REVIEW article

Front. Microbiol., 03 December 2019

Sec. Infectious Agents and Disease

Volume 10 - 2019 | https://doi.org/10.3389/fmicb.2019.02712

Plasmodium falciparum Blood Stage Antimalarial Vaccines: An Analysis of Ongoing Clinical Trials and New Perspectives Related to Synthetic Vaccines

  • 1. Fundación Instituto de Inmunología de Colombia, Bogotá, Colombia

  • 2. Ph.D. Programme in Biomedical and Biological Sciences, Universidad del Rosario, Bogotá, Colombia

  • 3. Medicine Programme, Health Sciences Faculty, Universidad de Boyacá, Tunja, Colombia

  • 4. Basic Sciences Department, School of Medicine and Health Sciences, Universidad del Rosario, Bogotá, Colombia

  • 5. Department of Pathology, School of Medicine, Universidad Nacional de Colombia, Boyacá, Colombia

Abstract

Plasmodium falciparum malaria is a disease causing high morbidity and mortality rates worldwide, mainly in sub-Saharan Africa. Candidates have been identified for vaccines targeting the parasite’s blood stage; this stage is important in the development of symptoms and clinical complications. However, no vaccine that can directly affect morbidity and mortality rates is currently available. This review analyzes the formulation, methodological design, and results of active clinical trials for merozoite-stage vaccines, regarding their safety profile, immunological response (phase Ia/Ib), and protective efficacy levels (phase II). Most vaccine candidates are in phase I trials and have had an acceptable safety profile. GMZ2 has made the greatest progress in clinical trials; its efficacy has been 14% in children aged less than 5 years in a phase IIb trial. Most of the available candidates that have shown strong immunogenicity and that have been tested for their protective efficacy have provided good results when challenged with a homologous parasite strain; however, their efficacy has dropped when they have been exposed to a heterologous strain. In view of these vaccines’ unpromising results, an alternative approach for selecting new candidates is needed; such line of work should be focused on how to increase an immune response induced against the highly conserved (i.e., common to all strains), functionally relevant, protein regions that the parasite uses to invade target cells. Despite binding regions tending to be conserved, they are usually poorly antigenic and/or immunogenic, being frequently discarded as vaccine candidates when the conventional immunological approach is followed. The Fundación Instituto de Inmunología de Colombia (FIDIC) has developed a logical and rational methodology based on including conserved high-activity binding peptides (cHABPs) from the main P. falciparum biologically functional proteins involved in red blood cell (RBC) invasion. Once appropriately modified (mHABPs), these minimal, subunit-based, chemically synthesized peptides can be used in a system covering the human immune system’s main genetic variables (the human leukocyte antigen HLA-DR isotype) inducing a suitable, immunogenic, and protective immune response in most of the world’s populations.

Introduction

Plasmodium falciparum malaria continues being one of the main diseases having a great impact on public health worldwide. It has been estimated that 219 million clinical cases and more than 435,000 malaria-related deaths occurred worldwide in 2017, most of them (90%) in sub-Saharan Africa (WHO, 2018). In spite of many efforts at early diagnosis, timely treatment, and attempts at producing antimalarial vaccines, a completely effective strategy for controlling malaria has not yet been achieved.

There are several ongoing approaches to developing vaccines targeting the different stages of the P. falciparum parasite’s life cycle (Figure 1A), including the asexual phase in human hepatic and erythrocyte cells and the sexual phase in the female Anopheles mosquito (; ).

FIGURE 1

Understanding the intra-erythrocyte cycle which includes red blood cell (RBC) invasion arouses major interest since the clinical symptoms of malaria are manifest during this stage, characterized by very high fever, headache, nausea, vomiting, and general malaise (; Tahita et al., 2013). Multiple hematological complications also occur, such as anemia, hemolysis, and hemagglutination, during the parasite’s cyclic invasion, growth, and reproduction (Ord et al., 2015), which can lead to renal and cerebral damage, vasculitis, and patients’ rapid death.

Erythrocyte invasion (Figure 1B) begins when merozoites (Mrz) roll on the RBC surface via receptor–ligand low-affinity interactions, mainly carried out by some of the 12-Mrz surface protein (MSP) family (Rodríguez et al., 2005) (MSP1 to MSP12), inducing weak erythrocyte membrane deformation (Weiss et al., 2015). The Mrz then become reorientated, inducing strong calcium (Ca++)-mediated, actin-dependent RBC deformation via the erythrocyte binding antigen (EBA-175, EBA-140, and EBA-181) and erythrocyte binding ligand (EBL) and reticulocyte binding homolog (Rh1, Rh2a/Rh2b, and Rh4) families. The latter acts as an alternative pathway to EBA, depending on the presence or absence of RBC membrane receptor molecules to bring their apical poles into direct contact with the host cell membrane. This induces tight junction (TJ) formation between RBC proteins and Mrz receptor molecules immediately after the Rh5–basigin interaction has induced the rhoptries to release microneme proteins, leading to rhoptry neck (RON-2) () and apical membrane antigen-1 (AMA-1) complex formation interacting with a yet-unknown receptor (Weiss et al., 2015) (Figure 1C).

Mrz invasion continues via the interaction of rhoptry proteins, dense granules, and RBC membrane lipids participating in the formation of the parasitophorous vacuole membrane (PVM). This enables parasite multiplication (32–50 per cycle/48–72 h) through the sequential formation of ring, trophozoite, and schizont stages (, ) (Figure 1C).

A vaccine targeting the erythrocyte stage capable of interrupting P. falciparum’s asexual cycle could reduce parasitemia and morbidity by blocking invasion and the production of harmful by-products during parasite growth, which induces clinical symptomatology (; Patarroyo et al., 2017a; ). Several blood-stage antigens have thus been identified as potential vaccine candidates; this led to FIDIC developing the first minimum subunit-based synthetic multi-epitope, multistage vaccine 30 years ago: synthetic P. falciparum vaccine 66 (SPf66). That vaccine contained three Mrz-derived protein fragments [MSP1, SERA, and an amino acid (aa) sequence from a then-undefined molecule] and the Spz CSP1-derived asparagine–alanine–asparagine–proline (NANP) sequence, interspersed twice. It had ∼45% protective efficacy in the Aotus monkey experimental model and induced 40% full protection in a controlled human malaria infection (CHMI) trial and in large phase III field trials involving a population aged over 1 year in Colombia, Venezuela, Ecuador, and Brazil (∼50,000 people vaccinated) (Patarroyo, 1987, 1988; Valero et al., 1993). An SPf66 vaccine produced in the United States by another group, having a different degree of polymerization, induced limited protection which was not statistically significant in a field trial in Thailand (Nosten et al., 1996). These results clearly suggested that SPf66 vaccine’s protective efficacy was genetically (later confirmed by HLA-DR phenotyping) and transmission intensity dependent and SPf66 vaccination was thus stopped to continue with the search for more epitopes that could form part of a fully protective vaccine.

The WHO’s latest update (WHO, 2017) states that many vaccines (>100) have been tested on humans since SPf66. Only the following 10 recombinant or viral vaccine candidates are currently in clinical studies: EBA region II-non-glycosylated (EBA-175 RII NG), apical membrane antigen 1 diversity covering (AMA-1 DiCo), Mrz surface protein-3 (MSP3) long synthetic peptide (LSP), serine repeat antigen-5 formulated with aluminum hydroxyl gel (BK-SE36), P. falciparum MSP3 and glutamate-rich protein (GLURP) (GMZ2) fusion protein, the chimpanzee adenovirus 63 (ChAd63) with modified vaccinia virus Ankara (MVA) encoding the reticulocyte binding homolog-5 (ChAd63/MVA RH5), two placental malaria vaccine candidates (PRIMVAC and PAMVAC), unstructured 104mer synthetic peptide (P27A), and pre-erythrocytic and blood-stage (PEBS) vaccines (Table 1).

TABLE 1

Vaccine formulationTrial characteristicsMain resultsReferences
Chemically synthesized vaccine
MSP3-LSP
Adjuvants: Montanide ISA 720 and aluminum hydroxide
Phase IaDoses evaluated: 10, 30, 100, and 300 μg of MSP3-LSP (days 0, 30, and 120)
Administration route: Subcutaneous
Participants: 36 (18–45 years old)
Year: 2003–2004
– formulation with Al(OH)3 was better tolerated
– cytophilic IgG1 subclass humoral response predominated
; Sirima et al., 2009
Phase IbDose: 30 μg of MSP3-LSP (days 0, 28, and 112)
Participants: Group 1: 30 (18–45 years old); Group 2: 55 (12–24 months old)
Year: 2007–2008
– vaccine was safe and well tolerated
– absence of immune humoral response in the vaccinated group
Chemically synthesized vaccine
P27A
Adjuvants: GLA-SE/alhydrogel
Phase IaDose: 10 and 50 μg of P27A (days 0, 28, and 56)
Administration route: Intramuscular
Participants: 16 adults
Year: 2014–2015
– high frequency of local and systemic adverse events (AE)Steiner-Monard et al., 2018
Phase IbDose: 10 and 50 μg of P27A (days 0, 28, and 56)
Administration route: Intramuscular
Participants: 40 adults
Year: 2014–2015
– > humoral immune response in individuals who had not been exposed to malaria
– low antibody dependent (ADCI) – anti-P27A cell inhibition capability (in vitro trials)
Recombinant vaccine
BK-SE36
Adjuvant: aluminum hydroxide
Expression system (ES):Escherichia coli
Phase IaDose evaluated: 50 and 100 μg of SE36 (days 0, 21, and 42)
Administration route: Subcutaneous
Participants: 40 adults
Year: 2008
– 100% seroconversion (29/29 participants) at the end of follow-up (day 63); Palacpac et al., 2013
Phase IbDose: 50 and 100 μg of SE36 (days 0 and 21)
Participants: Stage 1: 56 (21–40 years old)/Stage 2: 84 (6–20 months old)
Year: 2010–2011
– significant increase in Ab titers only in 6- to 10-year-old participants (5/71-fold)
Recombinant vaccine
AMA-1 DiCo
Adjuvants: aluminum hydroxide, GLA-SE
ES:Pichia pastoris
Phase IaDose evaluated: 50 μg of AMA-1 DiCo (days 0, 28, and 182)
Administration route: Intramuscular
Participants: 30 (20–25 years old)
Year: 2014–2015
– average IgG concentration: adjuvant GLA-SE (37.7–60.2 mg/ml)
– alhydrogel (19–22.9 mg/ml)
Sirima et al., 2017
Phase IbDose evaluated: 50 μg of AMA-1 DiCo (days 0, 28, and 182)
Participants: 36 (20–25 years old)
Year: 2014–2015
– significant increase in IgG (90–150 mg/ml) during week 30 in the GLA-SE group
Recombinant vaccine
PRIMVAC
Adjuvants: alhydrogel and GLA-SE
ES:E. coli
Phase Ia/IbDose evaluated: 20, 50, and 100 μg of PRIMVAC (days 0, 28, and 56)
Administration route: Intramuscular
Participants: 68 (18–35 years old)
Year: 2016–2018
– not published(; Sirima et al., 2016a)
Recombinant vaccine
PAMVAC
Adjuvants: alhydrogel and GLA-SE
ES:Drosophila melanogaster
Phase Ia/IbDose evaluated: 20, 50, and 100 μg of PRIMVAC (days 0, 28, and 56)
Administration route: Intramuscular
Participants: 66 (18–35 years old)
Year: 2016–2017
– not published()
Recombinant vaccine
PfPEBS
Adjuvants: aluminum hydroxide
ES:E. coli
Phase Ia/IbDose evaluated: 5 or 30 μg of PfPEBS (days 0 and 28)
Administration route: Subcutaneous
Participants: 36 (18–45 years old)
– not published
Recombinant vaccine
EBA-175 RII NG
Adjuvant: aluminum phosphate
ES:P. pastoris
Phase IaDose: 5, 20, 80, and 160 μg of EBA-175 (days 0, 42, and 194)
Administration route: Intramuscular
Participants: 80 adults
Year: 2008
– vaccine well tolerated
– > Ab titers following third immunization; however, becoming reduced at the end of follow-up
Phase IbDose: 5, 20, and 80 μg of EBA-175 (days 0, 42, and 194)
Administration route: Intramuscular
Participants: 60 adults
Year: 2010–2012
– inhibition of parasite growth in vitro: 25.0% in the placebo group and 12.0–20.0% in the vaccinated group
Recombinant vaccine
GMZ2
Adjuvant: alhydrogel
Expression system:Lactococcus lactis
Phase IaDose: 10, 30, or 100 μg of GMZ2 (days 0, 28, and 56)
Administration route: subcutaneous
Participants: 30 adults
Year: 2006–2007
– high frequency of local and systemic adverse reactions (grades 1 and 2)
Phase IbDose: 100 μg of GMZ2 (days 0, 28, and 56)
Participants: 40 adults (18–45 years old)
Year: 2007–2008
– greater amount of anti-GMZ2 Ab titers in the experimental group (>1.4-fold)
Phase IIbDose: 100 μg of GMZ2 (days 0, 28, and 56, 1-year follow-up)
Participants: 1,849 children (1 and 5 years old)
Year: 2010–2014
– efficacy: 14%; Sirima et al., 2016b
Recombinant adenovirus vaccine
ChAd63 RH5/MVA RH5
ES adenoviral: ChAd63 and MVA
Phase IaDose:
– ChAd63 RH5 [5 × 109 viral particles (vp) cf. 5 × 1010 vp]
– ChAd63 [5 × 1010 vp + MVA RH5 1 × 108 plaque-forming unit (pfu)]/(5 × 1010 vp + MVA RH5 2 × 108 pfu)
Participants: 24 non-exposed adults (19–49 years old)
Year: 2014–2015
– suitable safety profile
– inhibition of parasite growth in vitro (GIA): 36.0 and 50.6%
Payne et al., 2017

Current clinical trials for Plasmodium falciparum erythrocyte stage vaccine candidates.

This review covers the results of current clinical trials carried out with these vaccine candidates, analyzing the formulation, aa sequence, and 3D structure of some fragments of these proteins selected for developing vaccine candidates and their relationship with conserved high activity binding peptides (cHABPs) identified in our institution. A large amount of our cHABPs’ aa sequences (besides mediating RBC binding and invasion) have been found in vaccine candidate fragments as they are located in such proteins’ functionally strategic sites (i.e., nutrient and calcium ion transport and enzymatic activities). These cHABPs thus represent excellent targets for developing synthetic vaccines since they can block the binding of proteins involved in RBC invasion as well as some of their biological functions.

The methodological design of current clinical trials and analysis of their results are reviewed, discussing reported safety, immunogenicity, and efficacy data.

Clinical Studies Regarding Blood-Stage Malaria Vaccines

MSP3-LSP Vaccine

The P. falciparum MSP3, secreted and translocated to a parasite membrane, has ∼43-kDa molecular weight (). An LSP has been chemically synthesized from the 95-aa- long MSP3 fragment in its C-terminal extreme’s conserved region, including the (181RKTKEYAEKAKNAYEKAKNAYQKANQAVLKAKEASSYDYILGWEFGGGVPEHKKEENMLSHLYVSSKDKENISKENDDVLDEKEEEAEETEEEELE276) aa sequence (; Sirima et al., 2007).

MSP3-LSP vaccine candidate results have been published in phase Ia/Ib clinical trial (Sirima et al., 2007, 2009; Nebie et al., 2009). Phase Ia carried out in Switzerland involved 35 healthy volunteers; three subcutaneous injections of MSP3-LSP were administered in 10-, 30-, 100-, and 300-μg doses on days 0, 30, and 120. Montanide ISA 720 and aluminum hydroxide (AH) adjuvants were used, AH being better tolerated and having a lower reactogenicity rate. It did not lead to serious vaccine-related adverse events (AE) during the trial. Regarding immunogenicity results, 63% (22/35) of the volunteers had detectable antibody (Ab) levels against MSP3-LSP following the second dose and 77% (23/30) following the third dose (ranging from 200 to 3,200 μg/ml, average 1,600 μg/ml); however, these titers became dramatically reduced by the end of follow-up (month 12) ().

MSP3-LSP was considered safe in phase Ib trials in Burkina Faso involving thirty 18- to 45-year-old healthy volunteers who were vaccinated with three doses of 30 μg on days 0, 28, and 112; there was only one systemic AE (tachycardia) which became spontaneously resolved, with no significant laboratory alterations being observed. There was a total absence of humoral response in all subjects vaccinated with MSP3-LSP, which could have been associated with preexisting levels of humoral immunity due to previous exposure to P. falciparum. It was thus suggested that a clinical trial should be performed using small children who had not acquired immunity (Sirima et al., 2007).

A stepped-dose trial was subsequently carried out involving 45 children between 12 and 24 months old who were randomized for receiving a 15- or 30-μg dose of MSP3-LSP. The vaccine was well tolerated regarding both doses, and no severe AE were observed. There was greater IgG1 and IgG3 subclass cytophilic Ab production, having a better response in participants vaccinated with the 30-μg dose. MSP3-LSP was considered to induce a suitable humoral immune response in less than 2-year-old children and was safe; it was decided that it should be evaluated in biological in vivo trials involving a wider population and including malaria challenge trials (Sirima et al., 2009). Phase II trial results remain unknown, as no reproducible and/or positive results have been obtained regarding the study population.

P27A Vaccine

P27A is an unstructured 104mer synthetic peptide from the P. falciparum TEX1 blood-stage protein. Developing this vaccine involved making bioinformatic predictions for protein structures including α-helix coil-type motifs; they were based on the hypothesis that the best vaccine candidates have this type of secondary structure and that they can imitate native P. falciparum epitopes in an aqueous environment, thereby facilitating immune system recognition (). Such analysis led to identifying the trophozoite export protein (Tex1) encoded by the PFF0165c gene which was chemically synthesized in short peptides, the P27 α-helix region (845K–871T), and the P27A intrinsically unstructured N-terminal region (223H–326S) (Figure 2B) which is characterized by having few hydrophobic aa and high hydrophilic content (Villard et al., 2007).

FIGURE 2

). (E) PAMVAC and PRIMVAC vaccines. Top: Protein scheme, CIDRα1 (cysteine-rich inter-domain regions α1), C2 (C2 domain), and Duffy binding-like (DBL) domain. Bottom: Protein structure, including the NTS region (blue), whole protein (green), and cHABPs 6510 (purple) and 6512 (orange). PDB 2XU0.

In vitro analysis of the Tex1 protein indicated that it had low polymorphism and was exported by the PVM (). Preclinical studies demonstrated that polypeptide P27A produced high immunogenicity when formulated with different adjuvants; it was well recognized in mouse and rabbit animal models (Remarque et al., 2008a), thereby agreeing with the results from in vitro analysis of sera and peripheral blood from semi-immune adults naturally exposed to malaria (Olugbile et al., 2009).

A phase Ia/Ib clinical study was sequentially carried out on 16 Swiss and 40 Tanzanian volunteers who were given three doses of 10 and 50 μg of P27A on days 0, 28, and 56, with glucopyranosyl lipid adjuvant-stable emulsion (GLA-SE) and alhydrogel adjuvants. The vaccine’s safety and tolerability were evaluated during an 8-month follow-up; slight and moderated AE were reported in 100% of the volunteers involved in phase Ia and in 82.5% of those in phase Ib, having a higher reactogenicity rate with the GLA-SE adjuvant (Steiner-Monard et al., 2018).

The highest humoral immune response was observed in the Swiss volunteers, especially following the third dose immunized with 50 μg of candidate vaccine formulated in GLA-SE, giving a median of 51,200 Ab titers (day 84); however, the titers decreased 26 weeks after the last immunization (9,600 median titer). Even though the anti-P27A Ab induced in the formulation with both adjuvants had less than 25% recognition of Tex, cell inhibition was only 10% in both cases. Nevertheless, the researchers explained that the Tanzanian volunteers’ reduced immune response was related to other types of infection, genetic factors (HLA) or previous exposure to malaria and stated that a higher dose of adjuvant was required for carrying out a new clinical trial (Steiner-Monard et al., 2018).

BK-SE36 Vaccine

Plasmodium falciparum serine repeat antigen 5 (SERA-5) is an abundant protein during the asexual blood stage (), having limited antigenic polymorphism (Palacpac et al., 2011). It is stored in the parasitophorous vacuole (PV) and released in soluble form for mediating schizont, Mrz, and gamete rupture and release. It is cleaved into three fragments: a 47-kDa N-terminal domain, a 50∗kDa central domain and an 18 kDa C terminal, from which a 6-kDa fragment is derived ().

In vitro trials have shown that mouse Ab against the 47-kDa N-terminal domain (SE47′) inhibited parasite intra-erythrocyte proliferation (i.e., considered a strategic region for vaccine development (). However, its hydrophobic nature hampers its purification, leading to a recombinant molecule called SE36 being designed as vaccine candidate from a synthetic gene encoding P. falciparum aa residues 17–382 (Honduras-1 strain) (; ). SE36 was expressed in Escherichia coli and formulated with AH gel (AHG) (Tougan et al., 2018).

Clinical phases Ia and Ib follow-up results have been published (Palacpac et al., 2013; ; Yagi et al., 2016) The first evaluated the vaccine’s safety and immunogenicity in 40 healthy, malaria-naive, Japanese male adults when administered by subcutaneous route in three doses on days 0, 21, and 42, at two different concentrations (50 and 100 μg of BK-SE36). Follow-up lasted 63 days, giving a good safety profile, high Ab response, and 100% seroconversion rate following the second dose, thereby enabling advancing to new clinical trial phases ().

Phase Ib was developed in two stages in Uganda; the first involved healthy 21- to 40-year-old adults (n = 56) who were serologically negative or positive to anti-SE36 Ab. The second stage included healthy children and young adults (n = 84) in three age cohorts (16–20, 11–15, and 6–10 years). The most frequently occurring AE was induration (92% of participants in stage 1 and 63% in stage 2); there were no serious AE, meaning that the vaccine was considered safe. Regarding immunogenicity results, the change in Ab titers was only significant for 6- to 10-year-old participants (5.71-fold increase from baseline) vaccinated with 1.0 (100 μg) BK-SE36. The immunogenicity response with 0.5 (50 μg) BK-SE36 was low and not statistically significant (1.55-fold increase). It was concluded that the absence of a robust humoral immune response seemed to be common in malaria-endemic areas due to previous exposure to natural P. falciparum infection.

Complementary analysis with this study population demonstrated 21% (7/33 participants) malarial incidence in the group vaccinated with 1.0 BK-SE36, 30% (10/33) in the 0.5 BK-SE36 group, and 45% in a placebo group, following 1 year’s follow-up (Palacpac et al., 2013).

Based on these results, the relationship between human leukocyte antigen (HLA-DRβ1) allele polymorphism and host genetic factors was studied regarding developing an effective immune response to vaccination. Although previous research has demonstrated that HLA-DRβ1 influenced an immunogenic response against malaria [i.e., SPf66 () and in the AMA-1 and rhoptry-associated protein (RAP2) vaccine candidates], this study determined that DRβ1 alleles did not influence Ab response to BK-SE36 or vaccinated subjects’ susceptibility to clinical malaria (Tougan et al., 2016). The vaccine is now being evaluated in a phase Ib trial in children under 5 years old (Tougan et al., 2016; Yagi et al., 2016).

AMA-1 DiCo Vaccine

The PfAMA1-DiCo recombinant vaccine candidate is based on the AMA-1 protein concentrated at the Mrz apical pole which participates in their reorientation and RBC invasion (Remarque et al., 2008b; ). This protein is stored in the micronemes (Srinivasan et al., 2011); it is structurally formed by 614 aa, having a 83-kDa molecular weight (Patarroyo et al., 2017a). It is differentiated into two regions; the first has a 550-aa ectodomain divided into three domains (I, II, and III) located in the N-terminal extreme, and the second, a transmembrane, intracytoplasmic region located in the C-terminal extreme (; ). AMA-1 is a highly polymorphic antigen (Ouattara et al., 2010); induced Ab response mainly targets the protein’s functionally irrelevant and variable portions, thus distracting a host’s immune response (Wright and Rayner, 2014; ).

The vaccine candidate includes three 454-aa (aa 100–545) sequences (DiCo 1, 2, and 3), designed by aligning and analyzing 355-aa sequences from the PfAMA1 FVO, HB3, and 3D7 strains’ extracellular region, covering 97% of target aa variability. A synthetic gene was constructed for each of the three DiCo sequences and then expressed in the yeast Pichia pastoris (Remarque et al., 2008a). A stepped phase Ia/Ib AMA-1 DiCo clinical trial was carried out in Europe and Africa. Phase Ia in Paris included 30 healthy adults who received three intramuscular (IM) doses of 50 μg of AMA-1 DiCo on days 0, 28, and 182, with two different adjuvants (alhydrogel, n = 15, or GLA-SE, n = 15). Phase Ib in Burkina Faso included 36 participants having had previous exposure to malaria, who received 50 μg of AMA-1-DiCo with GLA-SE (n = 18) or placebo with saline solution (n = 18). The vaccine was well tolerated by all participants; the most frequently occurring local reaction was pain at the injection site. Both vaccine formulations were immunogenic; nevertheless, GLA-SE was more potent than alhydrogel in the French participants, having a 200–300-fold increase in IgG Ab titers. By comparison, most volunteers in Burkina Faso who were seropositive during screening and had a lower Ab titer increase (four times) had higher IgG concentrations than the European participants by the end of the study (Sirima et al., 2017).

Considering that previous studies’ testing vaccine candidates based on variable AMA-1 regions have shown high immunogenicity but poor protective efficacy (Sagara et al., 2009; Payne et al., 2016), it remains to be seen whether AMA-1-DiCo (which also includes polymorphic regions) can achieve higher protection-inducing efficacy in ongoing phase II trials.

Placental Malaria Vaccines: PRIMVAC and PAMVAC

Pregnant women represent a group of the population having a greater risk of contracting malaria (). P. falciparum infection leading to the expression of the VAR2CSA antigen (a variable member of the PfEMP1 protein family interacting with chondroitin sulfate A) facilitates the accumulation of infected erythrocytes in the placenta, causing many obstetric complications, such as the threat of preterm delivery, low birth-weight, gestational anemia, and greater susceptibility to the parasite during infancy. This often leads to preterm mortality, involving around 100,000 abortions per year and thus making it a serious public health problem ().

Two anti-placental malaria vaccine candidates were presented at the European Vaccine Initiative (EVI) in Paris and Brussels in 2014; PRIMVAC and PAMVAC are based on the VAR2CSA protein. The first includes Duffy binding-like (DBL) regions 1X and 2X (DBL1X-DBL2X) and a 105-kDa VAR2CSA domain (Figure 2E) from the P. falciparum 3D7 strain, all expressed as a recombinant protein in E. coli (). A preclinical study involved BALB/c mice that received four doses IM of 110 μg PRIMVAC formulated with two adjuvants (GLA-SE or alhydrogel) on days 1, 15, 29, and 43. The pharmacological product was stable and remained potent up to 3 years after having been stored at −20°C, and no toxicity was observed. PRIMVAC adjuvanted with alhydrogel or GLA-SE produced Abs which could recognize VAR2CSA expressed on the surface of erythrocytes infected by different strains. The mice immunized with either of the two adjuvants had high Ab values (≥1/819,200) by day 65. These Abs also inhibited interaction with the homologous NF54–CSA strain and heterologous strains with CSA to a lesser extent ().

Clinical phase Ia/Ib began in January 2016; it involved 68 healthy 18- to 35-year-old European and African adults who received three doses (20, 50, and 100 μg) of PRIMVAC by IM injection on days 0, 28, and 56. It was estimated that this first clinical trial would culminate in April 2018; however, no preliminary research results are available (Srivastava et al., 2010; ; Sirima et al., 2016a).

PAMVAC is based on DBL inter-domains 1 and 2a (ID1-DBL2X-ID2a) as a 73-kDa fragment derived from the P. falciparum FCR3 strain PfEMP1 protein (Figure 2E), produced as a recombinant protein in Drosophila melanogaster Schneider-2 (S2) cells. The Ia/Ib clinical phase with PAMVAC began in May 2016, involving 66 healthy adults from Germany and Benin who received the same vaccination scheme as used with PRIMVAC. Preliminary safety and immunogenicity results for this vaccine candidate remain unknown ().

PfPEBS Vaccine

This vaccine uses a 1,000-kDa fragment (Figure 3A) from the P. falciparum Pf11.1 antigen (Petersen et al., 1990) which is expressed during pre-erythrocyte and blood stages (PfPEBS) which have been demonstrated to have in vitro functional activity against pre-erythrocyte and erythrocyte stages during P. falciparum infection. The vaccine is made as a synthetic protein and administered with AH adjuvant in two doses with a 28-day interval. It was postulated that 36 healthy 18- to 45-year-old adult volunteers should be included in phase Ia/II; they would have randomly received 5 or 30 μg of the vaccine for evaluating vaccine safety and immunogenicity profile as well as its efficacy through challenge studies. However, no data regarding this vaccine candidate’s clinical study’s preliminary results in humans have been published to date ().

FIGURE 3

).

EBA-175 RII NG Vaccine

The EBA-175 (175-kDa) protein belongs to the erythrocyte binding protein (EBP) family, which enables Mrz to interact with RBC and whose presence or absence defines alternative invasion routes (Zerka et al., 2016). The EBA-175 structure is formed by eight regions: a transmembrane one, a cytoplasmic one, and six extracellular regions or domains (I–VI). Domain II has been the most studied to date; it has functional importance regarding specific erythrocyte binding, to glycophorin A (GYPA). However, it has been found recently that domains V and VI, being translocated to the membrane, also mediate RBC invasion. The domain II region consists of 616 aa, having two cysteine-rich regions (F1 and F2) which are homologous for the Plasmodium vivax Duffy binding protein () (i.e., DBL for Duffy binding-like domain).

The vaccine developed with this non-glycosylated antigen (EBA-175 RII NG) contains F1 (aa 8–282) and F2 regions (aa 297–603) in its sequence (Tolia et al., 2005), thereby enabling binding to host RBC GYPA, and was expressed in P. pastoris (Zhang and Pan, 2005). In vitro studies have shown that malaria can be attenuated by the production of high Ab levels targeting EBA-175 (; Ohas et al., 2004), making it a potential vaccine candidate.

A Ia phase clinical trial included 80 participants in the USA who received three doses of the vaccine on days 0, 42, and 194 at different concentrations (5, 20, 80, and 160 μg), having slight- to moderate-intensity local and systemic reactions. Immunogenicity results highlighted appreciable anti-EBA-175 Ab levels when greater than 20-μg concentrations were administered with at least two immunizations. All participants vaccinated developed in vitro parasite growth during inhibition trials (3D7 strain) 14 days after the third dose (day 194) but had insufficient ability for inhibiting P. falciparum growth, ranging from 7% to 19% ().

An additional randomized, double-blind, phase Ib study evaluated the safety and immunogenicity of EBA-175 RII NG adjuvanted with aluminum phosphate administered in three doses to 60 semi-immune adults in Ghana (Africa) (). Vaccine concentrations (5, 20, and 80 μg) were well tolerated; however, 38 individuals developed grade 1 and grade 2 adverse reactions during follow-up (no severe AE). Ab titer geometric mean was similar for all vaccinated groups, decreasing after day 42 and rapidly increasing after the third vaccination. The highest parasite growth inhibition percentage occurred in the placebo group (25.0%) compared to the vaccinated group (12.0–20.0%).

Some limitations found in both trials were related to sample size, short/limited follow-up, and differences between immunological response regarding vaccine concentrations between people exposed to malaria and those not exposed to it. More time must thus be dedicated to developing the EBA-175 RII NG vaccine to improve its Ab functionality due to poor P. falciparum growth inhibition as demonstrated in in vitro trials ().

GMZ2 Vaccine (a Recombinant Protein Consisting of GLURP and MSP3 Conserved Domains)

GMZ2 is a fusion vaccine which includes N-terminal domain non-repeat regions from soluble (released to the environment during parasite growth) and glutamate-rich GLURP (R0 N-term-GLURP27–500) proteins, identified as the main B-cell epitopes. It has a 220-kDa molecular weight and is expressed during P. falciparum pre-erythrocyte and erythrocyte stages (Singh et al., 2004). The vaccine also includes a 48-kDa molecular weight, MSP3 (MSP3212–380) C-terminal domain conserved region (Figure 3C) (; Theisen et al., 2017). It has been proven that these antigens can induce Abs in semi-immune individuals (; Soe et al., 2004).

A phase Ia clinical trial was carried out in Germany in 2006 involving 30 participants who were divided into three groups according to the dose being administered (10, 30, or 100 μg GMZ2) (). The vaccine proved safe and was well tolerated; all adverse reactions were grade 1 or 2, being mainly associated with headache, fatigue, and nausea. Mean anti-GMZ2 Ab concentration similarly increased following the third vaccination, having an average of 1.20 mg/dl values in group 1, 1.60 mg/dl in group 2, and 1.33 mg/dl in group 3; however, such values considerably decreased following 1 year’s follow-up (day 365) regarding initial concentrations.

Phase Ib involved 40 participants in Gabon (Africa) who received three doses of 100 μg GMZ2 (). No severe AE (grade III) were reported, even though four participants developed malaria in the control group (anti-rabies vaccine) and in the group vaccinated with GMZ2. Although vaccinated individuals had higher anti-GMZ2 with 1.4 Ab levels higher than those for the control group at the end of the study, there was no difference regarding Ab production and memory B-cell response, possibly produced by intense previous exposure to P. falciparum.

Phase II clinical trials were carried out for evaluating GMZ2 efficacy. One of them involved thirty 1- to 5-year-old Gabonese children who randomly received three doses of 30 or 100 μg GMZ2 or anti-rabies vaccine (control group) on days 0, 28, and 56, with a 1-year follow-up (). Safety, reactogenicity, and immunogenicity results were similar to those for the study’s first phase, and the geometric mean for Abs produced was higher for the group which received the vaccine at 100-μg GMZ2 concentration (this being the dose selected for a multicenter trial).

This new study (phase IIb) in Burkina Faso, Ghana, Uganda, and Gabon involved immunizing 1,849 1- to 5-year-old African children; 868 of them received three doses of 100 μg GMZ2 at 0-, 1-, and 6-month intervals; 867 received the anti-rabies vaccine (control); and 114 were withdrawn from the trial (Sirima et al., 2016b). The GMZ2S group suffered 641 episodes of malaria and 720 occurred in the control group; 32 cases were severe malaria. Vaccine efficacy was 14% (adjusted for age and site) and 11.3% (adjusted for age), indicating that GMZ2 formulation must be improved to enable clinical studies to continue. Greater, longer-lasting immune response is thus required for inducing significant protection against clinical disease which could stimulate memory B-cells and long-lived plasma cells (LLPC) (Theisen et al., 2017).

ChAd 63RH5/MVA RH5 Vaccine

The reticulocyte binding protein homolog 5 (PfRH5) has a 63-kDa molecular weight (526 aa), this being lower than other RH family proteins (RH1, RH2a, RH2b, and RH4) ranging from 200 to 375 kDa (; ). RH5 is a necessary ligand for P. falciparum invasion of erythrocytes and plays an essential role in parasite survival via its interaction with RBC surface receptor basigin (BSG) (). Furthermore, it must be associated with cysteine-rich protective antigen (CyRPA) and PfRh5-interacting protein (PfRipr) to completely carry out its function, forming a macromolecular complex mediating RBC entry (Reddy et al., 2015; Wong et al., 2019). RH5 adopts different conformational states during complex formation, particularly when interacting with CyRPA and Ripr, such molecular rearrangements being crucial for target cell entry.

Structural analysis of RH protein family erythrocyte binding has led to identifying new inhibiting epitopes (Wright et al., 2014). Studies concerning anti-PfRH5 monoclonal Ab (mAb) have indicated complete inhibition against parasite invasion of RBC in vitro (Ord et al., 2014); this has been associated with protection against the disease (Ord et al., 2015). ChAd63 and MVA were used for developing the vaccine (Payne et al., 2017) (Figure 3D).

A phase Ia clinical trial for comparing/evaluating ChAd63 RH5 cf ChAd63 RH5 + MVA was carried out at two concentrations; it involved 24 British adults who had not been exposed to malaria (Payne et al., 2017). The vaccine had a favorable safety profile; most slight or moderate AE occurred in the MVA groups. The ChAd63 and MVA vectors were designed to maximize Ab response induction against erythrocyte-stage malaria antigens; reactogenicity, kinetics, and the magnitude of CD4+/CD8+ T-cell response results agreed with those found in other vaccine trials carried out with similar doses of these vectors (Sheehy et al., 2011, 2012). This was consistent with the hypothesis that immunity is mainly associated with the viral vector.

In vitro parasite growth inhibition trials involving a growth inhibition assay (GIA) gave 36.0–50.6% using 10 mg/ml purified IgG of immunized individuals. Avidity-based extracellular protein interaction screening (AVEXIS) tests confirmed that the vaccine could also block RH5FL complex proteins’ interaction with P113, CyRPA, and BSG proteins (Payne et al., 2017), forming a trimolecular complex for mediating RBC invasion. Subsequent studies analyzed the kinetics of Ab responses targeting RH5 complex antigens (PfRH5, CyRPA, and Pf113) in Ghanaian children suffering from P. falciparum malaria (Partey et al., 2018). The results showed that IgG-specific Abs became induced against PfRH5 complex proteins during acute malaria but that their prevalence was low and IgG levels rapidly decreased following treatment. Such data indicated that PfRH5 complex-specific Ab levels in natural infection in Ghanaian children were only markers for recent exposure (Partey et al., 2018).

Abs induced by immunization with ChAd 63RH5/MVA RH5 might not fully block RH5–BSG interaction since it has been shown that RH5 interacts better with RBC when complexed with Ripr and CyRPA than when binding alone (Wong et al., 2019). Moreover, it has been shown that the inhibitory effect of sera raised against RH5 and sera raised against CyRPA is additive (); including both antigens in a vaccine formulation would thus be desirable. It remains to be seen whether protective efficacy increases when all the proteins belonging to the complex are formulated together as RH5 conformation shifts when alone or in complex () and whether RH5–CyRPA–Ripr complex formation is essential for target cell entry.

Concluding Remarks

Developing vaccines against P. falciparum erythrocyte-stage infection has mainly been focused on formulations involving single-antigen recombinant proteins from a limited amount of molecules or their fragments (two or three). Most have had an acceptable safety profile and have sometimes been able to induce low or medium Ab titers partially capable of inhibiting parasite growth in vitro (i.e., in a GIA). However, the immunogenicity so induced has not been sufficient for providing significant protection against malaria, given the parasite’s tremendous complexity (which involves many proteins and mechanisms during invasion), the parasite’s genotype and phenotypical diversity (for evading a host’s immune system), the receptor molecules’ genetic variability, and human immune system molecules’ tremendous genetic complexity.

Developing an effective vaccine thus implies a clear understanding of the parasite’s life cycle, its antigenic polymorphism, sialic acid-dependent and sialic acid-independent invasion routes or alternative pathways, and a suitable production system regarding complete proteins or their functionally active basic subunits. An adjuvant or vaccine delivery system must be selected which can boost the immune response and guarantee a suitable safety profile.

The main difficulty regarding currently available vaccines (in trials) is that a high Ab concentration must be induced for blocking erythrocyte invasion and that they involve using antigens inducing specific immunogenicity against the vaccine strain which does not correlate with a person’s real exposure to different parasite strains in natural settings. The methods used for this type of formulation today involve using naked DNA encoding specific proteins, complete recombinant proteins, or viral vector DNA, some of which are associated with developing high rates of local and systemic reactogenicity.

No vaccine encoding a single blood-stage antigen or protein has induced significant immunogenicity and/or protection in phase I/II trials to date; new clinical studies should thus include more participants having different age ranges, thereby enabling statistically significant analysis and prolonged follow-up time for evaluating immunological memory. The formulation of a vaccine which can induce both humoral and cell-mediated immune responses would enable inducing immunity against P. falciparum, thereby increasing the/any efficacy reported to date.

A new functional approach recently suggested by other groups is that a fully protective antimalarial vaccine must be multi-epitope and multistage, an approach which has long been claimed by us. This is due to multiple strategies, like redundant proteins performing similar or the same biological function, rapid mutation, in one or several aa to bypass the immune system with one single aa change. It also must be multistage, that is, targeting both pre-erythrocyte (sporozoite) and erythrocyte (Mrz) stages (different proteins according to proteomics) and involving alternative pathways due to different receptors on invaded cells or a strong immune response against targeted molecules to ensure that hepatocyte and RBC invasion can be avoided. It must also have transmission blocking (gametocytes) components to avoid the parasite cycle becoming completed to control or reduce transmission from humans to mosquitoes.

Our Approach

A new functional approach to vaccine production is thus required when one considers the problems encountered regarding current vaccine candidates. FIDIC’s experience in the field (ca. 35 years) led to postulating a scientific, logical, and rational approach. This states that a fully protective antimalarial vaccine must be multi-epitope, multistage, and minimal subunit based, containing conserved aa sequences from key proteins by identifying high-activity binding peptides (cHABP); this can only be achieved by chemical synthesis.

Some of the many cHABPs identified by our institute have been included in the protein fragments selected by other groups for their vaccine candidate production. MSP3-derived cHABP 31202 (201Y220I) has been located in the MSP3-LSP vaccine’s conserved 95-aa fragment (Figure 2A). SERA-5-derived cHABPs 6725 (141Y–160K) and 6733 (321Y–340S) (Patarroyo et al., 2011; ) are included in the vaccine candidate BK-SE36 recombinant fragment (Figure 2C). PfAMA1-derived cHABP 4313 (134D–153G) located in conserved domain 1 and cHABP 4325 (374M–393H) in domain 2 are included in the AMA-1 DiCo vaccine candidate (Figure 2D). The FIDIC group has described cHABPs 1779 (356N–375I) and 1783 (436H–455K) in the F2 region in the aa sequence used in the EBA-175 RII NG vaccine (Figure 3B) (Patarroyo et al., 2017a).

The blood-stage antimalarial vaccine candidates’ immunogenicity results described here (mainly based on P. falciparum protein conserved regions) have indicated that although moderate Ab titers are induced after a first immunization, they do not induce long-lasting protective immunity. This is consistent with our research demonstrating that, although conserved regions are functionally important for target cell binding, they are poorly recognized by host immune system due to being located far from the highly polymorphic regions used by the parasite as an evasion mechanism to distract the immune system (Patarroyo et al., 2017b); such polymorphic regions are immunodominant but confer just strain-specific immunity (; ).

cHABPs are immunologically silent due to the particular and specific 3D structure they adopt (Patarroyo et al., 2016, 2017a), thereby hampering an appropriate presentation to the major histocompatibility complex class II (MHC II) binding groove (an essential step for mounting a strong adaptive immune response). A further refinement requires that cHABPs must be appropriately modified (mHABPs) to cover the immune system’s (HLA) immense human genetic variability, thus named immune protection-inducing protein structures (IMPiPS). mHABPs have proven highly immunogenic and protection inducing against experimental malaria in Aotus monkeys. This experimental model is susceptible to human malaria, having an immune system 90–100% identical to humans, as demonstrated by DNA sequencing (Suárez et al., 2006), thereby explaining the aforementioned proteins’ suitable profiles as vaccine candidates (Patarroyo et al., 2011, 2017b; Rodriguez et al., 2008).

Animal trials involved immunizing from five to nine Aotus monkeys per group with 125 μg each of mHABP (Patarroyo et al., 2017a). Blood samples were obtained before each immunization (days 0, 20, and 40) and 20 days after the third dose for immunological studies. Immunized and control Aotus were intravenously injected with 100,000 P. falciparum FVO-strain-infected RBC to evaluate protective efficacy (defined as the total absence of parasites in blood during the 15 days of the test) (Rodriguez et al., 1990). Animals were treated with antimalarial drugs and kept in quarantine until ascertaining that they were parasite free and then returned to the jungle 4 weeks later according to National Institute of Health Animal Management Guidelines.

This methodology has enabled testing and selecting mHABP derived from parasite life cycle stages, which has led to promising results in obtaining a highly immunogenic and protection-inducing antimalarial vaccine (; Rodriguez et al., 2008; ; ). Chemically synthesized vaccines’ main advantages include their high yield, reproducibility, purity (free of contaminants, such as endotoxins), lack of secondary adverse reactions, being able to synthesize unlimited amounts and stability at room temperature for long periods of time (not requiring cold chain) (; Skwarczynski and Toth, 2016).

The clear relationship observed between mHABPs’ structure, their immunological properties, and feasible production highlights the challenges and opportunities arising from this new methodology, along with the universal principles and rules used in developing a new vaccine.

Statements

Author contributions

DS, MG, LC-C, AC, and JM-F conceived the work and drafted the manuscript. CR designed the figures. MEP and MAP conceived the general work and critically revised the manuscript. All authors have revised the manuscript and given their approval for this version to be submitted.

Funding

This work was financed by the Universidad de Boyacá, Tunja, Colombia, and the Ph.D. program in Biomedical and Biological Sciences, Universidad del Rosario, Bogotá, Colombia.

Acknowledgments

We would like to thank Jason Garry for translating and thoroughly revising the manuscript.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  • 1

    Arévalo-PinzónG.CurtidorH.MuñozM.PatarroyoM. A.BermudezA.PatarroyoM. E. (2012). A single amino acid change in the Plasmodium falciparum RH5 (PfRH5) human RBC binding sequence modifies its structure and determines species-specific binding activity.Vaccine30637–646. 10.1016/j.vaccine.2011.11.012

  • 2

    AudranR.CachatM.LuratiF.SoeS.LeroyO.CorradinG.et al (2005). Phase I malaria vaccine trial with a long synthetic peptide derived from the merozoite surface protein 3 antigen.Infect. Immun.738017–8026. 10.1128/IAI.73.12.8017-8026.2005

  • 3

    BaumJ.ChenL.HealerJ.LopatickiS.BoyleM.TrigliaT.et al (2009). Reticulocyte-binding protein homologue 5 – An essential adhesin involved in invasion of human erythrocytes by Plasmodium falciparum.Int. J. Parasitol.39371–380. 10.1016/j.ijpara.2008.10.006

  • 4

    BelachewE. B. (2018). Immune response and evasion mechanisms of Plasmodium falciparum parasites.J. Immunol. Res.2018:6529681. 10.1155/2018/6529681

  • 5

    BélardS.IssifouS.HounkpatinA. B.SchaumburgF.NgoaU. A.EsenM.et al (2011). A randomized controlled phase Ib Trial of the malaria vaccine candidate GMZ2 in African children.PLoS One6:e22525. 10.1371/journal.pone.0022525

  • 6

    BermúdezA.Moreno-VranichA.PatarroyoM. E. (2012). Protective immunity provided by a new modified SERA protein peptide: its immunogenetic characteristics and correlation with 3D structure.Amino Acids43183–194. 10.1007/s00726-011-1061-5

  • 7

    BermúdezA.VanegasM.PatarroyoM. E. (2008). Structural and immunological analysis of circumsporozoite protein peptides: a further step in the identification of potential components of a minimal subunit-based, chemically synthesised antimalarial vaccine.Vaccine266908–6918. 10.1016/j.vaccine.2008.09.071

  • 8

    CaoJ.KanekoO.ThongkukiatkulA.TachibanaM.OtsukiH.GaoQ.et al (2009). Rhoptry neck protein RON2 forms a complex with microneme protein AMA1 in Plasmodium falciparum merozoites.Parasitol. Int.5829–35. 10.1016/j.parint.2008.09.005

  • 9

    ChenL.XuY.HealerJ.ThompsonJ. K.SmithB. J.LawrenceM. C.et al (2014). Crystal structure of PfRh5, an essential P. falciparum ligand for invasion of human erythrocytes.eLife3:e04187. 10.7554/eLife.04187

  • 10

    ChêneA.GangnardS.GuadallA.GinistyH.LeroyO.HavelangeN.et al (2019). Preclinical immunogenicity and safety of the cGMP-grade placental malaria vaccine PRIMVAC.EBioMedicine42145–156. 10.1016/j.ebiom.2019.03.010

  • 11

    ChêneA.HouardS.NielsenM. A.HundtS.D’AlessioF.SirimaS. B.et al (2016). Clinical development of placental malaria vaccines and immunoassays harmonization: a workshop report.Malar. J.15476. 10.1186/s12936-016-1527-8

  • 12

    CoelhoC. H.DoritchamouJ. Y. A.ZaidiI.DuffyP. E. (2017). Advances in malaria vaccine development: report from the 2017 malaria vaccine symposium.npj Vacc.234. 10.1038/s41541-017-0035-3

  • 13

    CorradinG.VillardV.KajavaA. V. (2007). Protein structure based strategies for antigen discovery and vaccine development against malaria and other pathogens.Endocr. Metab. Immune Disord. Drug Targets7259–265. 10.2174/187153007782794371

  • 14

    CowmanA. F.BerryD.BaumJ. (2012). The cellular and molecular basis for malaria parasite invasion of the human red blood cell.J. Cell Biol.198961–971. 10.1083/jcb.201206112

  • 15

    CowmanA. F.HealerJ.MarapanaD.MarshK. (2016). Malaria: biology and disease.Cell167610–624. 10.1016/j.cell.2016.07.055

  • 16

    CurtidorH.ReyesC.BermúdezA.VanegasM.VarelaY.PatarroyoM. E. (2017). Conserved binding regions provide the clue for peptide-based vaccine development: a chemical perspective.Molecules22:E2199. 10.3390/molecules22122199

  • 17

    DechavanneS.SrivastavaA.GangnardS.Nunes-SilvaS.DechavanneC.FievetN.et al (2015). Parity-dependent recognition of DBL1X-3X suggests an important role of the VAR2CSA high-affinity CSA-binding region in the development of the humoral response against placental malaria.Infect. Immun.832466–2474. 10.1128/IAI.03116-4

  • 18

    DeshmukhA.ChourasiaB. K.MehrotraS.KanaI. H.PaulG.PandaA.et al (2018). Plasmodium falciparum MSP3 exists in a complex on the merozoite surface and generates antibody response during natural infection.Infect. Immun.86:e00067-18. 10.1128/IAI.00067-18

  • 19

    DraperS. J.SackB. K.KingC. R.NielsenC. M.RaynerJ. C.HigginsM. K.et al (2018). Malaria vaccines: recent advances and new horizons.Cell Host Microbe2443–56. 10.1016/j.chom.2018.06.008

  • 20

    DruilheP.GentonB. (2012). Trial for Malaria Vaccine Candidate, PfPEBS (P. Falciparum Pre-Erythrocytic and Blood Stage) (PEBS-POC1). Available at: https://clinicaltrials.gov/ct2/show/record/NCT01605786(accessed May 15, 2019).

  • 21

    El SahlyH. M.PatelS. M.AtmarR. L.LanfordT. A.DubeT.ThompsonD.et al (2010). Safety and immunogenicity of a recombinant nonglycosylated erythrocyte binding antigen 175 region II malaria vaccine in healthy adults living in an area where malaria is not endemic.Clin. Vacc. Immunol.171552–1559. 10.1128/CVI.00082-10

  • 22

    EsenM.KremsnerP. G.SchleucherR.GässlerM.ImoukhuedeE. B.ImbaultN.et al (2009). Safety and immunogenicity of GMZ2 - a MSP3-GLURP fusion protein malaria vaccine candidate.Vaccine276862–6868. 10.1016/j.vaccine.2009.09.011

  • 23

    FavuzzaP.GuffartE.TamborriniM.SchererB.DreyerA. M.RuferA. C.et al (2017). Structure of the malaria vaccine candidate antigen CyRPA and its complex with a parasite invasion inhibitory antibody.eLife6:e20383. 10.7554/eLife.20383

  • 24

    FletcherT. E.BeechingN. J. (2013). Malaria.J. R. Army Med. Corps159158–166. 10.1136/jramc-2013-112

  • 25

    FoxB. A.Xing-LiP.SuzueK.HoriiT.BzikD. J. (1997). Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of parasite-inhibitory antibodies.Exp. Parasitol.85121–134. 10.1006/expr.1996.4118

  • 26

    GarciaY.PuentesA.CurtidorH.CifuentesG.ReyesC.BarretoJ.et al (2007). Identifying merozoite surface protein 4 and merozoite surface protein 7 Plasmodium falciparum protein family members specifically binding to human erythrocytes suggests a new malarial parasite-redundant survival mechanism.J. Med. Chem.505665–5675. 10.1021/jm070773z

  • 27

    GbédandéK.FievetN.ViwamiF.EzinmegnonS.IssifouS.ChippauxJ.-P.et al (2017). Clinical development of a VAR2CSA-based placental malaria vaccine PAMVAC: quantifying vaccine antigen-specific memory B & T cell activity in Beninese primigravidae.Vaccine353474–3481. 10.1016/j.vaccine.2017.05.027

  • 28

    HisaedaH.YasutomoK.HimenoK. (2005). Malaria: immune evasion by parasites.Int. J. Biochem. Cell Biol.37700–706. 10.1016/j.biocel.2004.10.009

  • 29

    HoriiT. (2008). [Malaria vaccine].Nippon Rinsho661990–1998.

  • 30

    HoriiT. (2014). Decisions for the future.Hum. Vacc. Immunotherapeut.107–10. 10.4161/hv.28053

  • 31

    HoriiT.ShiraiH.JieL.IshiiK. J.PalacpacN. Q.TouganT.et al (2010). Evidences of protection against blood-stage infection of Plasmodium falciparum by the novel protein vaccine SE36.Parasitol. Int.59380–386. 10.1016/j.parint.2010.05.002

  • 32

    JuilleratA.Lewit-BentleyA.GuillotteM.GangnardS.HesselA.BaronB.et al (2011). Structure of a Plasmodium falciparum PfEMP1 rosetting domain reveals a role for the N-terminal segment in heparin-mediated rosette inhibition.Proc. Natl. Acad. Sci. U.S.A.1085243–5248. 10.1073/pnas.1018692108

  • 33

    KoramK. A.AduB.OcranJ.KarikariY. S.Adu-AmankwahS.NtiriM.et al (2016). Safety and immunogenicity of EBA-175 RII-NG malaria vaccine administered intramuscularly in semi-immune adults: a phase 1, double-blinded placebo controlled dosage escalation study.PLoS One11:e0163066. 10.1371/journal.pone.0163066

  • 34

    KoramK. A.GyanB. A. (2010). Malaria vaccine development: an endemic country perspective.Hum. Vacc.612–16. 10.4161/hv.6.1.9605

  • 35

    KulangaraC.LuedinS.DietzO.RuschS.FrankG.MuellerD.et al (2012). Cell biological characterization of the malaria vaccine candidate trophozoite exported protein 1.PLoS One7:e46112. 10.1371/journal.pone.0046112

  • 36

    KwentiT. E.MoyeA. L.WiylanyuyA. B.NjundaL. A.Nkuo-AkenjiT. (2017). Variation in the immune responses against Plasmodium falciparum merozoite surface protein-1 and apical membrane antigen-1 in children residing in the different epidemiological strata of malaria in Cameroon.Malar. J.16453. 10.1186/s12936-017-2105-4

  • 37

    LiJ.MitamuraT.FoxB. A.BzikD. J.HoriiT. (2002). Differential localization of processed fragments of Plasmodium falciparum serine repeat antigen and further processing of its N-terminal 47 kDa fragment.Parasitol. Int.51343–352. 10.1016/s1383-5769(02)00042-9

  • 38

    LiangH.SimB. K. (1997). Conservation of structure and function of the erythrocyte-binding domain of Plasmodium falciparum EBA-175.Mol. Biochem. Parasitol.84241–245.

  • 39

    LimS. S.YangW.KrishnarjunaB.Kannan SivaramanK.ChandrashekaranI. R.KassI.et al (2014). Structure and dynamics of apical membrane antigen 1 from Plasmodium falciparum FVO.Biochemistry537310–7320. 10.1021/bi5012089

  • 40

    LumkulL.SawaswongV.SimpalipanP.KaewthamasornM.HarnyuttanakornP.PattaradilokratS. (2018). Unraveling haplotype diversity of the apical membrane antigen-1 gene in Plasmodium falciparum populations in Thailand.Korean J. Parasitol.56153–165. 10.3347/kjp.2018.56.2.153

  • 41

    MeraldiV.NebiéI.TionoA. B.DialloD.SanogoE.TheisenM.et al (2004). Natural antibody response to Plasmodium falciparum Exp-1, MSP-3 and GLURP long synthetic peptides and association with protection.Parasite Immunol.26265–272. 10.1111/j.0141-9838.2004.00705.x

  • 42

    MiuraK. (2016). Progress and prospects for blood-stage malaria vaccines.Expert Rev. Vacc.15765–781. 10.1586/14760584.2016.1141680

  • 43

    MordmüllerB.IssifouS. (2018). Safety and Immunogenicity of the Placental Malaria Vaccine Candidate PAMVAC Variously Adjuvanted (PAMVAC). Available at: https://clinicaltrials.gov/ct2/show/NCT02647489?term=PAMVAC&rank=1(accessed April 20, 2019).

  • 44

    MordmüllerB.SzywonK.GreutelaersB.EsenM.MewonoL.TreutC.et al (2010). Safety and immunogenicity of the malaria vaccine candidate GMZ2 in malaria-exposed, adult individuals from Lambaréné, Gabon.Vaccine286698–6703. 10.1016/j.vaccine.2010.07.085

  • 45

    MurilloL. A.RochaC. L.MoraA. L.KalilJ.GoldenbergA. K.PatarroyoM. E. (1991). Molecular analysis of HLA DR4-beta 1 gene in malaria vaccinees. Typing and subtyping by PCR technique and oligonucleotides.Parasite Immunol.13201–210. 10.1111/j.1365-3024.1991.tb00275.x

  • 46

    NarumD. L.HaynesJ. D.FuhrmannS.MochK.LiangH.HoffmanS. L.et al (2000). Antibodies against the Plasmodium falciparum receptor binding domain of EBA-175 block invasion pathways that do not involve sialic acids.Infect. Immun.681964–1966. 10.1128/iai.68.4.1964-1966.2000

  • 47

    NebieI.DiarraA.OuedraogoA.TionoA. B.KonateA. T.GansaneA.et al (2009). Humoral and cell-mediated immunity to MSP3 peptides in adults immunized with MSP3 in malaria endemic area, Burkina Faso.Parasite Immunol.31474–480. 10.1111/j.1365-3024.2009.01130.x

  • 48

    NostenF.LuxemburgerC.KyleD. E.BallouW. R.WittesJ.WahE.et al (1996). Randomised double-blind placebo-controlled trial of SPf66 malaria vaccine in children in northwestern Thailand. Shoklo SPf66 malaria vaccine trial group.Lancet348701–707. 10.1016/s0140-6736(96)04465-0

  • 49

    OhasE. A.AdamsJ. H.WaitumbiJ. N.OragoA. S. S.BarbosaA.LanarD. E.et al (2004). Measurement of antibody levels against region II of the erythrocyte-binding antigen 175 of Plasmodium falciparum in an area of malaria holoendemicity in western Kenya.Infect. Immun.72735–741. 10.1128/iai.72.2.735-741.2004

  • 50

    OlugbileS.KulangaraC.BangG.BertholetS.SuzarteE.VillardV.et al (2009). Vaccine potentials of an intrinsically unstructured fragment derived from the blood stage-associated Plasmodium falciparum Protein PFF0165c.Infect. Immun.775701–5709. 10.1128/IAI.00652-9

  • 51

    OrdR. L.CaldeiraJ. C.RodriguezM.NoeA.ChackerianB.PeabodyD. S.et al (2014). A malaria vaccine candidate based on an epitope of the Plasmodium falciparum RH5 protein.Malar. J.13:326. 10.1186/1475-2875-13-326

  • 52

    OrdR. L.RodriguezM.LoboC. A. (2015). Malaria invasion ligand RH5 and its prime candidacy in blood-stage malaria vaccine design.Hum. Vacc. Immunotherapeut.111465–1473. 10.1080/21645515.2015.1026496

  • 53

    OuattaraA.MuJ.Takala-HarrisonS.SayeR.SagaraI.DickoA.et al (2010). Lack of allele-specific efficacy of a bivalent AMA1 malaria vaccine.Malar. J.9:175. 10.1186/1475-2875-9-175

  • 54

    PalacpacN. M. Q.ArisueN.TouganT.IshiiK. J.HoriiT. (2011). Plasmodium falciparum serine repeat antigen 5 (SE36) as a malaria vaccine candidate.Vaccine295837–5845. 10.1016/j.vaccine.2011.06.052

  • 55

    PalacpacN. M. Q.NtegeE.YekaA.BalikagalaB.SuzukiN.ShiraiH.et al (2013). Phase 1b randomized trial and follow-up study in uganda of the blood-stage malaria vaccine candidate BK-SE36.PLoS One8:e64073. 10.1371/journal.pone.0064073

  • 56

    ParteyF. D.CastbergF. C.SarbahE. W.SilkS. E.AwandareG. A.DraperS. J.et al (2018). Kinetics of antibody responses to PfRH5-complex antigens in Ghanaian children with Plasmodium falciparum malaria.PLoS One13:e0198371. 10.1371/journal.pone.0198371

  • 57

    PatarroyoM. E. (1987). Induction of protective immunity against experimental infection with malaria using synthetic peptides.Nature328629–632. 10.1038/328629a0

  • 58

    PatarroyoM. E. (1988). A synthetic vaccine protects humans against challenge with asexual blood stages of Plasmodium falciparum malaria.Nature332158–161. 10.1038/332158a0

  • 59

    PatarroyoM. E.AlbaM. P.ReyesC.Rojas-LunaR.PatarroyoM. A. (2016). The malaria parasite’s Achilles’ heel: functionally-relevant invasion structures.Curr. Issues Mol. Biol1811–19.

  • 60

    PatarroyoM. E.AlbaM. P.Rojas-LunaR.BermudezA.Aza-CondeJ. (2017a). Functionally relevant proteins in Plasmodium falciparum host cell invasion.Immunotherapy9131–155. 10.2217/imt-2016-91

  • 61

    PatarroyoM. E.Aza-CondeJ.Moreno-VranichA.PabónL.VarelaY.PatarroyoM. A. (2017b). Far from the Madding Crowd: the molecular basis for immunological escape of Plasmodium falciparum.Curr. Issues Mol. Biol.2265–78. 10.21775/cimb.022.065

  • 62

    PatarroyoM. E.BermúdezA.PatarroyoM. A. (2011). Structural and immunological principles leading to chemically synthesized, multiantigenic, multistage, minimal subunit-based vaccine development.Chem. Rev.1113459–3507. 10.1021/cr100223m

  • 63

    PayneR. O.MilneK. H.EliasS. C.EdwardsN. J.DouglasA. D.BrownR. E.et al (2016). Demonstration of the blood-stage Plasmodium falciparum controlled human malaria infection model to assess efficacy of the P. falciparum apical membrane antigen 1 vaccine, FMP2.1/AS01.J. Infect. Dis.2131743–1751. 10.1093/infdis/jiw039

  • 64

    PayneR. O.SilkS. E.EliasS. C.MiuraK.DioufA.GalawayF.et al (2017). Human vaccination against RH5 induces neutralizing antimalarial antibodies that inhibit RH5 invasion complex interactions.JCI Insight2:96381. 10.1172/jci.insight.96381

  • 65

    PetersenC.NelsonR.LeechJ.JensenJ.WollishW.ScherfA. (1990). The gene product of the Plasmodium falciparum 11.1 locus is a protein larger than one megadalton.Mol. Biochem. Parasitol.42189–195. 10.1016/0166-6851(90)90161-e

  • 66

    ReddyK. S.AmlabuE.PandeyA. K.MitraP.ChauhanV. S.GaurD. (2015). Multiprotein complex between the GPI-anchored CyRPA with PfRH5 and PfRipr is crucial for Plasmodium falciparum erythrocyte invasion.Proc. Natl. Acad. Sci. U.S.A.1121179–1184. 10.1073/pnas.1415466112

  • 67

    RemarqueE. J.FaberB. W.KockenC. H. M.ThomasA. W. (2008a). A diversity-covering approach to immunization with plasmodium falciparum apical membrane antigen 1 induces broader allelic recognition and growth inhibition responses in rabbits.Infect. Immun.762660–2670. 10.1128/IAI.00170-8

  • 68

    RemarqueE. J.FaberB. W.KockenC. H. M.ThomasA. W. (2008b). Apical membrane antigen 1: a malaria vaccine candidate in review.Trends Parasitol.2474–84. 10.1016/j.pt.2007.12.002

  • 69

    RodríguezL. E.CurtidorH.OcampoM.GarciaJ.PuentesA.ValbuenaJ.et al (2005). Identifying Plasmodium falciparum merozoite surface antigen 3 (MSP3) protein peptides that bind specifically to erythrocytes and inhibit merozoite invasion.Protein Sci.141778–1786. 10.1110/ps.041304505

  • 70

    RodriguezL. E.CurtidorH.UrquizaM.CifuentesG.ReyesC.PatarroyoM. E. (2008). Intimate molecular interactions of P. falciparum merozoite proteins involved in invasion of red blood cells and their implications for vaccine design.Chem. Rev.1083656–3705. 10.1021/cr068407v

  • 71

    RodriguezR.MorenoA.GuzmanF.CalvoM.PatarroyoM. E. (1990). Studies in owl monkeys leading to the development of a synthetic vaccine against the asexual blood stages of Plasmodium falciparum.Am. J. Trop. Med. Hyg.43339–354. 10.4269/ajtmh.1990.43.339

  • 72

    SagaraI.DickoA.EllisR. D.FayM. P.DiawaraS. I.AssadouM. H.et al (2009). A randomized controlled phase 2 trial of the blood stage AMA1-C1/Alhydrogel malaria vaccine in children in Mali.Vaccine273090–3098. 10.1016/j.vaccine.2009.03.014

  • 73

    SheehyS. H.DuncanC. J.EliasS. C.ChoudharyP.BiswasS.HalsteadF. D.et al (2012). ChAd63-MVA–vectored blood-stage malaria vaccines targeting MSP1 and AMA1: assessment of efficacy against mosquito bite challenge in humans.Mol. Ther.202355–2368. 10.1038/mt.2012.223

  • 74

    SheehyS. H.DuncanC. J.EliasS. C.CollinsK. A.EwerK. J.SpencerA. J.et al (2011). Phase Ia clinical evaluation of the Plasmodium falciparum blood-stage antigen MSP1 in ChAd63 and MVA vaccine vectors.Mol. Ther.192269–2276. 10.1038/mt.2011.176

  • 75

    SinghS.SoeS.MejiaJ.-P.RoussilhonC.TheisenM.CorradinG.et al (2004). Identification of a conserved region of Plasmodium falciparum MSP3 targeted by biologically active antibodies to improve vaccine design.J. Infect. Dis.1901010–1018. 10.1086/423208

  • 76

    SirimaS. B.DurierC.KaraL.HouardS.GansaneA.LoulergueP.et al (2017). Safety and immunogenicity of a recombinant Plasmodium falciparum AMA1-DiCo malaria vaccine adjuvanted with GLA-SE or Alhydrogel® in European and African adults: a phase 1a/1b, randomized, double-blind multi-centre trial.Vaccine356218–6227. 10.1016/j.vaccine.2017.09.027

  • 77

    SirimaS. B.LaunayO.GamainB. (2016a). Trial to Evaluate the Safety and Immunogenicity of a Placental Malaria Vaccine Candidate (PRIMVAC) in Healthy Adults (PRIMALVAC). Available at: https://clinicaltrials.gov/ct2/show/NCT02658253?term=primvac&rank=1(accessed June 10, 2019).

  • 78

    SirimaS. B.MordmüllerB.MilliganP.NgoaU. A.KirondeF.AtugubaF.et al (2016b). A phase 2b randomized, controlled trial of the efficacy of the GMZ2 malaria vaccine in African children.Vaccine344536–4542. 10.1016/j.vaccine.2016.07.041

  • 79

    SirimaS. B.NébiéI.OuédraogoA.TionoA. B.KonatéA. T.GansanéA.et al (2007). Safety and immunogenicity of the Plasmodium falciparum merozoite surface protein-3 long synthethic peptide (MSP3-LSP) malaria vaccine in healthy, semi-immune adult males in Burkina Faso, West Africa.Vaccine252723–2732. 10.1016/j.vaccine.2006.05.090

  • 80

    SirimaS. B.TionoA. B.OuédraogoA.DiarraA.OuédraogoA. L.YaroJ. B.et al (2009). Safety and immunogenicity of the malaria vaccine candidate MSP3 long synthetic peptide in 12-24 months-old Burkinabe children.PLoS One4:e7549. 10.1371/journal.pone.0007549

  • 81

    SkwarczynskiM.TothI. (2016). Peptide-based synthetic vaccines.Chem. Sci.7842–854. 10.1039/C5SC03892H

  • 82

    SoeS.TheisenM.RoussilhonC.AyeK.-S.DruilheP. (2004). Association between protection against clinical malaria and antibodies to merozoite surface antigens in an area of hyperendemicity in myanmar: complementarity between responses to merozoite surface protein 3 and the 220-kilodalton glutamate-rich protein.Infect. Immun.72247–252. 10.1128/IAI.72.1.247-252.2004

  • 83

    SrinivasanP.BeattyW. L.DioufA.HerreraR.AmbroggioX.MochJ. K.et al (2011). Binding of Plasmodium merozoite proteins RON2 and AMA1 triggers commitment to invasion.Proc. Natl. Acad. Sci. U.S.A.10813275–13280. 10.1073/pnas.1110303108

  • 84

    SrivastavaA.GangnardS.RoundA.DechavanneS.JuilleratA.RaynalB.et al (2010). Full-length extracellular region of the var2CSA variant of PfEMP1 is required for specific, high-affinity binding to CSA.Proc. Natl. Acad. Sci. U.S.A.1074884–4889. 10.1073/pnas.1000951107

  • 85

    Steiner-MonardV.KamakaK.KarouiO.RoethlisbergerS.AudranR.DaubenbergerC.et al (2018). The candidate blood stage malaria vaccine P27A induces a robust humoral response in a fast track to the field phase I trial in exposed and non exposed volunteers.Clin. Infect. Dis.68466–474. 10.1093/cid/ciy514

  • 86

    SuárezC. F.PatarroyoM. E.TrujilloE.EstupiñánM.BaqueroJ. E.ParraC.et al (2006). Owl monkey MHC-DRB exon 2 reveals high similarity with several HLA-DRB lineages.Immunogenetics58857–857. 10.1007/s00251-006-0157-7

  • 87

    TahitaM. C.TintoH.MentenJ.OuedraogoJ.-B.GuiguemdeR. T.van GeertruydenJ.et al (2013). Clinical signs and symptoms cannot reliably predict Plasmodium falciparum malaria infection in pregnant women living in an area of high seasonal transmission.Malar. J.12464. 10.1186/1475-2875-12-464

  • 88

    TheisenM.AduB.MordmüllerB.SinghS. (2017). The GMZ2 malaria vaccine: from concept to efficacy in humans.Expert Rev. Vacc.16907–917. 10.1080/14760584.2017.1355246

  • 89

    ToliaN. H.EnemarkE. J.SimB. K. L.Joshua-TorL. (2005). Structural basis for the EBA-175 erythrocyte invasion pathway of the malaria parasite Plasmodium falciparum.Cell122183–193. 10.1016/j.cell.2005.05.033

  • 90

    TouganT.EdulaJ. R.TakashimaE.MoritaM.ShinoharaM.ShinoharaA.et al (2018). Molecular camouflage of Plasmodium falciparum merozoites by binding of host vitronectin to P47 fragment of SERA5.Sci. Rep.8:5052. 10.1038/s41598-018-23194-9

  • 91

    TouganT.ItoK.PalacpacN. M. Q.EgwangT. G.HoriiT. (2016). Immunogenicity and protection from malaria infection in BK-SE36 vaccinated volunteers in Uganda is not influenced by HLA-DRB1 alleles.Parasitol. Int.65455–458. 10.1016/j.parint.2016.06.012

  • 92

    ValeroM. V.AmadorL. R.GalindoC.FigueroaJ.BelloM. S.MurilloL. A.et al (1993). Vaccination with SPf66, a chemically synthesised vaccine, against Plasmodium falciparum malaria in Colombia.Lancet341705–710. 10.1016/0140-6736(93)90483-w

  • 93

    VillardV.AgakG. W.FrankG.JafarshadA.ServisC.NébiéI.et al (2007). Rapid identification of malaria vaccine candidates based on α-helical coiled coil protein motif.PLoS One2:e645. 10.1371/journal.pone.0000645

  • 94

    WeissG. E.GilsonP. R.TaechalertpaisarnT.ThamW.-H.de JongN. W. M.HarveyK. L.et al (2015). Revealing the sequence and resulting cellular morphology of receptor-ligand interactions during Plasmodium falciparum invasion of erythrocytes.PLoS Pathog.11:e1004670. 10.1371/journal.ppat.1004670

  • 95

    WHO (2017). Malaria Vaccine Rainbow Table. Available at: http://www.who.int/vaccine_research/links/Rainbow/en/index.html(accessed April 27, 2019).

  • 96

    WHO (2018). World malaria report 2018.Geneva: WHO.

  • 97

    WongW.HuangR.MenantS.HongC.SandowJ. J.BirkinshawR. W.et al (2019). Structure of Plasmodium falciparum Rh5-CyRPA-Ripr invasion complex.Nature565118–121. 10.1038/s41586-018-0779-6

  • 98

    WrightG. J.RaynerJ. C. (2014). Plasmodium falciparum erythrocyte invasion: combining function with immune evasion.PLoS Pathog.10:e1003943. 10.1371/journal.ppat.1003943

  • 99

    WrightK. E.HjerrildK. A.BartlettJ.DouglasA. D.JinJ.BrownR. E.et al (2014). Structure of malaria invasion protein RH5 with erythrocyte basigin and blocking antibodies.Nature515427–430. 10.1038/nature13715

  • 100

    YagiM.PalacpacN. M. Q.ItoK.OishiY.ItagakiS.BalikagalaB.et al (2016). Antibody titres and boosting after natural malaria infection in BK-SE36 vaccine responders during a follow-up study in Uganda.Sci. Rep.6:34363. 10.1038/srep34363

  • 101

    ZerkaA.OlechwierA.RydzakJ.KaczmarekR.JaskiewiczE. (2016). Baculovirus-expressed Plasmodium reichenowi EBA-140 merozoite ligand is host specific.Parasitol. Int.65708–714. 10.1016/j.parint.2016.07.009

  • 102

    ZhangD.PanW. (2005). Evaluation of three pichia pastoris-expressed Plasmodium falciparum merozoite proteins as a combination vaccine against infection with blood-stage parasites.Infect. Immun.736530–6536. 10.1128/IAI.73.10.6530-6536.2005

Summary

Keywords

clinical trial, immunogenicity, vaccine, malaria, antimalarial vaccine, merozoite, Plasmodium falciparum

Citation

Salamanca DR, Gómez M, Camargo A, Cuy-Chaparro L, Molina-Franky J, Reyes C, Patarroyo MA and Patarroyo ME (2019) Plasmodium falciparum Blood Stage Antimalarial Vaccines: An Analysis of Ongoing Clinical Trials and New Perspectives Related to Synthetic Vaccines. Front. Microbiol. 10:2712. doi: 10.3389/fmicb.2019.02712

Received

11 September 2019

Accepted

08 November 2019

Published

03 December 2019

Volume

10 - 2019

Edited by

Lisa Sedger, University of Technology Sydney, Australia

Reviewed by

Sonja Frölich, The University of Adelaide, Australia; Sunil Joshi, University of Miami, United States

Updates

Copyright

Manuel Elkin Patarroyo, Manuel Alfonso Patarroyo,

†These authors have contributed equally to this work and share first authorship

This article was submitted to Infectious Diseases, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics