ORIGINAL RESEARCH article

Front. Microbiol., 11 September 2020

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 11 - 2020 | https://doi.org/10.3389/fmicb.2020.576738

In silico Screening Unveil the Great Potential of Ruminal Bacteria Synthesizing Lasso Peptides

  • 1. Departamento de Microbiologia, Universidade Federal de Viçosa, Viçosa, Brazil

  • 2. Departamento de Bioquímica e Biologia Molecular, Universidade Federal de Viçosa, Viçosa, Brazil

  • 3. Institute for Global Food Security, School of Biological Sciences, Medical Biology Centre, Queen’s University Belfast, Belfast, United Kingdom

Abstract

Studies of rumen microbial ecology suggest that the capacity to produce antimicrobial peptides could be a useful trait in species competing for ecological niches in the ruminal ecosystem. However, little is known about the synthesis of lasso peptides by ruminal microorganisms. Here we analyzed the distribution and diversity of lasso peptide gene clusters in 425 bacterial genomes from the rumen ecosystem. Genome mining was performed using antiSMASH 5, BAGEL4, and a database of well-known precursor sequences. The genomic context of the biosynthetic clusters was investigated to identify putative lasA genes and protein sequences from enzymes of the biosynthetic machinery were evaluated to identify conserved motifs. Metatranscriptome analysis evaluated the expression of the biosynthetic genes in the rumen microbiome. Several incomplete (n = 23) and complete (n = 11) putative lasso peptide clusters were detected in the genomes of ruminal bacteria. The complete gene clusters were exclusively found within the phylum Firmicutes, mainly (48%) in strains of the genus Butyrivibrio. The analysis of the genetic organization of complete putative lasso peptide clusters revealed the presence of co-occurring genes, including kinases (85%), transcriptional regulators (49%), and glycosyltransferases (36%). Moreover, a conserved pattern of cluster organization was detected between strains of the same genus/species. The maturation enzymes LasB, LasC, and LasD showed regions highly conserved, including the presence of a transglutaminase core in LasB, an asparagine synthetase domain in LasC, and an ABC-type transporter system in LasD. Phylogenetic trees of the essential biosynthetic proteins revealed that sequences split into monophyletic groups according to their shared single common ancestor. Metatranscriptome analyses indicated the expression of the lasso peptides biosynthetic genes within the active rumen microbiota. Overall, our in silico screening allowed the discovery of novel biosynthetic gene clusters in the genomes of ruminal bacteria and revealed several strains with the genetic potential to synthesize lasso peptides, suggesting that the ruminal microbiota represents a potential source of these promising peptides.

Introduction

Natural products have improved human quality of life and play a noteworthy role in drug discovery and development (). Among natural products, secondary metabolites stand out as scaffolds for the development of products for human medicine, animal health, crop protection, and numerous biotechnological applications (). Traditional culture-based strategies for the screening of new molecules have been responsible for the discovery of many relevant enzymes and metabolites (; ). However, these approaches are largely driven by chance, making then costly, time-consuming, and often limited regarding the number of strains that can be used in large-scale screening endeavors (). The advent of microbial genomics and the increasing availability of computational tools to perform genome mining has evidenced the underexplored potential of some microbial species as alternative sources of new therapeutic agents (). These tools and resources emerged as an alternative approach to identify novel biosynthetic gene clusters (BGCs) encoding putative bioactive metabolites and to assess the genetic potential of producer strains (). Besides the discovery of new products, genome mining also contributes to understanding the connection between metabolites and the gene sequences that encode them, providing ecological insights about the role of individual microbial populations in the microbiome ().

Secondary metabolites could play a diverse role in the environment by their wide range of biological activities. In this context, lasso peptides stand out as functionally diverse metabolites produced by several species of bacteria. Members of the lasso peptide family are reported to have antimicrobial (; ) and anti-viral activities (; ). These molecules also can show receptor antagonism activities, such as the glucagon receptor antagonist BI-32169 (; ) or act as enzyme inhibitors (; ). This functional diversity combined with their physicochemical properties makes lasso peptides attractive scaffolds for drug development (). Moreover, these molecules compose a class of ribosomally synthesized and post-translationally modified peptides (RiPPs), which are suitable for genome mining approaches due to the gene-encoded nature of their precursors ().

The lasso peptides typically contain 16–21 amino acid residues and are defined by their unusual topology, which resembles threaded lassos or slipknots. This peculiar structure is the result of cyclization, which is due to the amide bond between the amino group of an N-terminal Gly/Cys residue and the carboxyl group of a Glu/Asp residue at position 8 or 9 of the mature peptide (; ; ). This post-translational modification is performed by a protease that shows homology to bacterial transglutaminases (LasB) and by a protein homologous to asparagine synthetase (LasC) (; ). It is assumed that LasC is involved in the activation of the side-chain carboxyl group of the Glu/Asp residue at position 8 or 9, while LasB catalyzes the transfer of ammonia from glutamine to the activated side-chain carboxyl group. Following this, the cleavage of the precursor peptide releases an N-terminal Gly/Cys, and the cyclization takes place by a nucleophilic attack (; ; ; ). The gene D is also frequently found on the biosynthetic gene clusters of lasso peptides encoding an ABC transporter that is thought to play a role in immunity of producer cells against the antimicrobial activity of their lasso peptides (, ; ).

Studies based on genome mining have contributed to identifying new microbial species producing lasso peptides (; ; ). The ruminal ecosystem is composed of microbial communities that show high taxonomic and functional diversity (), and although it has been investigated as a source for novel enzymes and antimicrobials (; ; ), the rumen still represents an underexplored environment for the discovery of lasso peptides. Indeed, both culture-dependent and culture-independent approaches have revealed promising antimicrobial peptides from the rumen (; ; ; , ). However, no systematic efforts have been made to investigate the potential of rumen bacteria to produce lasso peptides. The availability of hundreds of reference genomes from cultured ruminal bacteria through the Hungate1000 Project1, offers an unprecedented opportunity to identify novel lasso peptides within the genomes of ruminal bacteria. The present study set out to perform an in silico screening of the genomes of the major bacterial species represented in the core ruminal microbiome in an attempt to identify biosynthetic gene clusters encoding putative lasso peptides. As such, this work aimed to i) characterize the distribution of BGCs potentially associated with the production of lasso peptides in the genomes of ruminal bacteria; ii) identify sequences of potential novel lasso peptide precursors, iii) evaluate the phylogenetic distribution and conservation of the biosynthetic genes/proteins predicted to encode lasso peptides, and iv) examine if these biosynthetic genes are expressed by the active rumen microbiota.

Materials and Methods

Genomic Data Collection and Prediction of Lasso Peptides Within Rumen Bacterial Genomes

Genome files (.fasta) of 425 ruminal bacteria belonging to the Hungate1000 project () were downloaded from the NCBI (National Center for Biotechnology Information2 and JGI (Joint Genome Institute3) websites (Supplementary Table 1).

To identify microcin producers, the amino acid sequences of McjA (AAD28494.1), McjB (AAD28495.1), McjC (AGC14226.1), and McjD (AGC14214.1), which are products of the mcjABCD gene cluster, were downloaded from NCBI. A set of 68 lasso peptides previously described in the literature were also screened based on their core sequences () (Supplementary Table 2). Screening of these protein-coding genes in genomes of ruminal bacteria was performed by running BLASTx through the command line. The cut-off parameters used to consider positive hits were a minimum sequence identity of 30% and E-value < 10–5. New putative biosynthetic gene clusters in the genomes of ruminal bacteria were predicted using the web-based genome mining tools of antiSMASH 5 () and BAGEL4 ().

The genes belonging to predicted clusters were generically named lasA, lasB, lasC, and lasD, corresponding to the following putative gene products: LasA, the lasso peptide precursor; LasB, the leader peptidase, LasC, the lasso cyclase and LasD, the ABC transporter ().

Distribution of BGCs Encoding Putative Lasso Peptides in the Genomes of Ruminal Bacteria

To verify the distribution of biosynthetic gene clusters encoding putative lasso peptides in the genomes of rumen bacteria, a phylogenetic tree was reconstructed using the 16S rRNA gene sequences from the rumen bacterial genomes analyzed in this study. The sequences were obtained from the Hungate1000 Project and aligned using RDP Release 11.5 aligner of the Ribosomal Database Project website (RDP4). The phylogenetic tree was reconstructed using the Approximately Maximum-Likelihood method by FastTree v2.1 (). The Interactive Tree of Life (iTOL) interface v45 () was used to visualize and annotate the FastTree output file (.tree).

Genomic Context of the Lasso Peptide Biosynthetic Gene Clusters

When a putative biosynthetic gene cluster was predicted by BAGEL4 and/or antiSMASH 5 but the gene encoding the potential precursor peptide was not identified, the regions located upstream and downstream of the predicted biosynthetic genes were examined, covering a region varying from 4762 bp to 17083 bp in length. This analysis is based on the assumption that genes sharing similar occurrence patterns or located near each other within the genome are likely to be functionally related. For that, genomes were annotated using Prokka v1.12 () (minimum contig size of 200 kb and E-value < 10–6) through the Galaxy platform and manually inspected to identify sequences potentially encoding the lasso peptide precursor within the genomic context of the biosynthetic machinery minimally required for the production of lasso peptides. A manual analysis of the genes adjacent to the lasso peptide gene cluster was also performed to investigate the presence of co-occurring genes. When proteins were annotated as “hypothetical”, BLAST analyses were performed in Uniprot to investigate the protein function using 30% of amino acid sequence similarity as the cut-off parameter.

Characterization of the Biosynthetic Proteins

Conservation Analysis of LasA, LasB, and LasC

Conserved motifs in putative lasso peptide precursors (LasA) and maturation enzymes (LasB, and LasC) were identified using the Batch Web CD-Search tool (). Default parameters were used for the analysis and the results were filtered considering E-value < 10–6. To analyze if the amino acid sequences of the biosynthetic precursors/proteins (LasA, LasB, and LasC) could be grouped according to the evolutionary history of the major species of bacteria from the rumen microbiome, phylogenetic trees were reconstructed based on the sequences of these proteins. The sequences were aligned using muscle 3.8.31. FastTree v2.1 was used to perform the tree reconstruction and iTOL was used to visualize and annotate the tree as described above. For LasA, the amino acid composition of conserved residues corresponding to the 44 amino acid residues located in the N-terminus of the protein was represented using WebLogo 2.8.26 and the default parameters.

Prediction of the LasA Core

Predictions of putative LasA core sequences followed patterns of the distribution of amino acid residues that have been extensively reported in the literature for precursor and mature lasso peptide sequences (; ; ). The core sequences of the putative lasso peptide precursors were inferred using BAGEL4, antiSMASH 5, and manual analyses of the genomic sequences flanking the putative gene clusters. The presence of glycine (G) at position 1 of the core peptide, followed by an aspartate (D) located at position 8 or 9 were used as criteria indicative of the N-terminal macrolactam ring matching the lasso peptides precursor pattern. The presence of threonine (T) in the leader peptide near the cleavage site was also taken into account, as well as the presence of conserved amino acids at particular positions in the precursor peptides, as indicated by the alignment of putative LasA sequences. All sequences predicted as a putative core of LasA were run through RiPPMiner7 to confirm cross-links between post-translationally modified residues associated with the formation of a characteristic ring structure in lasso peptides ().

Expression of Lasso Peptide Genes in Rumen Metatranscriptomes

The expression of the genes lasA, lasB, and lasC predicted in the genomes of ruminal bacteria were investigated using different metatranscriptome datasets from the rumen. Sequences of fifteen metatranscriptomes were obtained from the sequence read archive (SRA) of NCBI8 (). These datasets included ruminal metatranscriptomes from dairy and beef cattle and sheep, as described in Supplementary Table 3.

To evaluate the expression of unique lasA, lasB, and lasC genes, sequences corresponding to these genes but showing more than 50% similarities in a distance matrix calculated using Clustal Omega () were eliminated from the downstream analyses. Bowtie-build tool was then used to index the lasso peptide sequences and Bowtie2/2.2.8 () was applied to align the genes and the metatranscriptome datasets. The alignment results were visualized through Tablet software 1.19.09.03 (). The expression levels of lasA, lasB, and lasC were normalized calculating the number of reads per kilobase per million of mapped reads (RPKM) ().

Results

Distribution of Predicted Biosynthetic Gene Clusters of Lasso Peptides in the Species of Ruminal Bacteria

In the current study, we performed data mining in 425 bacterial genomes representing the major species of bacteria from the rumen microbiome in an attempt to identify BGCs potentially associated with the production of lasso peptides. Computational tools were applied to search for sequences in the rumen bacterial genomes with similarities to genes that are known to be associated with the biosynthesis of lasso peptides. Butyrivibrio proteoclasticus P18 and Lachnospiraceae bacterium NK4A144 harbored a gene encoding a product matching the McjC protein previously characterized in the mcjABCD operon (30% as a sequence similarity cut-off and E-value < 10–5), which is associated with the production of microcin J25. Moreover, mining the rumen bacterial genomes using the core regions of 68 lasso peptide precursors as query sequences revealed that Actinomyces denticolens PA and Bacillus cereus KPR-7A harbor sequences of core peptides highly similar (>70%) to Ssv-2083 and Paeninodim, respectively.

The BGCs predicted using BAGEL4 and antiSMASH 5 were divided into complete clusters, when containing all the genes considered to be essential (lasA, lasB and lasC) for the biosynthesis machinery required for lasso peptide production, and those which appear to be incomplete gene clusters, containing at least one (but not all) of the genes required for lasso peptide biosynthesis. The genome mining approaches revealed thirty-four ruminal bacterial genomes harboring incomplete or complete biosynthetic gene clusters potentially encoding putative lasso peptides (Table 1). The genomes with positive hits belonged mainly to the genera Butyrivibrio, of which 14 incomplete clusters and 3 complete clusters were identified out of 53 genomes analyzed. Members of the genus Lachnospira sp. (n = 5) harbored 3 incomplete and 2 complete biosynthetic gene clusters. Biosynthetic clusters containing all the essential genes for lasso peptide biosynthesis were also identified in the genomes of ruminal Bacillus sp. (n = 3), while other genera of ruminal bacteria, such as Acetitomaculum, Actinomyces, Clostridium, Eubacterium, and Ruminococcus presented clusters in lower abundance or the number of available genomes was too few to allow inferences about the abundance of putative lasso peptide gene clusters (Supplementary Figure S1).

TABLE 1

Genomes1BAGEL4
antiSMASH 5
lasAlasBlasClasDlasAlasBlasClasD
Acetitomaculum ruminis DSM 552200110111
Actinomyces denticolens PA10110000
Bacillus cereus KPR-7A00001111
Bacillus licheniformis VTM3R7800111111
Bacillus sp. MB202100111111
Butyrivibrio fibrisolvens AB202010100111
Butyrivibrio fibrisolvens AR4000100110
Butyrivibrio fibrisolvens DSM 307100101111
Butyrivibrio fibrisolvens MD200100010111
Butyrivibrio fibrisolvens WTE300400100111
Butyrivibrio fibrisolvens YRB200500100111
Butyrivibrio proteoclasticus B31600110111
Butyrivibrio proteoclasticus FD200700110111
Butyrivibrio sp. FC200100100110
Butyrivibrio sp. INlla1400000111
Butyrivibrio sp. MC202100110111
Butyrivibrio sp. NC300500110111
Butyrivibrio sp. VCD200600111110
Butyrivibrio sp. XBB100100110111
Butyrivibrio sp. XPD200600100111
Butyrivibrio sp. YAB300100110111
Clostridium beijerinckii HUN14200100111
Clostridium butyricum AGR214000110111
Eubacterium celullosolvens LD200600000110
Lachnospira multipara D15d00111111
Lachnospira multipara LB200300110111
Lachnospira multipara MC200300111111
Lachnospira multipara ATCC 1920700001111
Lachnospira pectinoschiza M8300110111
Lachnospiraceae bacterium KH1P1700000110
Lachnospiraceae bacterium MA202000110111
Lachnospiraceae bacterium YSD201300100110
Ruminococcus albus 800001111
Ruminococcus flavefaciens ATCC 1920810011111

Ruminal bacterial genomes harboring genes and gene clusters encoding putative lasso peptides predicted by BAGEL4 and antiSMASH 5.

1Genomes in bold harbored all the essential biosynthetic genes (lasA, lasB, and lasC) required for lasso peptide production detected by using either BAGEL4 or antiSMASH 5. Number 1 represents the presence of a gene while “0” represents the absence of a gene.

The number of genes and biosynthetic clusters that were predicted in the ruminal bacterial genomes varied according to the computational tool used to screen for the lasso peptides (Figure 1). In total, BAGEL4 predicted putative lasso peptide biosynthetic gene clusters in 109 ruminal bacterial genomes. However, the majority of these genomes (75%) harbored only putative additional genes and genes with no predicted function. These additional genes were identified by BAGEL4 as encoding modification proteins such as GlyS, a glycosyltransferase; regulatory proteins such as LanK, a sensor histidine kinase, and LanR, a transcriptional regulator; immunity/transport proteins such as ABC transporter and transport/leader cleavage proteins as LanT. BAGEL4 also predicted putative coding regions showing similarity to the Ref90 clusters, including kinases and acetyltransferases, in addition to genes with no predicted function (Figure 1). The genes required for lasso peptide production were identified in 27 rumen bacterial genomes using BAGEL4, however, only incomplete gene clusters were detected using BAGEL4 as no lasB gene was identified within these genomes using this computational tool (Table 1). Predictions of BGCs using antiSMASH 5 indicated gene clusters likely to encode lasso peptides in 33 ruminal bacterial genomes with all harboring at least lasA, lasB, or lasC. In 27 (82%) of these genomes, the gene lasD was also detected. These in silico screening approaches combined identified complete lasso peptide gene clusters in 11 rumen bacterial genomes, of which three were harbored by members of the genera Bacillus, Butyrivibrio and Lachnospira, and two in strains of the genus Ruminococcus (Table 1). These results show a higher prevalence and diversity of lasso peptides gene clusters within the Firmicutes phylum, mainly among members of the Lachnospiraceae family (Figure 1).

FIGURE 1

Identification of Lasso Peptide Precursors in the Genomic Regions Surrounding the Biosynthetic Gene Clusters

BAGEL4 and/or antiSMASH 5 were effective to predict coding sequences homologous to the enzymes of the lasso peptide maturation pathway (LasB and LasC). However, the prediction of precursor sequences (LasA) was limited using these computational tools due to the inherent features of these peptides, such as their short length and sequence variability. We therefore investigated the genomic context of the gene clusters aiming to identify potential coding sequences containing the expected features of a lasso peptide precursor. This pattern-based search for novel lasso peptide precursors increased the number of rumen bacterial genomes harboring complete gene clusters to 33, including Acetitomaculum ruminis DSM 5522, Eubacterium cellulosolvens LD2006, two species of Clostridium, two species of Lachnospira, three strains of Lachnospiraceae bacterium and 13 strains of Butyrivibrio.

The genomes of Butyrivibrio sp. NC3005, Butyrivibrio sp. YAB3001, Lachnospira multipara LB2003, Lachnospira pectinoschiza M83, and Lachnospiraceae bacterium YSD2013 showed more than one sequence with homology to the lasA gene and careful examination of all 33 rumen bacterial genomes also indicated distinct sequences in the putative biosynthetic clusters that were likely to encode a lasso peptide precursor in Butyrivibrio sp. AB2020. Additionally, different lasA sequences were predicted in the genome of Ruminococcus flavefaciens 19208 by BAGEL4 and antiSMASH 5. The putative LasA proteins predicted for all the rumen bacterial genomes harboring complete lasso peptides gene cluster are reported in Supplementary Table 4.

Expanding the genomic context analysis beyond the identification of lasA indicated that these biosynthetic clusters have a conserved pattern of genetic organization among groups of phylogenetically related organisms (Figure 2). Alignment of the lasso peptide gene clusters found in Butyrivibrio fibrisolvens indicated that these clusters contain additional genes such as nucleotidyltransferase, HPr kinase/phosphorylase, glycosyltransferase family 2 and EpsH, the sensor histidine kinase ResE and the transcriptional regulatory protein WalR. Other strains of Butyrivibrio sp. and Butyrivibrio proteoclasticus showed clusters containing the sensor protein kinase WalK, the transcriptional regulator SrrA, and the HPr kinase/phosphorylase, in addition to the essential biosynthetic genes. The lasso peptide gene cluster in strains of Lachnospira shared the serine kinase of the HPr protein and the sensor histidine kinase WalK, besides the putative genes encoding LasA, LasB, LasC, and LasD proteins.

FIGURE 2

Among the species of ruminal bacteria, the HPr kinase/phosphorylase, coenzyme PQQ synthesis protein D (PqqD), and an uncharacterized nucleotidyltransferase were found in approximately 58%, 46% and 30% of the genomes analyzed in this study, respectively (Supplementary Figure 2). Moreover, different proteins showing similar functional annotations were found within the lasso peptide gene clusters among these bacterial genomes, including the sensory proteins ResE and WalK, serine kinases, transcriptional regulators (WalR and SrrA) and glycosyltransferases (EpsH) (Supplementary Figure 2).

Sequence Conservation Analysis of the Putative Lasso Peptide Proteins LasA, LasB, and LasC

Analysis of conserved elements in the lasso peptide biosynthesis machinery included LasA-like precursor peptides and proteins homologous to the lasso peptide maturation enzymes (LasB, LasC, and LasD). No conserved motifs were identified in the putative LasA amino acid sequences predicted in the genomes of ruminal bacteria analyzed in this study, indicating that these residues are hypervariable and therefore, subjected to neutral drift. However, genome mining enabled the identification of conserved motifs in homologs of the lasso peptide maturation enzymes LasB, LasC, and LasD, with variable frequency (Table 2). Two conserved motifs were identified in the LasB homologs, including a transglut_core3 motif of the transglutaminase-like superfamily, which is involved in the formation of lasso peptide amide crosslink and was found in 97% of the analyzed LasB proteins. Also, a MdlB motif of an ATPase and permease component of the ABC-type multidrug transport system was detected in the LasB homolog found in the genomes of Ruminococcus albus 8 and Ruminococcus flavefaciens ATCC 19208. In these genomes, the lasB gene appears to be fused with another gene encoding a transporter protein. The MdlB motif was also found in 87% of the LasD homologs predicted in the genomes of ruminal bacteria analyzed in this study, together with five other domains of different ABC-type transporters occurring at much lower abundances. Six motifs were found in the LasC homologs, most of which belong to a conserved protein domain family (asn_synth_AEB superfamily) of the glutamine-hydrolyzing asparagine synthases.

TABLE 2

ProteinConserved motifsAccessionFrequencyCoverage (%)
LasBTransglut_core3pfam1347197%45–100
MdlBCOG11326%100
LasCAANH_like superfamilycl002926%100
asn_synth_AEB superfamilycl3692874%41–100
Asn_Synthase_B_Ccd0199118%100
AsnBcd007126%100
AsnB superfamilycl338526%57–60
Gn_AT_II superfamilycl0031915%73–100
LasDABC_ATPase superfamilycl2540310%98–100
GlnQCOG11263%100
HisMCOG07653%100
MdlBCOG113287%89–100
SunT superfamilycl344553%33
UgpACOG11753%91

Conserved motifs in lasso peptide maturation enzymes (LasB, LasC, and LasD) predicted in the genomes of ruminal bacteria.

Phylogenetic analysis of the predicted LasA precursor peptides grouped the sequences in three phylogroups each consisting of a different number of nodes (Figure 3A). The precursor peptides predicted in the genomes of most Butyrivibrio strains and all members of the genus Lachnospira analyzed in this study could be separated into three main distinct coherent clades. Sequences of lasso peptide precursors in the genomes of the genus Ruminococcus also generated a smaller and consistent clade within these phylogroups, while other sequences were spread throughout the phylogenetic tree. Although the overall amino acid sequence conservation was relatively low, residues located at positions 20–45 and 60–70 in the putative precursor peptides appeared with higher frequencies compared to other regions of the peptide (Figure 3A). As shown for the genomes of Butyrivibrio and Lachnospira, the 20–45 region contains a moderately to highly conserved glycine (G) residue spaced 8–9 positions away from an aspartate (D) residue, which are expected to form an isopeptide bond that installs the macrolactam into the N-terminus of the core peptide (Figures 3B,C). The glycine residue is also preceded at position 17 by a highly conserved threonine (T) residue that is often reported as an invariant residue present at the end of the leader peptides of lasso precursors (; ; , ). Therefore, this pattern of conserved elements in the precursor sequences matches the chemical/structural properties that have been described for known lasso peptides, confirming their essential role in lasso peptide function and thereby ensuring the reliability of our outputs.

FIGURE 3

Phylogenetic analysis of the proteins predicted as homologous of the lasso peptide maturation enzymes demonstrated that amino acid sequences of the LasB and LasC proteins belonging to the genera Butyrivibrio, Lachnospira, and Ruminococcus split into distinct phylogroups within the genomes of ruminal bacteria (Figures 4, 5). Also, sequences of the associated maturation enzymes appeared to be more conserved among the strains of Butyrivibrio fibrisolvens and Lachnospira multipara. The larger distancing of the LasB sequences observed in the clade containing members of the genus Ruminococcus is likely because these protein sequences are fused to a transporter protein.

FIGURE 4

FIGURE 5

Prediction of Putative Lasso Peptide Precursors in the Genomes of Ruminal Bacteria

Combining our sequence conservation analysis of the putative lasso peptide precursors (LasA) with the requirement of specific residues distributed at particular positions in the amino acid sequences of the mature lasso peptides allowed the identification of novel sequences that were likely to be precursor hits in the genomes of ruminal bacteria. In total, thirty-five LasA-like precursors were predicted in 29 genomes of ruminal bacteria investigated in the current study (Table 3). In Butyrivibrio sp. NC3005, Butyrivibrio sp. YAB3001, Lachnospira multipara LB2003, Lachnospira pectinoschiza M83, Lachnospiraceae bacterium YSD2013 and Ruminococcus flavefaciens ATCC 19208, at least two distinct LasA precursors were predicted in each genome. The predicted core peptide sequences indicated that the N-terminal isopeptide-bonded ring is likely to occur between a glycine residue (G) at position + 1 of the core and an aspartate residue (D) positioned 8–9 aa from the beginning of the core. Also, an invariant threonine residue (T) that has been indicated as a recognition element for the lasso peptide maturation enzymes was found at the end of the predicted leader peptide (position -3 from the start of the core). Our analysis also revealed that most of the identified LasA candidates present a highly conserved serine (S) residue in their C-terminal region. The length of the putative core peptide sequences varied from 21 to 42 amino acid residues, according to the sizes of their respective gene coding sequences (Table 3).

TABLE 3

GenomePredicted leader peptidePredicted core peptideCore lenght
Bacillus cereus KPR-7AMKKDWTIPTLEVLDINMTMAGPGLKTPDAVQPDVDEVVHYS21
Butyrivibrio fibrisolvens AB2020MKAWNTPVIETLEINETAAGGRQVTSHDGNIRVDNGIPAEEYLSGPVER29
Butyrivibrio fibrisolvens AR40MKVWNAPVMESLEINETAKGGKKVSEHDGFINYSHNGLPAEEYASGPVAK31
Butyrivibrio fibrisolvens DSM 3071MKAWNTPVMESLEINETAGGYNQITEHDGVINYSAGIPAEEYASGPLPR30
Butyrivibrio fibrisolvens MD2001MKVWNAPVMESLEINETAKGGKKVSEHDGFINYSHNGLPAEEYASGPVAK31
Butyrivibrio fibrisolvens WTE3004MKAWNTPVIETLEINETAAGGRQVTSHDGNIRVDNGIPAEEYLSGPVER30
Butyrivibrio fibrisolvens YRB2005MKAWNTPVIETLEINETAAGGRQVTSHDGNIRVDNGIPAEEYLSGPVER30
Butyrivibrio proteoclasticus B316MKNWNAPEIKELCLSGTQQHGTPNPYVDGKIYDAQRNENWFTFSGNNVDDTATPGEVIIGNP42
Butyrivibrio proteoclasticus FD2007MKNWNTPEIKELSLSGTQLHGQDVRFVDGSIYDEERNTNWASYSGGRPNRDEQPGEVIIH40
Butyrivibrio sp. FC2001MKKVWNDATLEALDITATAGGIYDTEELDSEKWFDEEHKQWWGSFGNNNLSKAKKED37
Butyrivibrio sp. INlla14MKTWNSAEIVELALNQTAGGSFDITTHDGKIVYTTLANGRQVPSEQYAYVSGEQHA37
Butyrivibrio sp. MC2021MKNWNAPEIQELNLSNTELGNRRSGYCDAAVWSVELHKNFYSYSGEGDPNEDEWNVHPQH41
Butyrivibrio sp. NC3005 (#1, #2)MKWNAPVMEELNINATANGMAPDENFDGDWVEINGKWYRPGNGSVSGGEIAQ34
Butyrivibrio sp. NC3005 (#3)MKWNAPVMEELNINATANGMAPDENFDGDWVEINGRWYRPGNGSISGSETAH34
Butyrivibrio sp. VCD2006MKKWNAPNIQELNLSSTMLRGRNPKYVDGYVYDAERDTNWASYSGGTSDPSATGAEVIINNP42
Butyrivibrio sp. XBB1001MKTWTSPEIKELNISNTALGNARSGYCDAAVYSIELHRNFYSFSGEGEKNQDDWHVTPQNP42
Butyrivibrio sp. XPD2006MKTWVNPEVVELEISATAQGDGPIAIPDAIRVDNDGTWYSFPSGSSQDAQ31
Butyrivibrio sp. YAB3001 (#1)MKTWLDAVIEEINFEKTEDGRSEKLDNDRQYTDGRGLAIQLGGHLS27
Butyrivibrio sp. YAB3001 (#2)MKAWNTPVIEEVKFTATKEGSQQWQVPDKHYLDETDNQWKWEFSDGKLN30
Clostridium beijerinkii HUN142MNETKLKWSEPEVMDLSVKDTQLGGHYSSSPDGAPWQDSNGNWQEPHGKS18
Eubacterium celullosolvens LD2006MKKWVNPEFKVLNISKTTYGPWNQTIPDSELTAEFDEFGNVKGYRQLFGQASGTTGETGTPAV44
Lachnospira multipara D15dMKTWITPRVEELEIVETAQGKSIKPSFDAFRIDENGNLWASFES25
Lachnospira multipara LB2003 (#1)MRTWTKPEVEVLAIAETAQGKVIKASFDAIRTDVNGNLWVSFPSGAEE28
Lachnospira multipara LB2003 (#2)MKTWITPAVEELEIVETAQGKNIKPSFDELRVDANGNLWASFQS25
Lachnospira multipara MC2003MKTWITPAVEELEIVETAQGKNIKPSFDELRVDANGNLWASFQS25
Lachnospira multipara ATCC 19207MKTWITPRVEELEIVETAQGKSIKPSFDAFRIDENGNLWASFES25
Lachnospira pectinoschiza M83 (#1)MKTWTKPELEVLAIEETAQGKVIKPSFDSVRTDENGNLWASFPSGAEE29
Lachnospira pectinoschiza M83 (#2)MRTWTTPELEVLEITETAQGKVIKASFDAIRTDENGNLWVSFPSGAED29
Lachnospiraceae bacterium KH1P17MRKWNTPELQELAINATAGGPQDNHTEDGKTVYDHEENAWYHRFGEDGNYTRN34
Lachnospiraceae bacterium MA2020MKSWNTPAIEELNINETAGGGQKTMNWDGEWITPDEGKSWWAGTVIVSG30
Lachnospiraceae bacterium YSD2013 (#1)MKKFEVAELVVLNIADTAFGPDDPNHVDDYKHAVEDPITHEVLGYEEEYGQAHSSNQN39
Lachnospiraceae bacterium YSD2013 (#2)MKKFVNADIQEVAIEETAFGPLNPEDVDETKYAVTDEEGNIIGYRAKFGKADASRQ37
Ruminococcus albus 8MTYNKPSFEKISSFKESTMGVWFGKFKDIFGGKAVVEIVIYY23
Ruminococcus flavefaciens ATCC 19208 (#1)MTYNKPSVEKVASFKDNTMGLWYGKFRDIFGAKTYFNLAWN22
Ruminococcus flavefaciens ATCC 19208 (#2)MTYNKPSFEKVASFKNKTMGLWFGNFKDLFGGKIYIALSPAW23

Amino acid sequences of putative lasso peptide precursors predicted in the genomes of ruminal bacteria.

The precursor peptides are composed by the leader peptide + core peptide. Letters in bold represent conserved amino acid residues in the leader and core peptides involved in the maturation or post-translational modification of the lasso peptides. Numbers inside brackets were added when more than one LasA sequence were found in the same genome.

Expression Analysis of Putative Lasso Peptides Biosynthetic Genes in Ruminal Metatranscriptome Datasets

Expression of the putative lasso peptide precursors and associated maturation enzymes were generally low in the ruminal metatranscriptome datasets, varying from 0.01 to 4.26 reads per kilobase per million of mapped reads (RPKM). Nonetheles, the expression levels differed between the genes lasA, lasB, and lasC and the number of mapped reads also varied among the datasets of beef cattle, dairy cattle, and sheep examined in the current study. Overall, only reads corresponding to the genes lasA, lasB, and lasC of Ruminococcus albus 8 were represented simultaneously in at least two datasets under study (SRR873462 and SRR873454).

The gene lasC showed the highest number of reads mapping to a putative lasso peptide biosynthetic gene within the active ruminal microbial community, being detected in 13 out of the 15 datasets (Figure 6C). Only reads mapping to the lasC gene of Lachnospira multipara D15d, Clostridium butyricum AGR2140, and Ruminococcus albus 8 were represented in the rumen of beef cattle, while for dairy cattle datasets, the mapped reads represented the lasC gene found in Butyrivibrio proteoclasticus B316, Lachnospira multipara D15d, and two species of Clostridium. The lasC gene also appears to be more broadly expressed in the ruminal metatranscriptomes of sheep, as reads of the genes that were found in eight bacterial genomes mapped to at least one out of the five datasets analyzed. Moreover, the expression of the lasC gene found in Clostridium butyricum ARG2140 and Lachnospira multipara D15d occurred across all the dataset groups (beef cattle, dairy cattle, and sheep) evaluated in the current study.

FIGURE 6

Reads mapping to the predicted lasA genes showed higher average RPKM values among the metatranscriptomes evaluated in the current study (Figure 6A). The highest RPKM value (4.26) was observed for reads mapping to the lasA sequences of Butyrivibrio proteoclasticus B316 in a beef cattle metatranscriptome. Only lasA reads from Butyrivibrio sp. XPD2006 and Lachnospiraceae bacterium YSD2013 (#1) were aligned to the dairy cattle metatranscriptomes. In the active ruminal microbial community of sheep, reads representing the lasA sequences of Lachnospira multipara D15d and Ruminococcus albus 8 mapped to two and three of the datasets under study, respectively.

Among the essential genes of the lasso peptide biosynthesis machinery, the genes corresponding to the maturation enzyme lasB were the least expressed across all the ruminal datasets examined in the current study. Only the reads corresponding to the lasB gene of Bacillus sp. MB2021 and Ruminococcus albus 8 could be mapped to a ruminal metatranscriptome, with the majority of the sequences aligned in the dairy cattle and sheep datasets (Figure 6B).

Discussion

Lasso peptides represent a group of ribosomally synthesized and post-translationally modified peptides (RiPPs) with unique topology and diverse biological activities. The discovery of new lasso peptides may be hindered by the great sequence variation of these molecules. Previously, we applied genome mining approaches to explore the ruminal environment as a potential source of bacteriocins (), and non-ribosomal peptides and polyketides (). Here, we performed an extensive in silico screen in publically available genomes of ruminal bacteria in an attempt to determine the prevalence and diversity of lasso peptides among major species of bacteria from the rumen. Additionally, we sought out to predict potentially novel lasso peptides in the genomes of different members of the rumen microbiome, thus guiding the future identification and characterization of these antimicrobial peptides in ruminal bacteria through in vitro studies.

The genetic screening using antiSMASH 5 and BAGEL4 revealed putative clusters for lasso peptides biosynthesis in 34 ruminal bacterial genomes, representing 8% of the total analyzed. From these, only 11 genomes presented clusters harboring all the essential genes of the biosynthesis machinery of lasso peptides, while in the other genomes the biosynthetic clusters were incomplete. However, after manually curating the genomic context of the incomplete gene clusters, thirty-three rumen bacterial genomes were found harboring complete lasso peptide clusters, confirming the limitations of using homology search tools to identify these biosynthetic genes through automated mining of complete and draft genomes. It should be emphasized, however, that both antiSMASH 5 and BAGEL4 are valuable tools for analyzing and identifying biosynthetic gene clusters in microbial genomes due to their intrinsic processivity, which allows fast screening of multiple datasets of genomic sequences. Nonetheless, computational tools may be limited by inherent constraints of their search algorithms, representativeness of the databases, and by singularities of the lasso peptide gene clusters, such as their small sizes and hypervariability of the precursor gene sequences (). Therefore, the examination of the genomic context flanking the essential genes may be a useful approach to refine pattern-based genome mining.

Lasso peptide production has been mainly associated with members of the phyla Actinobacteria and Proteobacteria and the best-studied molecules of this family are produced by representative species within these phyla (; ; ; ; ; ; ; ). Moreover, genome-guided studies focused on natural product discovery often point to these bacterial phyla as promising sources of lasso peptides (; ; ). However, our results indicate that genera of the phylum Firmicutes are probably the main producers of lasso peptides in the rumen environment, revealing these taxa as potential sources of new lasso peptides. These results are in agreement with a genome-guided exploration of the GenBank database, which highlighted the phyla Firmicutes, Cyanobacteria, Euryarchaeota, and Bacteroidetes as underexplored sources of lasso peptides (). The higher prevalence of lasso peptide gene clusters within the phylum Firmicutes reported in this study must take into account the abundance of sequenced genomes compared to other phyla of ruminal bacteria. Nonetheless, the presence of complete biosynthetic clusters observed in multiple strains of the phylum Firmicutes may increase the interest in exploring members of these taxa to accelerate the discovery of new bioactive molecules through in silico analyses and in vitro experimentation.

Analyses of the genomic context allowed the identification of additional co-occurring genes frequently found associated with the lasso peptide biosynthetic gene clusters, such as kinases, glycosyltransferases, and nucleotidyltransferases (; ; ). These co-occurring genes provide additional evidence of the probable functionality of the gene clusters identified in the rumen bacterial genomes and their association with the essential biosynthesis genes appears to be characteristic among species of the phylum Firmicutes (). Some of the additional genes flanking the biosynthetic clusters encode tailoring enzymes that introduce chemical modifications to the lasso peptides, including covalent modifications in their C-terminal region, such as phosphorylation (), methylation () or acetylation (). For example, HPr kinases found in Paenibacillus dendritiformis C454 are capable of modifying a C−terminal Ser in the lasso peptide precursor by adding one or more phosphate groups (). In Bacillus pseudomycoides DSM 12442, producer of pseudomycoidin, the presence of the PsmN, a nucleotidyltransferase, was associated with the glycosylation of the C-terminal region (). The advantages that these chemical modifications offer to the lasso peptides remains unclear, but they may affect peptide stability (), regulate critical processes, such as signaling pathways () or influence the functioning of self-immunity systems in the producer cells (; ).

A gene encoding a protein belonging to the PqqD enzyme superfamily frequently co-occurred with the lasso peptide biosynthesis genes in species of the genera Butyrivibrio and Lachnospira. It has been previously reported that the maturation enzyme B can be split between two separate open reading frames (proteins B1 and B2), and this genetic configuration seems a common feature in the lasso peptide gene clusters found in Gram-positive bacteria (; ). Protein B1 is annotated as a homolog of the PqqD enzyme superfamily (; ), and acts as a RiPP recognition element that binds the leader peptide and delivers the precursor for processing, while protein B2 is homologous to the transglutaminases and is responsible for the processing of the precursor peptide.

The predicted products of the putative biosynthetic genes detected by antiSMASH 5 and BAGEL4 were subjected to motif analysis and results demonstrated that the LasB homologs found in the rumen bacterial genomes harbor conserved motifs of the transglutaminases family, while the predicted LasC homologs contain consensus motifs of the asparagine synthetase family. These analyses are in agreement with the genome mining data and provide evidence for the presence of conserved catalytic domains on the enzymes of the lasso peptide maturation pathway. The transglutaminases belong to a large family of cysteine proteases capable of catalyzing the formation of amide crosslinks (). These enzymes contain the Cys-His-Asp catalytic triad in their active site, which is conserved among the McjB and McjB-like proteins from various bacteria (). Evidence of this catalytic triad was also found on the LasB homologs predicted in the genomes of rumen bacteria investigated in the current study, being particularly conserved in species of Butyrivibrio (Supplementary Figure 3). In the species of Ruminococcus, the LasB homologs contained a fused ABC-transporter domain, a feature that has been previously described for other maturation enzymes of this group (; ).

The phylogenetic analysis of the putative proteins encoded by the lasA, lasB, and lasC genes revealed monophyletic branches composed of strains of the same genera/species. Additionally, the genomic context analysis indicated that the lasso peptide clusters of phylogenetic-related bacteria show the same patterns of genetic organization and considerable conservation of the biosynthetic genes, suggesting that the lasso peptide biosynthetic genes can be inherited vertically, as proposed previously ().

Determination of putative lasA genes can be performed screening short ORFs flanking the biosynthetic genes and considering the requirement of specific amino acids at particular positions of the peptide precursor for the macrolactam ring formation (; ). Besides, our pattern-based genome mining considered the high conservation of the amino acids involved in the amide bond and the genomic context conservation of the lasso peptide clusters. It has been demonstrated that despite the high sequence variation within the structural gene lasA, the amino acids that are involved in the formation of the macrolactam ring are conserved across different species of bacteria (; ). The presence of a conserved threonine residue near the cleavage site of the leader peptide may be required for the recognition and binding of the protease, which seems a crucial event for the effective processing of some lasso peptides precursors (; ; , ). Phylogenetic analysis of the LasA sequences found in ruminal bacterial genomes confirmed the conservation of these nearly invariant amino acid residues providing further evidence that they may be related to the lasso peptide function even though some of the sequences were larger than expected. Moreover, phylogenetic analysis of known lasso peptides and the core peptide sequences described in the current study (Supplementary Figure 4) reinforces the novelty of the LasA-like sequences discovered in the genomes of ruminal bacteria, since the sequences diverged from a common ancestor when compared to the clades that grouped other lasso peptide families.

Some of the bacteria identified in the current study carrying a putative gene cluster for lasso peptide production are also potential producers of other antimicrobial compounds. For example, Ruminococcus albus 8 produces an antagonistic thermostable substance capable of inhibiting Ruminococcus flavefaciens (). In addition, two gene clusters of sactipeptides and one cluster of a class III bacteriocin were found in Ruminococcus albus 8 (). Bacteriocin gene clusters were also identified in the genomes of Butyrivibrio fibrisolvens MD2001, Butyrivibrio proteoclasticus B316, Butyrivibrio proteoclasticus FD2007, and Lachnospira multipara MC2003 (), while genes associated with the biosynthesis of non-ribosomal peptides (NRP) and polyketides (PK) were reported in the genomes of Bacillus cereus KPR-7A and Clostridium beijerinckii HUN142 (). Altogether, the presence of gene clusters encoding for distinct classes of antimicrobial compounds in ruminal bacteria suggest the importance of these molecules in the rumen ecosystem and highlight their potential applications in controlling undesirable bacteria.

The genes considered essential to lasso peptide biosynthesis showed a low level of expression in the ruminal metatranscriptome datasets and were more expressed within the microbial community of the sheep rumen, which is in agreement with our previous observations indicating that non-ribosomal peptide synthetases (NRPS) and polyketide synthases (PKS) were also more abundant in the rumen microbiota of sheep (). Additionally, the reads corresponding to the genes found in Butyrivibrio sp., Lachnospira sp., and Ruminococcus sp. were most represented in the sheep metatranscriptomes, also confirming previous observations showing a higher prevalence of NRPS and PKS within members of these ruminal taxa (). Taken together, these results demonstrate the potential production of antimicrobial compounds by species of bacteria colonizing the rumen of sheep, which deserves further investigation.

The metatranscriptome analysis also revealed differences in the expression level of the essential lasso peptide biosynthetic genes (lasA, lasB, and lasC). Reads mapping simultaneously to all three essential genes was only observed for Ruminococcus albus 8 in two datasets from sheep, indicating that in these microbial communities complete biosynthesis machinery could be generated for lasso peptide production. Overall, reads mapping to the putative LasA precursors were more abundant than reads mapping to the maturation enzymes LasB and LasC. These differences may be due to regulation at transcriptional level controlling the gene expression, differences in RNA stability, or other mechanisms that are known to affect the biosynthesis of antimicrobial peptides and other natural products (; ).

The genome mining of lasso peptide biosynthetic clusters in genomes of ruminal bacteria confirmed that in silico screening is a fast, effective, and less expensive approach for discovery of these antimicrobial peptides. However, future research should further develop and confirm these initial findings through experiments designed to validate in vitro the production of lasso peptides by ruminal bacteria or heterologous expression of the predicted lasso peptides and to demonstrate their biological activity. Nonetheless, these computational analyses allow to narrow down substantially the genera/species potentially producing lasso peptides in the rumen ecosystem, thus guiding future culture-based efforts. Besides, the peptides predicted in the genomes of ruminal bacteria can serve as scaffolds to develop derivatives with improved antimicrobial activity, stability to proteases and lower cytotoxicity (; ), through chemical synthesis or heterologous expression without the need of culturing the producer organism. Overall, our results reveal that ruminal bacteria harbor the genetic arsenal necessary for the production of several not yet described lasso peptides. The discovery of new peptides from ruminal bacteria reinforces the potential of the rumen microbiome as an important source of secondary metabolites that require future characterization.

Statements

Data availability statement

The datasets presented in this study can be found in online repositories. The names of the repository/repositories and accession number(s) can be found in the article/Supplementary Material.

Author contributions

HM, FA, SH, and TM conceived the project. YS, KA, TL, FA, TM, and SM performed the data analysis and interpretation of results under the supervision of HM. YS, KA, and HM wrote the manuscript. All authors read and approved the final manuscript.

Funding

This work has been supported by the Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES; Brasília, Brazil, Proex PPGMBA/UFV, Grant Number 0001), Fundação de Amparo a Pesquisa do Estado de Minas Gerais (FAPEMIG; Belo Horizonte, Brazil), and the Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq; Brasília, Brazil). We also thank the RCUK Newton Institutional Link Funding (172629373) and the INCT Ciência Animal.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2020.576738/full#supplementary-material

References

Summary

Keywords

precursor sequence, RiPPs, rumen, Butyrivibrio, antiSMASH 5, BAGEL4

Citation

Sabino YNV, Araújo KC, Assis FGV, Moreira SM, Lopes TS, Mendes TAO, Huws SA and Mantovani HC (2020) In silico Screening Unveil the Great Potential of Ruminal Bacteria Synthesizing Lasso Peptides. Front. Microbiol. 11:576738. doi: 10.3389/fmicb.2020.576738

Received

26 June 2020

Accepted

17 August 2020

Published

11 September 2020

Volume

11 - 2020

Edited by

Harsh Mathur, Teagasc, Ireland

Reviewed by

Piyush Baindara, University of Missouri, United States; Takeshi Zendo, Kyushu University, Japan; Nicholas Heng, University of Otago, New Zealand

Updates

Copyright

*Correspondence: Hilário C. Mantovani,

This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics