were scored within the top 25% of properties associated with successful vaccine development. Notably, four proteins were associated with cell wall, membrane, and envelope biogenesis, which are crucial for bacterial survival and serve as potential targets for immune attack. The identified proteins were FopA (WP_003023303.1), OmpA family protein (WP_003020808.1), and a hypothetical protein (WP_003026145.1). Notably, another hypothetical protein (WP_003029346.1) plays a dual role in intracellular trafficking and cell wall biogenesis, suggesting its potential involvement in immune responses. In addition, eight proteins with unknown functions were identified, including hypothetical proteins (WP_003023105.1, WP_003029578.1, WP_003022843.1), PD40 (WP_003021546.1), DUF2147 (WP_003023209.1), DUF3281 (WP_003026358.1), DUF4124 (WP_003022381.1), and a carbohydrate-binding protein (WP_227644127.1) (Figure 3). All identified proteins had molecular weights less than 110 kDa.
Figure 3
3.1.7 Tertiary structure prediction and characterization of conformational B-cell epitopes
The structures predicted by SWISS-MODEL were validated using Verify 3D, PROSA, and ERRAT analyses, which confirmed the accurate folding of all 12 proteins (Supplementary Data 2). Conformational epitopes were identified and visualized based on the predicted tertiary structures. The number of conformational epitopes for the 12 putative immunogenic targets is as follows: hypothetical protein (WP_003026145.1) (three epitopes), outer membrane protein FopA (WP_003023303.1) (five epitopes), OmpA family protein (WP_003020808.1) (three epitopes), hypothetical protein (WP_003029346.1) (seven epitopes), DUF2147 (WP_003023209.1) (four epitopes), hypothetical protein (WP_003023105.1) (five epitopes), carbohydrate-binding protein (WP_227644127.1) (two epitopes), DUF4124 (WP_003022381.1) (six epitopes), hypothetical protein (WP_003022843.1) (three epitopes), DUF3281 (WP_003026358.1) (two epitopes), PD40 (WP_003021546.1) (six epitopes), and hypothetical protein (WP_003029578.1) (seven epitopes). See Figure 3. Additional details are provided in Supplementary Table 1.
3.1.8 Protein-protein interaction networks
Based on the STRING database, the functions of eight candidate vaccine proteins DUF2147 (WP_003023209.1), hypothetical protein (WP_003023105.1), DUF4124 (WP_003022381.1), carbohydrate-binding protein (WP_227644127.1), hypothetical protein (WP_003022843.1), DUF3281 (WP_003026358.1), PD40 (WP_003021546.1), and hypothetical protein (WP_003029578.1) were not determined. The protein with accession number WP_003023209.1, interacts with the DNA mismatch repair protein (FTT_0486, mutL), several hypothetical proteins (FTT_0066, FTT_1537c, ORF FTT_0485, FTT_0220c, FTT_0045, FTT_1704, and FTT_1349), lipase/acyltransferase (FTT_0023c), and disulfide bond formation protein B (FTT_0107c, dsbB). The protein, with accession number WP_003021546.1, interacts with serine hydroxymethyltransferase (SHMT) and deoxyribodipyrimidine photolyase (PhrB). The protein with accession number WP_003023105.1 interacts with an outer membrane lipoprotein (FTT_0198, Blc) and a hypothetical protein (FTT_0200). The proteins with accession numbers WP_003022381.1, and WP_003022843.1 interacted with two hypothetical proteins (Figure 4). The string database did not predict the interactions for hypothetical protein (WP_003029578.1), carbohydrate-binding protein (WP_227644127.1), and DUF3281 (WP_003026358.1).
Figure 4
3.1.9 Multi-epitope vaccine construct processing
Of the 12 proteins, seven B-cell epitopes containing T-cell epitopes from four proteins exhibited promising properties for inclusion in the final vaccine construct (Table 1). Epitopes were linked using a GPGPG linker. The vaccine sequence was converted into FASTA format and evaluated against various criteria, including antigenicity, non-allergenicity, non-toxicity, and solubility. A schematic representation of the final multi-epitope vaccine peptide is shown in Figure 5. The SAVES 6.0 server provided an ERRAT score of 100, and the vaccine demonstrated 84.6% Ramachandran-favored residues with 15.4% in additional allowed regions. The antigenicity score of MEV predicted by the VaxiJen server was 1.061. AlgPred 2.0 and AllerTOP v2.0, were confirmed to be non-allergenic. The selected vaccine candidate exhibited the highest solubility scores, with a value of 0.914. MEV has a low molecular weight (21.27 kDa) and demonstrates extreme thermotolerance, as indicated by its high aliphatic index (61.34). The theoretical pI of MEV was 4.81, and it was recognized as hydrophilic owing to a negative GRAVY score (-0.946). The instability index of the vaccine candidate was 35.9, which categorizes it as a stable polypeptide. The estimated half-life of MEV is 4.4 hours in mammalian reticulocytes in vitro, and >10 h in E. coli in vivo. The results of protein-protein docking showed that the MEV-TLR-2 complex featured 10 hydrogen bonds and 154 unbound contacts, whereas the MEV-TLR-4 complex exhibited seven hydrogen bonds, three salt bridges, and 132 unbound contacts. The MEV demonstrated nearly equal interactions with TLR-2 (docking score: -235.03 kcal/mol, confidence score: 0.8456, and ligand RMSD: 57.67 Å) and TLR-4 (docking score: -215.94 kcal/mol, confidence score: 0.7890, and ligand RMSD: 42.13 Å). For the HLA interactions, protein-protein docking results showed that the MEV-HLA-A complex featured 3 hydrogen bonds and 179 unbound contacts, with a docking score of -241.44 kcal/mol, a confidence score of 0.8616 and ligand RMSD of 32.93 Å. In comparison, the MEV-HLA-DR-B complex exhibited 6 hydrogen bonds, 1 salt bridge, and 179 unbound contacts, with a docking score of -253.63 kcal/mol, a confidence score of 0.8882, and ligand RMSD of 34.59 Å. The detailed vaccine-receptor interactions are shown in Figure 6.
Table 1
| Protein (Accession number) | Start | End | length | Epitope | Antigenicity | Ag (Score) | Allergenicity | Conservancy % |
|---|---|---|---|---|---|---|---|---|
| Hypothetical protein (WP_003026145.1) | 52 | 72 | 21 | DKGVGEINNSSSVSPNNIAGV | Ag | 0.6682 | non-allergen | 100 |
| Hypothetical protein (WP_003029346.1) | 60 | 86 | 27 | NHNAKLQANDTIKYEIKQKQNIPWKSL | Ag | 0.8526 | non-allergen | 100 |
| OmpA family protein (WP_003020808.1) | 23 | 75 | 53 | STRPDNSDLIKDKYAGVDSSQALEMSSQIYGSDKLSSDQ VEQMKKELMNINCR | Ag | 0.6334 | non-allergen | 100 |
| PD40 (WP_003021546.1) | 20 | 50 | 31 | ADDLNAKIVNESVTKYSNNVETDADTNTNSP | Ag | 1.2715 | non-allergen | 100 |
| 230 | 245 | 16 | YNINSKDAATAIEFND | Ag | 1.0516 | non-allergen | 100 | |
| 255 | 263 | 9 | IKSLQGSDT | Ag | 1.0523 | non-allergen | 100 | |
| 402 | 416 | 15 | IHYQHNDDNKIDHLD | Ag | 0.7518 | non-allergen | 100 |
Seven promising epitopes from four selected F. tularensis OMPs were used in the MEV.
Start: The starting amino acid position of the epitope within the protein sequence; End: The ending amino acid position of the epitope within the protein sequence, Length: The number of amino acids in the epitope sequence; Antigenicity: Indicates if the epitope is recognized as an antigen; Antigenicity Score: A numerical score reflecting the strength of the epitope’s antigenic potential, with higher scores indicating greater antigenicity; Allergenicity: Indicates whether the epitope is considered an non-allergen; Conservancy (%): The percentage of conservation of the epitope across different species or strains.
Figure 5
Figure 6
3.1.10 In silico cloning of the design
To optimize processivity and expression in E. coli, the MEV sequence was subjected to rigorous reverse translation using the E. coli K12 codon table. The Codon Adaptation Index (CAI) was calculated as 0.95. This index quantifies how well codon usage in a sequence matches the codon usage bias of the host organism, with a value of 1.0, indicating perfect adaptation. The sequence also exhibited a GC content of 52.05%, which falls within the favorable range (30-70%) for expression in E. coli. Subsequently, using the SnapGene software, the vaccine sequence was inserted into a highly efficient ATOH1_Puc18 expression plasmid vector (Figure 7).
Figure 7
3.1.11 Immune simulation of predicted vaccine construct
The vaccine construct peaked rapidly after injection, and then declined, indicating a rapid initial immune response. IgM was the first antibody to respond to MEV and peaks shortly after MEV exposure. Subsequently, IgG antibodies (IgG1 + IgG2) were raised, and the elevation of these two antibodies was critical for long-term immunity. The combined IgM and IgG response showed a broad peak, indicating a sustained antibody presence to combat the antigen (Figure 8A). The initial immune response appears to be driven by IFN-γ, TGF-β, and IL-2, as their levels peaked at around day 5-6. This was followed by a peak in IL-12 and IL-10 levels on day 6-7, suggesting their involvement in sustaining and regulating immune response (Figure 8B). TC cells (CD4 T-cells and CD8 T-cells) peaked around day 10-15, and after 32 days, TC cells populations exhibited decline in concentration (Figure 8C). The population of natural killer (NK) cells peaked around days 7-10 and declines over 35 days (Figure 8D). The initial drop in the total and resting dendritic cell (DC) populations may be attributed to an early response to external injection of the vaccine construct (Figure 8E). This decline was followed by recovery, indicating an adaptive mechanism that restores the cell populations to a stable state. These dynamics highlight the effective engagement of dendritic cells in processing and presenting vaccine antigens, which are essential for a successful immunization response. These results suggest that the vaccine candidate successfully activated the immune system while maintaining the overall stability of the dendritic cell populations. Following the injection of the vaccine candidate, the macrophage populations exhibited dynamic changes, indicative of an effective immune response (Figure 8F).
Figure 8
3.1.12 Molecular dynamic simulation
MD simulations have proven invaluable in guiding experimental validation by analyzing conformational changes, stability variations, and the overall evolution of complex systems under cytosol-like conditions. These simulations allowed for the assessment of parameters such as the RMSD, root mean square fluctuation (RMSF), and radius of gyration. RMSD is a critical metric for evaluating the stability of receptor-ligand complexes. In our MD simulation study, the RMSD graph revealed the MEV, MEV_TLR-2 complex, and MEV_TLR-4 complex exhibited stable interactions, as shown in Figure 9A. Furthermore, we quantified the RMSF of the complexes to assess their flexibility across amino acid residues. Figure 9B illustrates that the RMSF values for the MEV, MEV_TLR-2 complex, and MEV_TLR-4 complex were similar, indicating similar flexibility. Additionally, we analyzed the radius of gyration (Rg) to evaluate the mobility and overall flexibility of the complexes. The gyration graph shown in Figure 9C corroborates the RMSD findings.
Figure 9
3.2 Identification of novel drug targets
3.2.1 Detection of cytoplasmic protein sequences: proteins with no similarities to the host
All proteins from the reference strain (1921 proteins) were analyzed using PSORTb and CELLO. A total of 918 cytoplasmic proteins were identified. Using PSI-BLAST, 520 proteins showed no similarity to human proteins, while 398 proteins were excluded due to their similarity with the human proteome. None of the proteins exhibited similarities with human mitochondrial proteins.
3.2.2 Identification of unique metabolic pathway proteins
Following BLAST analysis using the KAAS database, we identified 282 of the 520 non-homologous proteins that were involved in metabolic pathways common to humans and were consequently excluded from further analysis. The remaining 238 non-homologous proteins were retained for subsequent analyses.
3.2.3 Selecting essential protein sequences
Antibacterial agents are often designed to target and inhibit critical gene products, making essential proteins particularly effective therapeutic targets (60). A total of 37 proteins were identified as significant hits using a dataset of essential bacterial proteins from the DEG 15.2 database. These proteins are essential for the survival of F. tularensis, underscoring their potential as targets for therapeutic intervention (61). Targeting the unique genetic components specific to microbes can be particularly advantageous for developing species-specific treatments.
3.2.4 Identify novel drug targets
Among the 37 F. tularensis proteins identified as significant hits from the DEG 15.2 database, four proteins showed similarities to targets of FDA-approved or experimental drugs listed in the DrugBank database and were therefore excluded from further analysis. The remaining 33 proteins were selected for further investigation.
3.2.5 Determining host microbiome non-similar proteins
In the final analysis, 10 pathogen proteins were identified using microbiome BLAST, which showed no similarity to the human microbial flora (Table 2). Therefore, these proteins have been proposed as exclusive drug targets for combating various F. tularensis strains.
Table 2
| No. | Accession number) | EggNOG and CCD | Gut microbiota BLAST* |
|---|---|---|---|
| 1 | WP_003017413.1 | Asp-tRNA (Asn)/Glu-tRNA (Gln) amidotransferase subunit GatC | – |
| 2 | WP_003023081.1 | 30S ribosomal protein S16 | – |
| 3 | WP_003017784.1 | Hypothetical protein | – |
| 4 | WP_003014157.1 | Haloacid dehalogenase | – |
| 5 | WP_003020066.1 | Hypothetical protein | – |
| 6 | WP_003020080.1 | Hypothetical protein | – |
| 7 | WP_003022220.1 | uroporphyrinogen-III synthase | – |
| 8 | WP_042522581.1 | NAD(P)-binding protein | – |
| 9 | WP_003022345.1 | class I SAM-dependent methyltransferase | – |
| 10 | WP_003022350.1 | Hypothetical protein | – |
The shortlist of 10 novel drug targets against F. tularensis.
*: Minus symbol indicates no significant similarity was found with gut microbiota proteins.
3.2.6 Protein-protein interactions
Based on CDD and EggNOG analyses, the functions of six drug target proteins were detected, whereas four hypothetical proteins (WP_003017784.1, WP_003020066.1, WP_003020080.1, and WP_003022350.1) lacked identifiable functions (Table 2). Based on the STRING database results, hypothetical proteins (WP_003017784.1) interacts closely with the cytochrome b561 family protein (FTT_0219c), lipase/acyltransferase proteins (FTT_0023c), Type IV pili lipoprotein (FTT_1057c), conserved hypothetical protein (FTT_1537c), LicB-like transmembrane protein (FTT_0157c), conserved membrane protein similar to Q9X885 (FTT_0181c), a conserved hypothetical protein similar to AAP58972.1 (Q7X3I5) from F. novicida (FTT_1704), and two hypothetical proteins (FTT_0485, FTT_0066). Hypothetical protein (WP_003020066.1) shows an expression correlation with stringent starvation protein A (FTT_0458) and is similar to the macrophage growth locus A protein from F. novicida (FTT_1275). Hypothetical protein (WP_003020080.1) interacts with a hypothetical protein (FTT_0392c), methionine aminopeptidase (FTT_0393), 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase (FTT_0397), and DNA topoisomerase IV subunit A (FTT_0396). Hypothetical protein (WP_003022350.1) interacts with Tryptophanyl-tRNA synthetase (TrpS), antiporter protein (FTT_1490), Dephospho-CoA kinase (CoaE), Adenylylsulfate kinase (MsrA1), and Choloylglycine hydrolase (Cbs) (Figure 4).
4 Discussion
Single-antigen vaccines against tularemia are insufficient to provide comprehensive protection, highlighting the necessity for multi-antigen strategies (62–65). Multi-antigen vaccines that incorporate various proteins typically offer improved efficacy by activating broader immune responses (66–68). For example, a tri-antigen vaccine (DnaK, OmpA, and Tul4) generated appropriate antibody responses, but showed low protective efficacy (69). This indicates that while antibodies play a crucial role, effective protection also relies on strong T-cell responses and optimal combinations of antigens. A deeper understanding of these factors is essential for designing more effective vaccines.
In this study, we designed an MEV using immunodominant epitopes from F. tularensis OMPs to stimulate both B-cell and T-cell responses to protect against tularemia (70). It has been shown that OMP immunization provides the highest level of protection against tularemia in animal models (66). The membrane components of F. tularensis have demonstrated protective efficacy in both prophylactic and post-exposure therapeutic models of tularemia (66, 71, 72). Additionally, a study using a reverse vaccinology approach identified surface proteins as target immunogens for antibody-based immunotherapies against tularemia (73). Reverse vaccinology is a powerful technique for identifying immunogenic and surface-exposed proteins (74, 75), thus enabling the discovery of novel vaccine candidates that traditional methods may miss. An example of such success is the 4CMenB vaccine (Bexsero), the first approved vaccine against Neisseria meningitidis serogroup B (MenB) (76, 77). These examples highlight the importance of including a mix of antigens to achieve a protective immune response (78).
Our proposed MEV includes seven immunogenic epitopes from four OMPs, selected for their high antigenicity, solubility, thermostability, and optimal half-life. In silico analysis indicated effective expression and purification in E. coli, suggesting a cost-effective manufacturing process (79). The docking results indicated that the MEV construct strongly interacted with both TLR-2 and TLR-4, as well as HLA-A and HLA-DR-B, key receptors for initiating immune responses. The stable binding observed with both Class I and Class II MHC molecules is crucial for eliciting T cell-mediated adaptive immunity. These findings suggest that MEV has the potential to stimulate both the innate and adaptive immune pathways, thereby providing broad protection. This design yielded a stable and reproducible MEV, supported by docking and MD simulations, as well as the known roles of TLR2 (80), suggesting that the MEV vaccine construct has the potential to trigger a robust and multifaceted immune response and could be safe for human use. The simulations indicated a strong immune response to F. tularensis infection, suggesting a long-lasting immunity. The involvement of immune cells, such as macrophages, T-cells, and NK cells, along with signaling molecules, such as IL-2, IFN-γ, and IL-12, indicates a comprehensive immune response. These results align with those of studies highlighting the roles of IL-2, TNF-α, IFN-γ, and IL-12 in the management of F. tularensis infection (81–83). Additionally, the presence of antibodies (IgM and IgG2) suggests mechanisms such as macrophage phagocytosis and complement activation, further supporting MEV's multi-faceted approach (84). However, while the simulation highlighted increased immune cell populations, the absence of activation markers raises concerns regarding the accuracy of predicting functional immune engagement and vaccine efficacy. The recruitment of T-cells or macrophages does not ensure their active participation in the immune response. Activation markers such as CD80/CD86 and MHC are crucial for verifying that antigen-presenting cells (APCs) effectively communicate with T-cells, priming them for action. Without these markers, the immune response may remain suboptimal, potentially compromising the overall protective efficacy of the vaccine (85). This underscores the importance of further validation through both in vitro and in vivo studies to confirm the functional activation of immune cells.
To overcome the limitations of core proteins and achieve broad-spectrum protection, we employed a two-pronged strategy. First, we targeted vaccine candidates with high prevalence (> 90%) across a wide range of pathogenic F. tularensis strains, which were identified using a highly virulent strain as a reference. Second, we prioritized epitopes that exhibited complete sequence conservation (100 %). This comprehensive approach has the potential to develop a vaccine capable of providing robust protection against a broad spectrum of tularemia-causing F. tularensis strains. Supporting this strategy, a study by Subrat Kumar Swain et al. demonstrated that the strategic combination of B-cell and T-cell epitopes effectively induces a strong and durable immune response, thereby establishing both cellular and humoral immunity (86). This dual-epitope strategy enhanced the ability of the vaccine to elicit a well-rounded and long-lasting immune response against F. tularensis strains.
Abbas Khan et al. employed structural proteomics to design a multi-epitope vaccine for tularemia, using F. novicida, a less virulent strain (87). In contrast, our approach focused on F. tularensis type A, isolated from a patient with tularemia, ensuring greater relevance for vaccine development. This differs, from the findings of Khan et al, who identified only four potential targets in F. novicida (87). This discrepancy highlights the potential strain-specific variations in immunogenic targets. Of the 12 proteins identified in our study, only four contained suitable epitopes for MEV design. This demonstrates that a protein may be antigenic and exhibit other essential vaccine candidate properties, yet still lack suitable epitopes for eliciting protective immunity. For instance, FopA was identified as a vaccine candidate in our study but did not provide any suitable epitopes. Similarly, previous studies have shown that FopA does not elicit protective immunity against tularemia in animal models (88).
This study identified ten promising drug development targets that are crucial for the survival and metabolism of F. tularensis, thus making them ideal candidates for novel treatments. The targets included Asp-tRNA (Asn)/Glu-tRNA (Gln) amidotransferase subunit GatC (WP_003017413.1), NAD(P)-binding protein (WP_042522581.1), 30S ribosomal protein S16 (WP_003023081.1), Class I SAM-dependent methyltransferase (WP_003022345.1), haloacid dehalogenase (WP_003014157.1), and uroporphyrinogen-III synthase (WP_003022220.1). Four hypothetical proteins (WP_003017784.1, WP_003020080.1, WP_003020066.1, WP_003022350.1). These targets offer significant potential for developing new therapeutic interventions. Among these, GatC (WP_003017413.1), an amidotransferase subunit, is essential for bacteria to thrive in host cells. Inhibition of GatC can effectively prevent infection by halting bacterial proliferation (89). The NAD(P)-binding protein (WP_042522581.1) is another promising target. This vital coenzyme is involved in numerous biochemical processes, with approximately 5.4% of the proteins in the UniProtKB/Swiss-Prot database being annotated as NAD(P)-binding. These proteins, such as ADP-ribosylating toxins and poly-ADP-ribose polymerases, are recognized as therapeutic targets. Inhibition of NAD(P)-binding proteins can disrupt crucial redox and non-redox reactions within a pathogen, thereby crippling its metabolic functions (90). 30S ribosomal protein S16 (WP_003023081.1) plays a critical role in protein synthesis. Targeting bacterial ribosomes has been a successful antibiotic strategy, exemplified by drugs such as linezolid, tetracycline, and chloramphenicol (91–93). Class I SAM-dependent methyltransferase (WP_003022345.1) is also a promising target because of its vital role in cellular processes, such as gene expression, protein function, and cell signaling. Inhibition of these enzymes could disrupt these critical functions, hindering the ability of the bacterium to operate (94). Haloacid dehalogenase (WP_003014157.1), a HAD-like phosphatase, performs various cellular functions including primary and secondary metabolism, enzyme activity or protein assembly regulation, cell housekeeping, and nutrient uptake. Targeting this enzyme can disrupt the essential processes (95). Uroporphyrinogen III synthase (WP_003022220.1) is a cytosolic enzyme involved in heme biosynthesis, catalyzing the formation of uroporphyrinogen III from hydroxymethylbilane. Targeting this enzyme can interfere with the heme biosynthesis pathway in bacteria (96). In the present study, we identified four hypothetical proteins with unknown functions as potential vaccine targets. Understanding the roles of these proteins could open new avenues for treatment, underscoring the importance of further research to uncover novel therapeutic possibilities.
5 Conclusion
Tularemia demands the development of novel vaccine candidates, identification of new drug targets, and the adoption of modern strategies for effective management. In this study, we identified ten proteins involved in key cellular processes and pathways as potential immunogenic targets, including GatC, NAD(P)-binding protein, 30S ribosomal protein S16, Class I SAM-dependent methyltransferase, haloacid dehalogenase, uroporphyrinogen-III synthase, and four hypothetical proteins, which warrant further investigation. To address the challenges posed by F. tularensis and improved prophylactic measures, we designed an MEV. Rational design and proven safety of MEVs have accelerated the development of more stable, efficient, and broad-spectrum vaccine candidates that target a range of pathogens and cancers. This rapidly advancing field of immunoinformatics offers great potential for reducing time and resource expenditure, speeding up vaccine discovery, and making it an area ripe for further exploration. Our proposed MEV was predicted to be non-allergenic and to exhibit favorable physicochemical properties. Molecular docking studies combined with molecular dynamics simulations demonstrated the ability of the vaccine to form strong and stable interactions with immune receptors. Immune simulations further suggested the potential of this vaccine to elicit robust immune responses. While the construct shows promise as a safe and effective solution for combating tularemia, comprehensive in vitro and in vivo studies are essential to assess its efficacy under native conditions. The promising results of the computational analyses will be experimentally evaluated to confirm by the authors soon.
Statements
Data availability statement
The genome of Francisella tularensis is accessible at https://www.ncbi.nlm.nih.gov/datasets/genome/?taxon=263. The article files will be made available upon publication, and additional materials can be found in the Supplementary Information Files.
Ethics statement
The ethical considerations of the study were approved by the Ethical Committee of the Pasteur Institute of Iran (IR.PII.REC.1403.008).
Author contributions
SM: Conceptualization, Methodology, Software, Writing – original draft, Investigation. SE: Conceptualization, Data Curation, Writing – review & editing, Investigation, Project administration, Resources, Validation, Supervision, Funding acquisition. MA: Conceptualization, Data Curation, Writing – review & editing, Investigation, Project administration, Resources, Validation, Supervision, Funding acquisition. EM: Conceptualization, Data Curation, Writing – review & editing, Investigation. BS: Methodology, Software, Writing – original draft. AS: Conceptualization, Data Curation, Writing – review & editing, Investigation. MC: Conceptualization, Data Curation, Writing – review & editing, Investigation. FB: Conceptualization, Methodology, Software, Data Curation, Writing – review & editing, Investigation, Project administration, Resources, Validation, Supervision, Funding acquisition.
Funding
The author(s) declare that financial support was received for the research and/or publication of this article. This study is part of a Ph.D. thesis supported by the Pasteur Institute of Iran (Grant number: 66002217) and is based on research funded by the Iran National Science Foundation (INSF) (Project number: 4034040).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Publisher’s note
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2025.1479862/full#supplementary-material
References
1
MulliganMJStapletonJTKeitelWAFreySEChenWHRouphaelNet al. Tularemia vaccine: Safety, reactogenicity, "Take" skin reactions, and antibody responses following vaccination with a new lot of the Francisella tularensis live vaccine strain - A phase 2 randomized clinical Trial. Vaccine. (2017) 35:4730–7. doi: 10.1016/j.vaccine.2017.07.024
2
OystonPCQuarryJE. Tularemia vaccine: past, present and future. Antonie Van Leeuwenhoek. (2005) 87:277–81. doi: 10.1007/s10482-004-6251-7
3
DennisDTInglesbyTVHendersonDABartlettJGAscherMSEitzenEet al. Tularemia as a biological weapon: medical and public health management. JAMA. (2001) 285:2763–73. doi: 10.1001/jama.285.21.2763
4
BoissetSCasparYSuteraVMaurinM. New therapeutic approaches for treatment of tularaemia: a review. Front Cell Infect Microbiol. (2014) 4:40. doi: 10.3389/fcimb.2014.00040
5
BinaXRWangCMillerMABinaJE. The Bla2 β-lactamase from the live-vaccine strain of Francisella tularensis encodes a functional protein that is only active against penicillin-class β-lactam antibiotics. Arch Microbiol. (2006) 186:219–28. doi: 10.1007/s00203-006-0140-6
6
BeleteTM. Novel targets to develop new antibacterial agents and novel alternatives to antibacterial agents. Hum Microbiome J. (2019) 11:100052. doi: 10.1016/j.humic.2019.01.001
7
WawszczakMBanaszczakBRastawickiW. Tularaemia - a diagnostic challenge. Ann Agric Environ Med. (2022) 29:12–21. doi: 10.26444/aaem/139242
8
RobertsLMPowellDAFrelingerJA. Adaptive immunity to Francisella tularensis and considerations for vaccine development. Front Cell Infect Microbiol. (2018) 8:115. doi: 10.3389/fcimb.2018.00115
9
RappuoliRBottomleyMJD'OroUFincoODe GregorioE. Reverse vaccinology 2.0: Human immunology instructs vaccine antigen design. J Exp Med. (2016) 213:469–81. doi: 10.1084/jem.20151960
10
DeyJMahapatraSRRajTKKaurTJainPTiwariAet al. Designing a novel multi-epitope vaccine to evoke a robust immune response against pathogenic multidrug-resistant Enterococcus faecium bacterium. Gut Pathog. (2022) 14:21. doi: 10.1186/s13099-022-00495-z
11
De BritoRCFCardosoJMOReisLESVieiraJFMathiasFASRoattBMet al. Peptide vaccines for Leishmaniasis. Front Immunol. (2018) 9:1043. doi: 10.3389/fimmu.2018.01043
12
SharmaRRajputVSJamalSGroverAGroverS. An immunoinformatics approach to design a multi-epitope vaccine against Mycobacterium tuberculosis exploiting secreted exosome proteins. Sci Rep. (2021) 11:13836. doi: 10.1038/s41598-021-93266-w
13
D'MelloAAhearnCPMurphyTFTettelinH. ReVac: a reverse vaccinology computational pipeline for prioritization of prokaryotic protein vaccine candidates. BMC Genomics. (2019) 20:981. doi: 10.1186/s12864-019-6195-y
14
SheyRAGhogomuSMEsohKKNebangwaNDShintouoCMNongleyNFet al. In-silico design of a multi-epitope vaccine candidate against onchocerciasis and related filarial diseases. Sci Rep. (2019) 9:4409. doi: 10.1038/s41598-019-40833-x
15
DeyJMahapatraSRSinghPKPrabhuswamimathSCMisraNSuarM. Designing of multi-epitope peptide vaccine against Acinetobacter baumannii through combined immunoinformatics and protein interaction-based approaches. Immunol Res. (2023) 71:639–62. doi: 10.1007/s12026-023-09374-4
16
KanampalliwarAM. Reverse vaccinology and its applications. Methods Mol Biol. (2020) 2131:1–16. doi: 10.1007/978-1-0716-0389-5_1
17
JalalKAbu-IzneidTKhanKAbbasMHayatABawazeerSet al. Identification of vaccine and drug targets in Shigella dysenteriae sd197 using reverse vaccinology approach. Sci Rep. (2022) 12:251. doi: 10.1038/s41598-021-03988-0
18
KhanKJalalKUddinR. An integrated in silico based subtractive genomics and reverse vaccinology approach for the identification of novel vaccine candidate and chimeric vaccine against XDR Salmonella typhi H58. Genomics. (2022) 114:110301. doi: 10.1016/j.ygeno.2022.110301
19
NosratiMBehbahaniMMohabatkarH. Towards the first multi-epitope recombinant vaccine against Crimean-Congo hemorrhagic fever virus: A computer-aided vaccine design approach. J BioMed Inform. (2019) 93:103160. doi: 10.1016/j.jbi.2019.103160
20
SrivastavaSKamthaniaMKumar PandeyRKumar SaxenaASaxenaVKumar SinghSet al. Design of novel multi-epitope vaccines against severe acute respiratory syndrome validated through multistage molecular interaction and dynamics. J Biomol Struct Dyn. (2019) 37:4345–60. doi: 10.1080/07391102.2018.1548977
21
TostaSFOPassosMSKatoRSalgadoÁXavierJJaiswalAKet al. Multi-epitope based vaccine against yellow fever virus applying immunoinformatics approaches. J Biomol Struct Dyn. (2021) 39:219–35. doi: 10.1080/07391102.2019.1707120
22
NguyenTLKimH. Discovering peptides and computational investigations of a multiepitope vaccine target Mycobacterium tuberculosis. Synth Syst Biotechnol. (2024) 9:391–405. doi: 10.1016/j.synbio.2024.03.010
23
ChaudhariNMGuptaVKDuttaC. BPGA-an ultra-fast pan-genome analysis pipeline. Sci Rep. (2016) 6:24373. doi: 10.1038/srep24373
24
BachertBARichardsonJBMlynekKDKlimkoCPToothmanRGFettererDPet al. Development, phenotypic characterization and genomic analysis of a Francisella tularensis panel for tularemia vaccine testing. Front Microbiol. (2021) 12:725776. doi: 10.3389/fmicb.2021.725776
25
AshkenazyHErezEMartzEPupkoTBen-TalN. ConSurf 2010: calculating evolutionary conservation in sequence and structure of proteins and nucleic acids. Nucleic Acids Res. (2010) 38:W529–W33. doi: 10.1093/nar/gkq399
26
YuNYWagnerJRLairdMRMelliGReySLoRet al. PSORTb 3.0: improved protein subcellular localization prediction with refined localization subcategories and predictive capabilities for all prokaryotes. Bioinformatics. (2010) 26:1608–15. doi: 10.1093/bioinformatics/btq249
27
YuCSLinCJHwangJK. Predicting subcellular localization of proteins for Gram-negative bacteria by support vector machines based on n-peptide compositions. Protein Sci. (2004) 13:1402–6. doi: 10.1110/ps.03479604
28
DoytchinovaIAFlowerDR. VaxiJen: a server for prediction of protective antigens, tumour antigens and subunit vaccines. BMC Bioinf. (2007) 8:4. doi: 10.1186/1471-2105-8-4
29
SharmaNPatiyalSDhallAPandeAAroraCRaghavaGP. AlgPred 2.0: an improved method for predicting allergenic proteins and mapping of IgE epitopes. Briefings Bioinf. (2021) 22:bbaa294. doi: 10.1093/bib/bbaa294
30
DimitrovIFlowerDRDoytchinovaI eds. AllerTOP-a server for in silico prediction of allergens. In: BMC bioinformatics. BioMed Central. doi: 10.1186/1471-2105-14-s6-s4
31
KumarSStecherGLiMKnyazCTamuraK. MEGA X: molecular evolutionary genetics analysis across computing platforms. Mol Biol evolution. (2018) 35:1547. doi: 10.1093/molbev/msy096
32
YarivBYarivEKesselAMasratiGChorinABMartzEet al. Using evolutionary data to make sense of macromolecules with a "face-lifted" ConSurf. Protein Sci. (2023) 32:e4582. doi: 10.1002/pro.v32.3
33
SahaSRaghavaGP. VICMpred: an SVM-based method for the prediction of functional proteins of Gram-negative bacteria using amino acid patterns and composition. Genomics Proteomics Bioinf. (2006) 4:42–7. doi: 10.1016/S1672-0229(06)60015-6
34
PaulSSidneyJSetteAPetersB. TepiTool: A pipeline for computational prediction of T cell epitope candidates. Curr Protoc Immunol. (2016) 114:18.9.1–.9.24. doi: 10.1002/0471142735.2016.114.issue-1
35
GhashghaieAAlimoghaddamKOstadaliMRKhansariLSadraeeMMirrasekhianEet al. Allele frequencies of HLA class-I loci in the normal Iranian population. Int J hematology-oncology Stem Cell Res. (2009) 3(3):18–20.
36
Marchler-BauerADerbyshireMKGonzalesNRLuSChitsazFGeerLYet al. CDD: NCBI's conserved domain database. Nucleic Acids Res. (2015) 43:D222–6. doi: 10.1093/nar/gku1221
37
Huerta-CepasJSzklarczykDHellerDHernández-PlazaAForslundSKCookHet al. eggNOG 5.0: a hierarchical, functionally and phylogenetically annotated orthology resource based on 5090 organisms and 2502 viruses. Nucleic Acids Res. (2019) 47:D309–d14. doi: 10.1093/nar/gky1085
38
ForoutanMGhaffarifarFSharifiZDalimiA. Vaccination with a novel multi-epitope ROP8 DNA vaccine against acute Toxoplasma gondii infection induces strong B and T cell responses in mice. Comp Immunol Microbiol Infect Dis. 69:101413. doi: 10.1016/j.cimid.2020.101413
39
SchwedeTKoppJGuexNPeitschMC. SWISS-MODEL: an automated protein homology-modeling server. Nucleic Acids Res. (2003) 31:3381–5. doi: 10.1093/nar/gkg520
40
PrajapatRMarwalAGaurR. Recognition of errors in the refinement and validation of three-dimensional structures of AC1 proteins of begomovirus strains by using ProSA-Web. J Viruses. (2014) 2014:752656. doi: 10.1155/2014/752656
41
DymOEisenbergDYeatesTO. Detection of errors in protein models. International Tables for Crystallography. (2012) 677–83. doi: 10.1107/97809553602060000881
42
PonomarenkoJBuiH-HLiWFussederNBournePESetteAet al. ElliPro: a new structure-based tool for the prediction of antibody epitopes. BMC Bioinf. (2008) 9:1–8. doi: 10.1186/1471-2105-9-514
43
SzklarczykDGableALLyonDJungeAWyderSHuerta-CepasJet al. STRING v11: protein–protein association networks with increased coverage, supporting functional discovery in genome-wide experimental datasets. Nucleic Acids Res. (2019) 47:D607–D13. doi: 10.1093/nar/gky1131
44
KushwahaSKShakyaM. Protein interaction network analysis—approach for potential drug target identification in Mycobacterium tuberculosis. J Theor Biol. (2010) 262:284–94. doi: 10.1016/j.jtbi.2009.09.029
45
SrivastavaSKamthaniaMSinghSSaxenaAKSharmaN. Structural basis of development of multi-epitope vaccine against Middle East respiratory syndrome using in silico approach. Infection Drug resistance. (2018) 11:2377–91. doi: 10.2147/IDR.S175114
46
DarHAWaheedYNajmiMHIsmailSHettaHFAliAet al. Multiepitope subunit vaccine design against COVID-19 based on the spike protein of SARS-CoV-2: an in silico analysis. J Immunol Res. (2020) 2020:8893483. doi: 10.1155/2020/8893483
47
SabourinMTuzonCTFisherTSZakianVA. A flexible protein linker improves the function of epitope-tagged proteins in Saccharomyces cerevisiae. Yeast. (2007) 24:39–45. doi: 10.1002/yea.v24:1
48
YanYTaoHHeJHuangS-Y. The HDOCK server for integrated protein–protein docking. Nat Protoc. (2020) 15:1829–52. doi: 10.1038/s41596-020-0312-x
49
LaskowskiRA. PDBsum: summaries and analyses of PDB structures. Nucleic Acids Res. (2001) 29:221–2. doi: 10.1093/nar/29.1.221
50
HebditchMCarballo-AmadorMACharonisSCurtisRWarwickerJ. Protein-Sol: a web tool for predicting protein solubility from sequence. Bioinformatics. (2017) 33:3098–100. doi: 10.1093/bioinformatics/btx345
51
WilkinsMRGasteigerEBairochASanchezJCWilliamsKLAppelRDet al. Protein identification and analysis tools in the ExPASy server. Methods Mol Biol. (1999) 112:531–52. doi: 10.1385/1-59259-584-7:531
52
GouldNHendyOPapamichailD. Computational tools and algorithms for designing customized synthetic genes. Front bioengineering Biotechnol. (2014) 2:41. doi: 10.3389/fbioe.2014.00041
53
RapinNLundOBernaschiMCastiglioneF. Computational immunology meets bioinformatics: the use of prediction tools for molecular binding in the simulation of the immune system. PLoS One. (2010) 5:e9862. doi: 10.1371/journal.pone.0009862
54
AlbekairiTHAlshammariAAlharbiMAlshammaryAFTahir Ul QamarMAnwarTet al. Design of a Multi-Epitope Vaccine against Tropheryma whipplei Using Immunoinformatics and Molecular Dynamics Simulation Techniques. Vaccines. (2022) 10. doi: 10.3390/vaccines10050691
55
BrandonMCRuiz-PesiniEMishmarDProcaccioVLottMTNguyenKCet al. MITOMASTER: a bioinformatics tool for the analysis of mitochondrial DNA sequences. Hum Mutat. (2009) 30:1–6. doi: 10.1002/humu.20801
56
DamteDSuhJ-WLeeS-JYohannesSBHossainMAParkS-C. Putative drug and vaccine target protein identification using comparative genomic analysis of KEGG annotated metabolic pathways of Mycoplasma hyopneumoniae. Genomics. (2013) 102:47–56. doi: 10.1016/j.ygeno.2013.04.011
57
KanehisaMGotoS. KEGG: kyoto encyclopedia of genes and genomes. Nucleic Acids Res. (2000) 28:27–30. doi: 10.1093/nar/28.1.27
58
WishartDSFeunangYDGuoACLoEJMarcuAGrantJRet al. DrugBank 5.0: a major update to the DrugBank database for 2018. Nucleic Acids Res. (2018) 46:D1074–D82.
59
TurnbaughPJLeyREHamadyMFraser-LiggettCMKnightRGordonJI. The human microbiome project. Nature. (2007) 449:804–10. doi: 10.1038/nature06244
60
ZhangROuHYZhangCT. DEG: a database of essential genes. Nucleic Acids Res. (2004) 32:D271–D2. doi: 10.1093/nar/gkh024
61
JudsonNMekalanosJJ. TnAraOut, a transposon-based approach to identify and characterize essential bacterial genes. Nat Biotechnol. (2000) 18:740–5. doi: 10.1038/77305
62
ConlanJWShenHWebbAPerryMB. Mice vaccinated with the O-antigen of Francisella tularensis LVS lipopolysaccharide conjugated to bovine serum albumin develop varying degrees of protective immunity against systemic or aerosol challenge with virulent type A and type B strains of the pathogen. Vaccine. (2002) 20:3465–71. doi: 10.1016/S0264-410X(02)00345-6
63
ApicellaMAPostDMFowlerACJonesBDRasmussenJAHuntJRet al. Identification, characterization and immunogenicity of an O-antigen capsular polysaccharide of Francisella tularensis. PloS One. (2010) 5:e11060. doi: 10.1371/journal.pone.0011060
64
HickeyAJHazlettKRKirimanjeswaraGSMetzgerDW. Identification of Francisella tularensis outer membrane protein A (FopA) as a protective antigen for tularemia. Vaccine. (2011) 29:6941–7. doi: 10.1016/j.vaccine.2011.07.075
65
KaurRChenSArévaloMTXuQChenYZengM. Protective immunity against tularemia provided by an adenovirus-vectored vaccine expressing Tul4 of Francisella tularensis. Clin Vaccine Immunol. (2012) 19:359–64. doi: 10.1128/CVI.05384-11
66
HuntleyJFConleyPGRaskoDAHagmanKEApicellaMANorgardMV. Native outer membrane proteins protect mice against pulmonary challenge with virulent type A Francisella tularensis. Infect Immun. (2008) 76:3664–71. doi: 10.1128/IAI.00374-08
67
AshtekarARKatzJXuQMichalekSM. A mucosal subunit vaccine protects against lethal respiratory infection with Francisella tularensis LVS. PLoS One. (2012) 7:e50460. doi: 10.1371/journal.pone.0050460
68
RichardKMannBJStockerLBarryEMQinAColeLEet al. Novel catanionic surfactant vesicle vaccines protect against Francisella tularensis LVS and confer significant partial protection against F. tularensis Schu S4 strain. Clin Vaccine Immunol. (2014) 21:212–26. doi: 10.1128/CVI.00738-13
69
BanikSMansourAASureshRVWykoff-ClarySMalikMMcCormickAAet al. Development of a multivalent subunit vaccine against tularemia using tobacco mosaic virus (TMV) based delivery system. PLoS One. (2015) 10:e0130858. doi: 10.1371/journal.pone.0130858
70
GrandiG. Bacterial surface proteins and vaccines. F1000 Biol Rep. (2010) 2. doi: 10.3410/B2-36
71
SutherlandMDGoodyearAWTroyerRMChandlerJCDowSWBelisleJT. Post-exposure immunization against Francisella tularensis membrane proteins augments protective efficacy of gentamicin in a mouse model of pneumonic tularemia. Vaccine. (2012) 30:4977–82. doi: 10.1016/j.vaccine.2012.05.037
72
IrelandROlivares-ZavaletaNWarawaJMGherardiniFCJarrettCHinnebuschBJet al. Effective, broad spectrum control of virulent bacterial infections using cationic DNA liposome complexes combined with bacterial antigens. PLoS Pathog. (2010) 6:e1000921. doi: 10.1371/journal.ppat.1000921
73
ChandlerJCSutherlandMDHartonMRMolinsCRAndersonRVHeaslipDGet al. Francisella tularensis LVS surface and membrane proteins as targets of effective post-exposure immunization for tularemia. J Proteome Res. (2015) 14:664–75. doi: 10.1021/pr500628k
74
SetteARappuoliR. Reverse vaccinology: developing vaccines in the era of genomics. Immunity. (2010) 33:530–41. doi: 10.1016/j.immuni.2010.09.017
75
BahadoriZShafaghiMMadanchiHRanjbarMMShabaniAAMousaviSF. In silico designing of a novel epitope-based candidate vaccine against Streptococcus pneumoniae with introduction of a new domain of PepO as adjuvant. J Transl Med. (2022) 20:389. doi: 10.1186/s12967-022-03590-6
76
MediniDStellaMWassilJ. MATS: Global coverage estimates for 4CMenB, a novel multicomponent meningococcal B vaccine. Vaccine. (2015) 33:2629–36. doi: 10.1016/j.vaccine.2015.04.015
77
SerrutoDBottomleyMJRamSGiulianiMMRappuoliR. The new multicomponent vaccine against meningococcal serogroup B, 4CMenB: immunological, functional and structural characterization of the antigens. Vaccine. (2012) 30 Suppl 2:B87–97. doi: 10.1016/j.vaccine.2012.01.033
78
GoumariMMFarhaniINezafatNMahmoodiS. Multi-epitope vaccines (MEVs), as a novel strategy against infectious diseases. Curr Proteomics. (2020) 17:354–64. doi: 10.2174/1570164617666190919120140
79
DeyJMahapatraSRLataSPatroSMisraNSuarM. Exploring Klebsiella pneumoniae capsule polysaccharide proteins to design multiepitope subunit vaccine to fight against pneumonia. Expert Rev Vaccines. (2022) 21:569–87. doi: 10.1080/14760584.2022.2021882
80
ColeLELairdMHSeekatzASantiagoAJiangZBarryEet al. Phagosomal retention of Francisella tularensis results in TIRAP/Mal-independent TLR2 signaling. J Leukoc Biol. (2010) 87:275–81. doi: 10.1189/jlb.0909619
81
MetzgerDWSalmonSLKirimanjeswaraG. Differing effects of interleukin-10 on cutaneous and pulmonary Francisella tularensis live vaccine strain infection. Infect Immun. (2013) 81:2022–7. doi: 10.1128/IAI.00024-13
82
StenmarkSSunnemarkDBuchtASjöstedtA. Rapid local expression of interleukin-12, tumor necrosis factor alpha, and gamma interferon after cutaneous Francisella tularensis infection in tularemia-immune mice. Infect Immun. (1999) 67:1789–97. doi: 10.1128/IAI.67.4.1789-1797.1999
83
LindgrenHEneslättKGolovliovIGelhausCSjöstedtA. Analyses of human immune responses to Francisella tularensis identify correlates of protection. Front Immunol. (2023) 14:1238391. doi: 10.3389/fimmu.2023.1238391
84
KubelkovaKMacelaA. Francisella and antibodies. Microorganisms. (2021) 9. doi: 10.3390/microorganisms9102136
85
SansomDMManzottiCNZhengY. What's the difference between CD80 and CD86? Trends Immunol. (2003) 24:314–9.
86
SwainSKPandaSSahuBPMahapatraSRDeyJSarangiRet al. Inferring B-cell derived T-cell receptor induced multi-epitope-based vaccine candidate against enterovirus 71: a reverse vaccinology approach. Clin Exp Vaccine Res. (2024) 13:132–45. doi: 10.7774/cevr.2024.13.2.132
87
KhanAAliSSKhanAZahidMAAlshabrmiFMWaheedYet al. Structural proteomics guided annotation of vaccine targets and designing of multi-epitopes vaccine to instigate adaptive immune response against Francisella tularensis. Microb Pathog. (2024), 106777. doi: 10.1016/j.micpath.2024.106777
88
MoradkasaniSMaurinMFarrokhiASEsmaeiliS. Development, strategies, and challenges for Tularemia vaccine. Curr Microbiol. (2024) 81:126. doi: 10.1007/s00284-024-03658-0
89
McLendonMKApicellaMAAllenLA. Francisella tularensis: taxonomy, genetics, and Immunopathogenesis of a potential agent of biowarfare. Annu Rev Microbiol. (2006) 60:167–85. doi: 10.1146/annurev.micro.60.080805.142126
90
HuaYHWuCYSargsyanKLimC. Sequence-motif detection of NAD(P)-binding proteins: discovery of a unique antibacterial drug target. Sci Rep. (2014) 4:6471. doi: 10.1038/srep06471
91
ObertoJBonnefoyEMourayEPellegriniOWikströmPMRouvière-YanivJ. The Escherichia coli ribosomal protein S16 is an endonuclease. Mol Microbiol. (1996) 19:1319–30. doi: 10.1111/j.1365-2958.1996.tb02476.x
92
ZhangLHeJBaiLRuanSYangTLuoY. Ribosome-targeting antibacterial agents: Advances, challenges, and opportunities. Medicinal Res Rev. (2021) 41:1855–89. doi: 10.1002/med.21780
93
GiuliodoriAMSpurioRMilónPFabbrettiA. Antibiotics targeting the 30S ribosomal subunit: a lesson from nature to find and develop new drugs. Curr Topics Medicinal Chem. (2018) 18:2080–96. doi: 10.2174/1568026618666181025092546
94
AktasMGleichenhagenJStollRNarberhausF. S-adenosylmethionine-binding properties of a bacterial phospholipid N-methyltransferase. J Bacteriol. (2011) 193:3473–81. doi: 10.1128/JB.01539-10
95
AllenKNDunaway-MarianoD. Markers of fitness in a successful enzyme superfamily. Curr Opin Struct Biol. (2009) 19:658–65. doi: 10.1016/j.sbi.2009.09.008
96
Bernardo-SeisdedosGGilDBlouinJ-MRichardEMilletO. Chapter 18 - Natural and pharmacological chaperones against accelerated protein degradation: uroporphyrinogen III synthase and congenital erythropoietic porphyria. In: PeyAL, editor. Protein Homeostasis Diseases. Academic Press (2020). p. 389–413.
Summary
Keywords
Francisella tularensis, tularemia, multi-epitope vaccine, reverse vaccinology, drug target
Citation
Moradkasani S, Esmaeili S, Asadi Karam MR, Mostafavi E, Shahbazi B, Salek Farrokhi A, Chiani M and Badmasti F (2025) Development of a multi-epitope vaccine from outer membrane proteins and identification of novel drug targets against Francisella tularensis: an In Silico approach. Front. Immunol. 16:1479862. doi: 10.3389/fimmu.2025.1479862
Received
12 August 2024
Accepted
17 March 2025
Published
03 April 2025
Volume
16 - 2025
Edited by
Deepak Kumar, University of Southern Mississippi, United States
Reviewed by
Zhuo Ma, Albany College of Pharmacy and Health Sciences, United States
Jyotirmayee Dey, KIIT University, India
Updates
Copyright
© 2025 Moradkasani, Esmaeili, Asadi Karam, Mostafavi, Shahbazi, Salek Farrokhi, Chiani and Badmasti.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Farzad Badmasti, fbadmasti2008@gmail.com
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.