REVIEW article

Front. Bioeng. Biotechnol., 04 January 2023

Sec. Biomaterials

Volume 10 - 2022 | https://doi.org/10.3389/fbioe.2022.1100365

Peptide-based coacervates in therapeutic applications

  • 1. CAS Key Laboratory of Biological Effects of Nanomaterials and Nanosafety, CAS Key Laboratory of Standardization and Measurement for Nanotechnology, CAS Center for Excellence in Nanoscience, National Center for Nanoscience and Technology, Beijing, China

  • 2. University of Chinese Academy of Sciences, Beijing, China

Abstract

Coacervates are droplets formed by liquid‒liquid phase separation. An increasing number of studies have reported that coacervates play an important role in living cells, such as in the generation of membraneless organelles, and peptides contribute to condensate droplet formation. Peptides with versatile functional groups and special secondary structures, including α-helices, β-sheets and intrinsically disordered regions, provide novel insights into coacervation, such as biomimetic protocells, neurodegenerative diseases, modulations of signal transmission, and drug delivery systems. In this review, we introduce different types of peptide-based coacervates and the principles of their interactions. Additionally, we summarize the thermodynamic and kinetic mechanisms of peptide-based coacervates and the associated factors, including salt, pH, and temperature, affecting the phase separation process. We illustrate recent studies on modulating the functions of peptide-based coacervates applied in biological diseases. Finally, we propose their promising broad applications and describe the challenges of peptide-based coacervates in the future.

1 Introduction

Liquid‒liquid phase separation (LLPS) is the foundation for the generation of membraneless organelles (Aumiller et al., 2016; Gaur et al., 2022), leading to unique regions and compartments in cells, such as the nucleolus and Cajal bodies in the nucleus and stress particles and P granules in the cytoplasm. Multivalent interactions are the main driving force for LLPS. Phase separation participates in several functional biological activities (Nakashima, et al., 2019), such as DNA damage repair (Patel et al., 2015), signal transmission (Sabari et al., 2018), gene expression and modulation of peptide assembly (Bari and Prakashchand, 2021).

With high loading efficiency via electronic interactions, excellent biocompatibility, membrane permeability, and low cytotoxicity (Xiao et al., 2020; Shirzadian et al., 2021), coacervates have more extraordinary advantages than traditional nanoparticles (Jo et al., 2019). Coacervates have already been confirmed to be utilized as a protein delivery system to accelerate skull bone regeneration (Kim et al., 2018), tumor treatment (Liu, et al., 2022) and neurodegenerative diseases (Wu et al., 2018). Moreover, coacervates formed by histidine-rich beak protein derivative peptides can not only deliver macromolecules into cells but also protect mRNA from degradation (Sun et al., 2022). Therefore, coacervates would be considered as delightful therapeutic agents, especially in drug delivery systems, tissue regeneration and biomimetic protocell (Matveev, 2019).

Overall, various polymers participate in the coacervation process, such as proteins, nucleic acids, and polysaccharides. In particular, intrinsically disordered regions (IDRs) are a common component driving phase separation, which provides a foundation for peptides to be potential candidates for coacervates. Peptides and their derivatives are involved in phase separation and they are easily synthesized, accessibly designed and highly produced, which would be an ideal model for experiments.

Peptides have a simple backbone chain and various functional groups in their side chains, contributing to the molecular self-assembly (Liu, et al., 2021). They can form special structures, including fibers, nanotubes, nanowires, etc. In addition, hydrophobic interactions and hydrogen bonding in peptide chains contribute to special conformations, such as α-helices and β-sheets, leading to peptide self-assembly and complex assembly (Zhou et al., 2017). Peptide assembly are closely related to many intractable diseases (Yu et al., 2017) and involved in many processes of constructing supramolecular structures and nanomaterials (Zheng et al., 2019). Due to the advantages of their structures, peptides are sensitive to external stimuli. Their structure contains different moieties that contribute to multiple intramolecular and intermolecular interactions through several conditions, leading to phase separation. Additionally, in phase separation, peptides can form coacervates by self-assemblies or complexes with other components due to their special sequences. Modulation of peptide assembly through ion strength, pH, and temperature would be conducive to forming droplets, which has attracted increasing attention to peptide-based coacervates (Sheehan, et al., 2021). Moreover, numerous studies have focused on the interactions in phase separation droplet. It is crucial to investigate intramolecular and intermolecular interactions between peptides and other peptides with different sequences, and also other molecules such as nucleic acids, and polysaccharides, which contributes to important physiological functional LLPS.

In this review, we focused on peptide-based coacervates, which are considered to have novel therapeutic applications (Figure 1). First, we introduced the background of condensates and provided the main driving forces for the coacervates. Additionally, we explored the influencing factors that contribute to coacervation, such as ionic strength, pH, temperature, and thermodynamic principles. According to recent studies, we sorted the peptide-based coacervates into different types based on their interaction components. Mainly, we discussed the peptide-peptide interactions, peptide-DNA interactions, peptide-RNA interactions, and peptide-polysaccharide interactions leading to liquid‒liquid phase separation and coacervates formation. Finally, we demonstrated examples of therapeutics, which is probably a significant step toward the development of novel applications in therapies.

FIGURE 1

2 Peptide-based coacervates

Numerous reports have demonstrated that peptides are able to enter a dense liquid phase from a dispersed solution. Peptides form different structures in a dense liquid phase due to the various participants. It could be a simple coacervate formed by only one peptide but it could also be a complex coacervate that may contain peptides, nucleic acids or polysaccharides. The participants affect the properties of the coacervates as well as their applications.

2.1 Peptide-peptide coacervates

Peptide-peptide coacervates can be divided into two types: simple coacervates, which are composed of only monomeric peptides, and complex coacervates, which are composed of two different types of peptides.

Self-coacervate peptides are important components of underwater adhesives, drug delivery systems and even the origin of life, although they are usually not native peptides or proteins. Studying artificially designed self-coacervate peptides provides evidence of the influence of the primary amino acid sequence or composition on coacervation (Wei et al., 2016). In addition, self-coacervation could be a reasonable model for studies of the origins of life. A Summary of self-coacervate peptide is showed in Table 1.

TABLE 1

PeptidesSequenceNotably detailsReferences
DgHBP-2GHGVYGHGVYGHGPYGHGPYGHGLYWglucose-responsive insulin delivery system; encapsulated with magnetic nanoparticles and Doxorubicin(Dox) as a liver cancer treatmentLim et al. (2018), Lim et al. (2020)
mfp-3S-pepGYDGYNWPYGYNGYRYGWNKGWNGYSystemic underwater adhesiveKaminker et al. (2017), Wei et al. (2016)
ATBPSKGPG(AGVPG)160(YG)6(CGG)8WPDelivery system for hydrophilic small molecules like water-soluble drugs and imaging agentsBhattacharyya et al. (2017)
vRAGE-ELPMAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGGGGSGGGGSGGGGSHMGPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGCGVPGVGVPGVGVPGVGVPGVGVPGCGVPGVGVPGWPTSQPELAPEDPEDVEHHHHHHPromising therapy for diabetic woundKang et al. (2021)
NTA-Fn(FPGVG)nn = 3 or 5Potential strategy of capturing heat-responsive molecule and metal-scavenging agentsSuyama et al. (2021)
I-ELP(VPGVG)120(GY)7Application for intratumoral radiation therapySchaal et al. (2016)
YFsFYYFsFYTyrosine rich short peptide was controlled by pH window and enable oxidative crosslinkingAbbas et al. (2022)
SUP(VPGXG)nSupercharged ELP derived peptide improve wound healing and skin regenerationSun et al. (2021)
X=lysine (K) or glutamic acid (E)
3KV84MGKKKP (VPGVG)14 (VPGVG)14 (VPGVG)14 (VPGVG)14 (VPGVG)14 (VPGVG)14Amino-acid side chains had different sensitivity to the coacervationSingh et al. (2016)
DCHPIC(MOA)155E30Form a new supermolecules morphology in polyion complexSun et al. (2017)
(MOA)156E27
(MOA)=poly(Lmethionine sulfoxide-stat-L-alanine)
LVFFAR9LVFFAR9 + ATPInvestigated the properties supermolecule amyloid coacervatesJain et al. (2022)
Dendritic ELP(GLPGL)nStructure-property relationships of dendritic ELPNavon et al. (2016)
ELP-1GPG(VPG[V5G3A2]G)150WPLoaded Dox to temperature-sensitive targeted deliveryZai-Rose et al. (2018)
F5H-(FPGVG)5-OHEffects of aromatic amino acids on ELPSuyama et al. (2022)
ELP3AAAAAKAAKYGA [(GVPGV)7 AAAAAKAAKYGA]3A new generation method for elastic fiberLau et al. (2022)
PDOC or PDLOCpoly(D -ornithine-co-citrulline)Stereoregularity influences UCST behaviorsKuroyanagi et al. (2019)
poly(DL -ornithine-co-citrulline)
PEG-ELPMASMTGGQQMG-HHHHH-DDDK-LQ[LDAS-TVYAVTGRGDSPASSAA-SA((VPGIG)2VPGKG(VPGIG)2)3VP]4LEPEG enhanced ELP’s ability of release, hydrogel storage and optical densityMeco and Lampe (2019)
ELP-CLP(GPO)8GG, (VPGYG)y(VPGFG)xGInfluence of tyrosine residues in ELPTaylor et al. (2020)
ELP-collagen(VPGVG)120A new biopolymer combined ELP with collagen to considered as collagen scaffoldsAmruthwar et al. 92013)
REP(TGPG [VGRGD(VGVPG)6]20WPCEnhance the insulin secreting abilityLee et al. (2019)
ELP[M1V3-40]MW[VPGVGVPGMG(VPGVG)2]40As an artificial IDR model to investigate temperature-responsive organelle-mimicsZhao et al. (2021)
ELP90(Val-Pro-Gly-Xaa-Gly)90Transmission of ELP may not relate to residue structureSelig et al. (2018)
Xaa=Val, Leu, and Gly in a 5:2:3 ratio
SOP-IDPGVGVPNew mimic model for the thermal compactions in dominantly hydrophobic IDPsBaul et al. (2020)
SAPAEAEAKAKAEAEAKAKPossess fibrillization properties and an Fc-binding function as antibody delivery systemPham et al. (2019)

Summary of self-coacervate peptide.

One of the most common studied peptides is mussel foot protein homolog peptide, inspired by the fact that mussels secrete a complex fluid that consists of underwater adhesive proteins. The mussel foot protein homolog peptide has strong potential for applications in bioadhesive materials in liquid environments. Kaminker et al. reported the unique development of synthetic underwater adhesives (Kaminker et al., 2017). They focused on a single mussel foot protein-3S homolog peptide that displayed suitable properties for underwater adhesives due to the combined contributions of hydrophobic, hydrogen bond, van der Waals and electrostatic interactions that are toggled by the pH and temperature. The UCST behavior proved that the interactions formed the coacervate instead of increasing the entropy in this system.

Wei et al. (2016) designed mfp-3S-pep (GYDGYNWPYGYNGYRYGWNKGWNGY) that enables the formation of simple component coacervates at suitable pH values and salt concentrations. They demonstrated that a high ionic strength and a high pH value would promote the transition from a solution to coacervation. The increase in hydrophobic interactions and short-range electrostatic attraction led to the net attraction of the peptide chain. 3,4-dihydroxy-l-phenylalanine (Dopa), known as an important structure of mussel adhesive protein, was incorporated into mfp-3S-pep to increase its adhesive ability. It has been proven that Dopa enhances the hydrophilicity of peptides and intramolecular interactions due to the H-bond between Dopa and the amino residue. With Dopa functionalization and coacervation, mfp-3S-pep was allowed to adsorb on a rough surface under solution conditions, which could be considered an inspiring development for synthetic adhesives in aqueous environments.

It has been proven that under suitable conditions, a single peptide enables proliferation, self-assembly and the formation of droplets through liquid‒liquid phase separation in solution, and the droplets have a stable growth-division period via autocatalytic self-reproduction (Matsuo and Kurihara, 2021). They demonstrated that the droplets would continuously grow with the addition of DTT and a disulfide precursor of monomer (Mpre) (nutrition). The size of the coacervates increased from approximately 40 nm to a very large size after 24 h, which proved that the LLPS-formed coacervates aggregated with time. They also illuminated that recursive growth and division were occurring by observing the diameters of the droplets at different times. They evaluated six periods that added Mpre and then the newly formed coacervates extruded via a syringe. They found that from the second to sixth cycle, the size of the droplets at the beginning and the end were basically the same, while the growth process of the coacervate was not influenced. The photos from DIC microscopy showed that the recursive patterns of the changes in the diameters and the proliferation of the particles were combined with self-production and subsequent fusion. This meant than in response to the nutrition addition and extrusion, the coacervate experienced a recursive growth-division process. The coacervate formed by the monomer peptide was probably involved in the origins of life and may also be a possible candidate for the development of a self-sustainable material.

Elastin-like peptide (ELP) is another self-coacervate peptide that has attracted a lot of attention (Rodriguez-Cabello et al., 2018). ELP, a derivation of the hydrophobic domain of tropoelastin, is made of repeated units of Xaa-Pro-Gly-Xaa-Gly, where X could be any amino acid except proline (Navon et al., 2016). Due to its thermally responsive capability, it would be an ideal drug delivery system for cancer treatment (Despanie et al., 2016; Bhattacharyya et al., 2017), wound healing (Kang et al., 2021) and metal scavenging agents (Suyama et al., 2021).

To construct a highly reliable and effective therapeutic cancer treatment, an ELP-formed drug delivery system has been utilized for several different types of tumors (Schaal et al., 2016). The ELP (the peptide sequence (VPGVG)120 (GY)7) formed a thermally triggered micelle to overcome the limitations of the thermosensitive radionuclide polymer to form a potential brachytherapy delivery agent with low off-target toxicity. The coacervate-loaded β-emissions of 53131 I would be triggered by body temperature to transform into an insoluble viscous coacervate, which would provide a strong and protected radionuclide. The radioactivity of 53131 I remained above 52% and 70% in prostate and pancreatic tumor models, respectively, after 60 days of treatment without obvious radioactivity accrual. In a prostate mouse model, the tumor was dramatically reduced, and the volume of the tumor was less than 5% of its original volume. The same effect was reported for a pancreatic BxPc3 luc mouse model. After only 7 days, the growth of the tumors was strikingly limited, and the volume of the pancreatic tumors was less than 300 mm3 after the treatment was completed. Compared with the surgery group, the brachytherapy treatment group showed little body weight loss, which proved the excellent biosafety of ELP micelles. The smart thermal response mechanism suggests a wide and potential therapeutic future for ELPs.

Peptide-peptide coacervates can be formed by two different charged peptides, poly-lysine and poly-glutamate, whose electronic interactions are their main driving force (McCall et al., 2018). However, hydrogen bonding, chirality, hydrophobicity, the length of the peptide chain, the charge density and the chemical properties of the functional groups are important. A summary of peptide-peptide coacervates is exhibited in Table 2. Tabandeh and Leon, (2019) reported coacervates formed by polycations and polyanion peptides. They exchanged the peptide sequences of D- and L-chiral patterns of lysine or glutamic acid for glycine, alanine or leucine. They demonstrated that with increasing hydrophobicity of the peptides, the loading efficiency of coacervates that worked as a novel drug delivery system was significantly enhanced.

TABLE 2

PeptidePeptideNotable detailsReferences
poly-L-lysinepoly-(L,D)-glutamic acidSelf-assembling polypeptide coacervates to investigate the partitioning of cytoskeletal protein actin into liquid polymer rich dropletsMcCall et al. (2018)
V96humanin peptideHumanin peptide assembled with ELP to protect human retinal pigment epithelium cells from deathLi et al. (2020)
É£-poly-glutamic acidÉ›-poly-L-lysineOral deliveryMuriel Mundo et al. (2020)
TDP-43 CTDGRN-5Verify GRN participated in autophagy of TDP-43 in redox conditionBhopatkar et al. (2020)
Poly(L-lysine hydrochloride)poly(L-glutamic acidSystematic research of the interfacial energy in coacervatesPriftis et al. (2012)
sodium salt)
Poly(g-3-(4-(guanidinomethyl)-1H-1,2,3-triazol-1-yl)propyl-l-glutamate (PPLGPG)50PolyGlu50The influence of α-helix in coacervatesPriftis et al. (2015)
PLys50

Summary of peptide-peptide coacervates.

2.2 Peptide-DNA coacervates

Single stranded DNA (ssDNA) and double stranded DNA (dsDNA) exhibited strikingly different behaviors in complex with a polycation peptide. Compared with dsDNA, ssDNA is a shorter, more flexible and hydrophobic polymer with a lower charge density. These factors have strong effects on the formation of coacervation (Vieregg et al., 2018). A summary of peptide-DNA coacervates is showed in Table 3.

TABLE 3

Peptide sequenceDNA nameApplicationReferences
CKKKHHHHKKKCpEGFP-C1Environment sensitive gene delivery systemWang et al. (2020)
(RRLR)6-SSSGSS21-mer single-stranded oligonucleotides of random sequenceMechanism of regulating membranless organelle and living cellsBai et al. (2021)
Polylysine5’-TGAACTAACG-3’Dynamic regulate the reactions of LLPSWee et al. (2021)
(KG)15 and (KGG)105’-TCAACATCAGTCTGATAAGCTA-3’Sequence-specific hybridization controlVieregg et al. (2018)
LLPS
poly-L-lysine21nt ssDNANew non-equilibrium dynamic behaviors in artificial protocellsYin et al. (2018)

Summary of peptide-DNA coacervates.

Single stranded DNA (ssDNA) has flexible chain and non-defined conformation, which promote the development of coacervates. Wee et al. reported that the coacervates formed by polylysine and arylazopyrazole (AAP)-conjugated ssDNA would contribute to improve the observation of transient and dynamic LLPS via photoswitch (Wee et al., 2021). The photoswitichable droplets would control the conformation of ssDNA through irradiations of different wavelengths. Notably, the scientists demonstrated that the electronic interactions between the peptide and backbone of ssDNA drove the formation of coacervates and also claimed that the cis-trans isomerization of units which were absent from binding activity contributed to the interactions in droplets. The findings illuminated that the coacervates enable to improve the acceleration in kinetics both in catalyzed and uncatalyzed activities.

Long double stranded DNA has rarely been studied in peptide-based coacervation due to its stiff chain, hydrophilicity and high charge density. However, some short dsDNA recently shifted the perspective when a coacervation containing short double-stranded DNA (dsDNA) and poly-l-lysine (PLys) was formed and contributed to the exploration of probiotic cell evolution (Fraccia and Jia, 2020). The coacervates of short dsDNA and poly-l-lysine exhibited liquid‒liquid phase separation instead of precipitation, and the short dsDNA dominated the aggregation and packing process in coacervation. Additionally, the phase behaviors were controlled by the temperature, monovalent salt concentration, dsDNA, and peptide concentration, which kept the complex in a fluid state. It also offered opportunities to generate multiphase condensates, which provided an understanding of how nucleic acids and peptides self-assemble to evolve prebiotically together.

Furthermore, hybridization of the peptide chains influenced the behavior of phase separation due to the difference in charge density (Vieregg et al., 2018). (KG)15 and (KGG)10 affected the size of the coacervates from approximately 100 nm-10μm, although the phase formed with ssDNA was not changed.

2.3 Peptide-RNA coacervates

Membraneless organelles were confirmed to play an important role in living cells, affecting the process of disease. Because of their capability of imbibing biomolecules, membraneless organelles could be a location of multiple reactions. Peptide-RNA coacervates are generated through phase separation, with multivalent associations (Saha et al., 2019). RNA, as an anionic polyelectrolyte, has a highly negatively charged phosphate backbone. Electronic interactions are one of the main forces of coacervation; RNA is able to combine with cation polypeptides to form droplets, and the condensate is involved in various physiological activities (Henninger et al., 2021). A summary of peptide-RNA coacervates is showed in Table 4.

TABLE 4

PeptideRNANotable detailsReferences
polyaminespolyUSimplified model to explore the property of interfacial liposome assemble for membraneless organellesAumiller et al. (2016)
Primordial-(HhH)2-ArgpolyUDisordered polypeptides can give rise to structureLongo et al. (2020)
Primordial-(HhH)2-Orn
K4, K10polyUNew explanations for temperature-dependent drive forcePullara et al. (2022)
R10, K10Template-directed RNAEnhance the functions of RNA and other biopolymersPoudyal et al. (2019)
K72(ACGU)6High catalytic efficiencyNakashima et al. (2021)
(PR)12PolyAPoly(PR) inhibited the process of transcription and diffusion of NPM1Chen et al. (2021)
TDP-43 CTDtorula yeastLeading to TDP-43 pathobiologyBhopatkar et al., (2020)
RNA
R10RNA 15-merExplore the mechanism that short non-code peptide enhance the early cell fitnessJia et al. (2016)
R4rIGSRNALong and low complexity RNA is important to build membrane-less compartmentsWang et al. (2018)

Summary of peptide-RNA coacervates.

The structure of the peptide determines the formation of coacervation, which contributes to the protein structure domain (Seal et al., 2022). Recently, a flexible peptide and its derivatives showed that a helix-hairpin-helix (HhH) motif combined with RNA contributes to coacervation. The flexible peptide was present as dimers alone, which built bridging bidentate interactions with PolyU in coacervates. The results from double electron−electron resonance spectroscopy showed the symmetric (HhH)2-fold that was related to dsDNA binding in the distance distribution between dimers and α-helix folding. Based on this study, they claimed that peptide aggregation was the special aspect of coacervation and peptide-involved liquid‒liquid phase separation would be the basis of the formation of protein structures in duplication and fusion processes in original life. Aumiller et al. proved that shifting peptide phosphorylation would control peptide-RNA droplet coacervation (Aumiller and Keating, 2016). Adding or removing a phosphate site from the peptide (peptide sequence: RRASLRRASL) led to the aggregation or disaggregation of the droplets because the electronic interactions in the coacervates were changed. Similar results were found for simple base RNA (poly U) and transfer RNA, which contain four bases and have a molecular weight of approximately 23–27 kDa.

In addition, peptide-RNA coacervates contribute to enhancing the catalytic ability of RNA (Poudyal et al., 2019). Le Vay et al. recently reported that in coacervation formed by poly-l-lysine (PLys) and a split HPz ribozyme, the ribozyme activity was increased significantly in different circumstances. The variant chain length of PLys showed that regardless of it being a longer peptide (PLys)19–72 or a shorter peptide (PLys)5–24, a polycation peptide improved ribozyme activity (Le Vay et al., 2021). This ability was suppressed at a high ratio of peptide, while at a low ratio, (PLys)19–72: RNA = 1.1:1 and (PLys)5–24: RNA = 2.3:1, the catalytic ability was strong. The polycation peptide enhanced ribozyme activity through electronic-mediated liquid‒liquid phase separations, leading to peptide-RNA coacervation instead of cleavage. Therefore, short motifs offer the chance for RNA to form long and complex chains without external simulation, which supports the hypothesis that the peptides and RNA were undergoing early coevolution. Additionally, simple heteropeptide-RNA coacervates have been demonstrated to enable the maintenance of ribozyme activity (Iglesias-Artola et al., 2022).

The concentration of Mg2+ is one of the standards used to evaluate the level of ribozyme activity because Mg2+ is a necessary factor for the catalysis of RNA. Although the results of ICP‒MS and ITC compartment peptide (RGG)4 coacervation had higher mobility than R9, K9 and Mg2+ partitioning was dependent on the change density of the peptide. (RGG)4, which had a lower change density, had a lower binding ability to RNA. The heteropeptide had a larger transition area than the homopeptide, leading to a wider range of peptide concentrations to guard the catalytic ability of the RNA. Therefore, the properties of the peptide sequence would dominate the activity of the ribonucleic acid, and coacervation between the peptide and RNA could force the development of protocellular compartments.

2.4 Peptide-polysaccharides coacervates

Peptide-polysaccharides coacervation has been widely used in food science (Glab and Boratynski, 2017; Niu et al., 2018), drug delivery system (Abashzadeh et al., 2011; Park et al., 2021) and skin regeneration (Park et al., 2019). Electronics interactions drive the formation of droplet to control the structure under suitable circumstance (Pillai et al., 2021). Also, the interactions were influenced by the eternal factors such as pH, temperature and ion strength. A summary of peptide-polysaccharides coacervates in Table 5. It was proven that the coacervates contained poly-arginine or poly-lysine with heparin had high loading efficiency (Chu et al., 2012; Johnson et al., 2014). Polycation peptides combined with heparin would be an intelligent delivery strategy for growth factors. With the high loading efficiency approximately 99%, the coacervates loaded fibroblast growth factor-2 (FGF2) (Chu et al., 2011). The results demonstrated the coacervates not only offered the effective protection for FGF2 from proteolytic degradations, but also enhanced the functions of differentiation and chemotaxis with relative low dose. Chitosan, as the biocompatible cation polysaccharide, combined with anionic polypeptide poly (γ-glutamic acid) to form the condensate to deliver IFN-γ to inhibit the invasion of colorectal cancer cells (Castro et al., 2019). The dense condensate vehicle was non-toxic and biodegradable with high loading efficacy, showing narrow size distribution with diameter approximately 180 nm, excellent modulation for IL-10-stimulated macrophages and strong ability to profiler T cells. The delight peptide-polysaccharides coacervates claimed they were promising vehicles for clinical immunomodulatory therapy.

TABLE 5

PeptidePolysaccharidesNotable detailsReferences
poly(L-argininate glyceryl succinate)HeparinBiocompatible delivery systemChu et al. (2012)
poly(L-argininate glyceryl succinate)HeparinIL-12 coacervates to treat B16-F10 melanomaHwang et al. (2020)
poly(L-argininate glyceryl succinate)HeparinA new therapy of attenuating the disc degenerationZhu et al. (2019)
P1 GWVDHFADGYDEVIAChitosanVerify electronic interaction is main force for peptide/chitosan coacervatesZubareva et al. (2013)
P2 MELPSFGVSGVNESADM
P3 DQGHDTGSASAPAST
P4 VGIDQPPFGIFV
P5 SNCHTHEGGQLHCT
P6 CREGEDNSKRN
poly(γ-glutamic acid)ChitosanAs an immunostimulatory carrier loading IFN-γ for colorectal cancerCastro et al. (2019)
CWGGKAKAKAKAKAKAKAglycosaminoglycanLayer coating for ECM mimic systemWieduwild et al. (2018)
polylysinecarboxymethyl-dextranOffer a potential model for biomimetic protocellDora Tang et al. (2015)
poly(ethylene lysinylaspartate diglycerideHeparinEncapsulated protein as a safe and efficient delivery systemJohnson et al. (2014)
ELPhyaluronic acidPotential hydrophobic delivery systemTang et al. (2018)

Summary of peptide- polysaccharides coacervates.

3 Mechanism of coacervation

3.1 Thermodynamic principles

Entropic would vary in the coacervation steps, which influences the thermodynamic changes of droplets and the inner forces of their formation. The thermodynamic process of coacervation is still a controversial topic (Singh and Yethiraj, 2020). Garcia-Rojas et al. claimed that coacervates containing ovalbumin and lysozyme had two steps of formation, including enthalpically favorable and entropically unfavorable contributions (Santos et al., 2018). The isothermal titration calorimetry data demonstrated that electronic interactions and hydrogen bonds both contributed to the interaction. Yethiraj et al. tried to explore the thermodynamics of oligomer coacervation via MD simulations and umbrella sampling and demonstrated that π-cation interactions played a significant role in coacervation thermodynamics (Singh and Yethiraj, 2021). Containing poly-arginine (pR) and poly-tyrosine (pY), the oligomer coacervation was influenced by its free energy, which was different from the complexation of polyelectrolytes. The coacervates had a similar free energy profile to pR and pY, indicating that oligomer complexation dominated the phase separation. Additionally, the number of π-cation interactions was related to the free energy, and it was proven that the addition of salt would contribute to hindering the π-cation interactions between R and Y or competing with R carbocation to form π-cation.

The coacervates formed by poly-l-lysine (PLys) and different types of nucleoside triphosphates (NTPs), that is, A/G/C/T/U, exhibited impressive heat-response behavior due to base stacking interactions (Lu et al., 2021). As the temperature increased, the critical salt concentrations of ATP/PLys, GTP/PLys, CTP/PLys, TTP/PLys and UTP/PLys decreased. GTP/PLys coacervates decreased strikingly compared with the other NTPs at the same change in temperature. Additionally, it was observed that as the temperature decreased, the critical salt concentrations of GTP and ATP increased faster than those of NTPs. The reason why NTP/PLys coacervates respond to temperature differently is the difference in their relative stacking free energies of their nucleobases, which has been proven by the line of the NTP changing with temperature. They also proved their hypothesis with simplified Glory-Huggins equations, and their data analysis demonstrated that the entropy and enthalpy of PLys/GTP coacervates were due to the formation of hydrogen bonds between the polycations and GTP. Wang et al. investigated the binding affinity between the nucleotides and the homo-octapeptides of 20 common amino acids and an affinity matrix of 20 common amino acids, which exhibited proof of thermodynamics between amino acids and nucleotides or between amino acids and amino acids (Du et al., 2019; Wang et al., 2022). They claimed that the interactions were influenced by the DNA backbones, DNA base types, peptide chains and side function groups, which offers wise suggestions for phase separation. In addition, Lim et al. discovered that His and Tyr residues in the termini would enable forced coacervation and become the sites of interactions (Lim et al., 2021).

3.2 Kinetics

So far, the kinetics of coacervation have not been clarified. However, there are several possible explanations for the kinetics of the formation of coacervates. Bai et al. demonstrated that the dynamic process could be described by classic nucleation theory (Bai et al., 2021). They revealed that the coacervates formed by peptide S5 and oligonucleotide underwent a time-dependent process of heterogeneous nucleation, diffusion-limited growth, and Brownian motion coalescence. The changes in size with time indicated that polycation peptide S5 bound with polyanion oligonucleotide to form neutral nuclei. Because the charge of the oligonucleotide was higher than that of peptide S5, the oligonucleotide dominated the heterogeneous nucleation. Additionally, due to the different net charges on their surface, the coacervates would increase sharply and coarsen quickly (Figure 2).

FIGURE 2

In addition, the length of the peptide and the structure undoubtedly played an important role in kinetics (Spath et al., 2021). Through several cationic peptides, it was clear that with chain length growth, the level of crosslinking of coacervates was enhanced, which reduced the mobility of the droplets. Moreover, the addition of block polymer easily influenced the coacervate morphology. Scientists have tried to add poly (styrenesulfonate) to peptides as repelling segments and poly (ethylene glycol) as affinity segments to active peptides. The existence of a block polymer contributes to phase separation, while with the loss of the driving force of poly (styrenesulfonate), the dense packing, and crowding in the corona are obviously reduced, leading to breakage of the polymer.

4 Influencing factors

4.1 Ionic strength

Ionic strength is a significant factor that contributes to peptide-based coacervates, which usually shows variations in response to the salt concentration in solutions. Alterations of the salt concentrations would affect the formation of coacervates in two aspects: i) increasing the dissolution of components, which leads to the aggregation of coacervates, and ii) screening the net charge of the peptide and other components and hindering the interactions inside the coacervates by combining with the charged groups of the peptides or participants, which inhibit the formation of coacervates. Under a low concentration condition, the amount of coacervation increases as a consequence of the growth of dissolution. A high salt concentration usually hinders electronic interactions occurring in coacervates, leading to the suppression of coacervation.

It has been proven that peptide-RNA droplets can be controlled by divalent ion concentrations only (Onuchic et al., 2019). Scientists took an arginine-rich peptide (RRASL)3 containing IDPs characteristics and polyU as an in vitro model. With an increasing Mg2+ concentration, the coacervates deceased because the electronic internationalization between the peptide and RNA was reduced, which was similar to the response to Na+ (Figure 3). Additionally, they explored the phase behavior with the participation of Ca2+ and Sr2+, and the concentration thresholds were 50 mM and 75 mM, respectively, while Mg2+ was 300 mM. The difference in the liquid‒liquid phase separation threshold was caused by their higher screening efficiency and lower capability of interactions with RNA. Altering the divalent ion concentration would be a possible solution to control the phase separation by regulating the weak interactions.

FIGURE 3

Tabandeh et al. (Tabandeh and Leon, 2019) reported two oppositely charged peptides: one with equal residues of charged and uncharged amino acids and the other with increased charge density. They explored the critical salt concentration (CSC) of the coacervates formed by the two peptides, which is an important measurement for coacervate stability. The results showed that as the salt concentration increased from 0 mM to 120 nM, the turbidity of every pair of coacervates decreased. Ion pairing with the ions in the salt solution led to screening of the opposite charges of the peptides, resulting in weakening of the electronic interactions in the coacervates and limiting their formation.

4.2 pH

Peptides are commonly utilized as polyelectrolytes to form coacervation via electronic interactions; therefore, the pH value is significant in coacervation. Usually, phase separation starts when the pH of an aqueous solution is higher than the pI of the peptides (Weinbreck et al., 2003). Mountain et al. demonstrated that in a condensate formed by gum arabic (GA) and polypeptide leucine (PL), pH affected the behavior of the polysaccharides (Mountain and Keating, 2020). The charge of the polymer chain was enhanced while the pH was lower than the pKa of GA, which reduced the electronic interactions and contributed to the formation of soluble droplets.

Recently, tyrosine-rich short peptides were claimed to enable the formation of semipermeable coacervate protocells due to the oxidation of spacers in the YFsFY peptide (Abbas et al., 2022). Since the phenolic side group of tyrosine had a pKa of approximately 10.5, the self-assembled condensate was dissolved when the pH value increased. A condensate was observed in a range of pH values between 6.8–10.5 (Figure 4). Although the reason for this was not confirmed, it may be caused by deprotonating the cation or protonating the anion, considering that electronic interactions dominated the phase separation.

FIGURE 4

4.3 Temperature

Temperature is another important factor for the formation of peptide-based coacervation. The formation of hydrogen bonds and hydrophobic interactions is influenced by temperature variation (Wang et al., 2015), which contributes to polymer condensation. Recently, Li et al. demonstrated that two similar ELP sequences, poly (VGPVG)18 and poly (VPGVG)18, had different temperature-dependence behaviors in coacervates due to the decline of intrachain hydrogen bonds and the boost of interchain hydrogen bonds (Li et al., 2021). From the all-atom molecular dynamics simulation, the calculated data indicated that the different sequence orders of the peptides would lead to different structural properties. Above the transition temperature, poly (VGPVG) was more hydrophilic than poly (VPGVG) due to the wider configuration and larger surface area of the condensates. Notably, hydrogen bonds controlled the stability of the coacervation and were responsible for the chances of thermal hysteresis of the two peptides. Singh et al. observed the coacervation process through time-dependent 1 H high-resolution magic angle sample spinning (HRMAS) and high-resolution magic angle sample spinning (NMR) spectroscopy and found that the hydrophilic amino acid glycine α-CH2 was more sensitive than proline β-CH2 to coacervation (Singh et al., 2016).

Additionally, the particle size would be affected by temperature because ELP is thermally sensitive and is capable of coacervating reversibly with temperature shifting. Kang et al. (2021) reported that a vRAGE-conjugated ELP (peptide sequence: PLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIP) started to self-assemble and coacervate at approximately 31°C, and the particle had a narrower size distribution with increasing temperature. The tight size distribution would reduce any possible binding sites and enhance the protease-resistance ability.

5 Applications of peptide-based coacervates

5.1 DNA delivery system

Cell-penetrating peptides (CPPs), with excellent intracellular transition ability, are frequently considered a potential therapeutic treatment for drug delivery systems. A heptamer derivation from Penetrain (KIWFQNR) was reported to form coacervates with a DNA core, and the coacervation had a typical β-sheet structure (Mello et al., 2020). The peptide-DNA complex was claimed to promote cellular surface binding. The peptide complex encapsulated 200 bp DNA into HeLa cells, which was 10 times larger than other similar regulators, such as mRNA and siRNA. In addition, KIWFQNR had the longest non-charged fragment of Penetrain, which offers the possibility of intracellular DNA delivery without the participation of strong cations.

Wang et al. designed a bio-inspired DNA delivery system with peptide-DNA coacervate core and the dextran shield (Wang et al., 2020). They designed the positive charged peptide with sequence CKKKHHHHKKKC, while lysine enables to bind with DNA and histidine offer the proton sponge effect to release DNA. Cysteine contributed to crosslink in oxidation status in the air, which promote the coacervation. The in vitro results claimed that the coacervates delivery system had high DNA loading capability, high level transfection efficiency with a low cytotoxicity, which would a promising gene carrier system.

5.2 mRNA-based vaccines

LLPS droplets can be triggered by pH and redox responsiveness, making them suitable carriers for mRNA-based vaccines due to their excellent penetrability and biocompatibility. Sun et al. (2022) claimed to have formed microdroplets that from conjugated peptides (HBpep) and the mRNA would encapsulate EGFR-encoding mRNA into the cytosol and release it via the glutathione-mediated pathway. The transfection efficiency of the coacervates was higher than that of polyethylenimine and Lipofectamine 3,000 but less than that of Lipofectamine 2000 in HepG2 cells, while in the HEK293 cell line, the peptide-based coacervates had a transfection efficiency similar to that of Lipofectamine 2000. Notably, the coacervation of HBpep was friendly to cells and barely found to be cytotoxic at the optimized concentration. Additionally, they investigated the stability of the coacervates under high concentrations of RNase, and the electrophoresis experiment results showed that the molecular weight of mRNA in the condensate was barely changed. Surprisingly, compared with free mRNA, the peptide-RNA coacervates had excellent protease resistance capability, while free mRNA was rarely found after culture in RNase solution for 2 h. In summary, peptide-RNA coacervates represent a promising therapeutic platform for mRNA vaccines.

Nasr et al. reported coacervate nanosystem for co-delivery of mRNA and plasmid DNA (Nasr et al., 2021). The cationic peptide protamine sulfate loaded mRNA and encapsulated plasmid DNA. The flow cytometry and confocal laser scan microscopy data showed the co-delivery system have dual high transfection efficiency in DC2.4 cell line with low cytotoxicity (Figure 5). In summary, peptide-RNA coacervates represent a promising therapeutic platform for mRNA vaccines.

FIGURE 5

5.3 Small molecule delivery system

In recent decades, coacervate delivery systems have mostly been utilized in the food science area and are now frequently reported in therapeutic fields, such as wound healing (Lau et al., 2018), inflammation, cardiovascular diseases and cancer treatment (Schaal et al., 2016). Lim et al. developed a coacervate drug delivery system containing DgHBP-2 peptide, Doxorubicin (Dox) and magnetic nanoparticles (MNPs) as a novel liver cancer treatment (Lim et al., 2020). The DgHBP-2 peptide, derived from penta-repeats, was assembled into coacervates in phosphate buffer (pH = 9.5) while Dox and MNPs were added to the solution. The coacervates demonstrated that they were internalized by HepG2 cells without the participation of adenosine triphosphate (ATP). Additionally, the confocal data claimed that the droplets could be controlled by a magnetic field that induced a 45°C temperature, leading to the release of Dox and the dissolution of coacervation. A combination of chemotherapy and thermotherapy would enhance the effect of treatment and could be a novel therapeutic strategy for liver cancer. In addition, due to the strong electronic interactions in the coacervates, they can be used as charged molecules.

5.4 Biomimetic protocell

Peptide-based coacervates are promising particles for creating life-like biomimetic protocells (Nakashima et al., 2021). Because peptides have a simple chemical structure and various functional groups of side chains, the coacervates isolate and concentrate many molecules without limitations from the membrane. As a dramatic model of protocells, coacervates formed by different charged polyelectrolytes have been reported to increase enzymatic ability. Yin et al. (2018) claimed that under the situation of a direct current electric field, the coacervates showed repeated periods of vacuolization, frequency, and intensity. Strikingly, fluorescence microscopy results demonstrated that the coacervates had life-like behaviors, such as changing in size and shape, chaotic growth and fusion. In addition, an electric field influenced the kinetics of the system, which contributed to the mass transport and then tuned the location and movement of the enzyme activity to achieve the chemical activity of the protocells. Moreover, peptide-based coacervates would enable a change in the reaction rate. Compared with coacervates and microdroplets from electrospray ionization, this result indicated that with the contribution from the crowding effect, the rate of transcription was increased sharply (Stroberg and Schnell, 2018).

5.5 Transcriptional regulation

Transcription factors and cofactors, important components of transcription, have intrinsically disordered low-complexity domains leading to the formation of coacervates. Peptide-based coacervates offer the possibility of compartmentalizing and concentrating biochemical reactions, such as accumulating transcription apparatus at the key site to achieve molecular recognition showed in Figure 6. (Sabari et al., 2018). In addition, special amino acids, such as arginine, are involved in neuronal diseases that are frequently observed to be coacervated (Bhopatkar et al., 2020). Although the coacervates formed by poly R12 and RNA are non-toxic, poly (PR)12 enabled limited protein translation and exhibited cytotoxicity. Adding proline to the polyarginine structure favors multivalent interactions and governs LLPS, leading to the aggregation of acid proteins. This may offer an explanation for neuronal cell death in C9-amyotrophic lateral sclerosis.

FIGURE 6

5.6 Underwater adhesive

Because the coacervates were easily shifted from liquid to gel by adjusting the pH value or the concentrations of the metal ions, Li el al. reported that the short peptide GHK formed droplets with anionic polyoxometalates, and the coacervation exhibited excellent mechanical stiffness and self-healing properties (Li et al., 2019). In addition, they examined the mechanical adhesion strength in different substrates, such as titanium, polypropylene, glass, and stainless steel, and the data showed that the gel had impressive adhesion strength for all four substrates. Moreover, the regulation of the pH value and metal ions could trigger the formation of peptide-based coacervates in specific locations in injectable underwater adhesives. Consequently, the coacervation produced by short peptides and polyoxometalates would be a promising method for developing underwater adhesives (Figure 7).

FIGURE 7

6 Conclusion and perspectives

Recent reports offer information on advances in peptide-based coacervates. Versatile peptide functional groups and secondary structures are the main driving force for liquid‒liquid phase separation and sensitivity to the cellular environment. Moreover, external stimulations influence coacervation behaviors. We summarized the currently known different types of peptide-based coacervates as well as their therapeutic applications. At present, the researches of peptide-based coacervates are mainly focused on the role of peptide contained homologous amino acid, but ignore the possibility of non-poly electrolytes peptides and their internal mechanism of dynamic process. Peptide-based coacervates participated in regulation of cell metabolism, signal transduction, gene expression, protein homeostasis and other physiological processes, and helps maintain the stability of the internal environment. Besides, the phase separation droplets are closely related to many diseases and the formation of coacervates involved in the development of therapies. Peptide-based coacervates are biocompatibility and biosafety polymers and would be beneficial to partition, protect enzymes and implement reactions in the droplet through offering substrates from eternal environment. Comprehensively, the development of peptide-based coacervates indicates that peptides have strong potential as candidates for therapeutic applications. The studies summarized in this review could shed light on the controlled structures, functions, applications of peptide-based coacervates. There are several puzzles that need to be addressed in future studies:

  • 1) Due to the native properties of peptides that would tend to form precipitates instead of droplets, their mechanism of assembly and modulation of the methods of coacervation require further research.

  • 2) Controllable, scalable production methods need to be developed to support the manufacture of stable and uniform coacervates.

  • 3) Quantitative technologies are needed to evaluate the process instead of the common qualitative technology applied currently, such as fluorescence recovery after photobleaching.

  • 4) High spatiotemporal resolution detection measurements are urgently needed to explore the changes in the molecular interface, the distribution of its components in coacervates and their mass transmission.

  • 5) Simulation and calculations would deepen the understanding of their thermodynamics and kinetics.

  • 6) To date, LLPS has mainly focused on biomolecules. Nanoparticles and clusters also play an important role in phase separation, and more significant applications need investigation.

Statements

Author contributions

LM conceptualization, data curation and writing original draft. XF validation, writing-review and editing, and fund acquisition. CW conceptualization, resources, writing review and editing, supervision and funding acquisition.

Funding

This work was supported by National Natural Science Foundation of China (Nos. 21721002, 21790394, 32101130, and 31971295), Financial supported by the Strategic Priority Research Program of Chinese Academy of Sciences (XDB36000000).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

References

  • 1

    AbashzadehS.DinarvandR.SharifzadehM.HassanzadehG.AminiM.AtyabiF. (2011). Formulation and evaluation of an in situ gel forming system for controlled delivery of triptorelin acetate. Eur. J. Pharm. Sci.44, 514–521. 10.1016/j.ejps.2011.09.011

  • 2

    AbbasM.LawJ. O.GrellscheidS. N.HuckW. T. S.SpruijtE. (2022). Peptide-based coacervate-core vesicles with semipermeable membranes. Adv. Mater34, e2202913. 10.1002/adma.202202913

  • 3

    AmruthwarS. S.PuckettA. D.JanorkarA. V. (2013). Preparation and characterization of novel elastin-like polypeptide-collagen composites. J. Biomed. Mater Res. A101, 2383–2391. 10.1002/jbm.a.34514

  • 4

    AumillerW. M.Jr.KeatingC. D. (2016). Phosphorylation-mediated RNA/peptide complex coacervation as a model for intracellular liquid organelles. Nat. Chem.8, 129–137. 10.1038/nchem.2414

  • 5

    AumillerW. M.Jr.Pir CakmakF.DavisB. W.KeatingC. D. (2016). RNA-based coacervates as a model for membraneless organelles: Formation, properties, and interfacial liposome assembly. Langmuir32, 10042–10053. 10.1021/acs.langmuir.6b02499

  • 6

    BaiQ.ZhangQ.JingH.ChenJ.LiangD. (2021). Liquid-liquid phase separation of peptide/oligonucleotide complexes in crowded macromolecular media. J. Phys. Chem. B125, 49–57. 10.1021/acs.jpcb.0c09225

  • 7

    BariK. J.PrakashchandD. D. (2021). Fundamental challenges and outlook in simulating liquid-liquid phase separation of intrinsically disordered proteins. J. Phys. Chem. Lett.12, 1644–1656. 10.1021/acs.jpclett.0c03404

  • 8

    BaulU.BleyM.DzubiellaJ. (2020). Thermal compaction of disordered and elastin-like polypeptides: A temperature-dependent, sequence-specific coarse-grained simulation model. Biomacromolecules21, 3523–3538. 10.1021/acs.biomac.0c00546

  • 9

    BhattacharyyaJ.WeitzhandlerI.HoS. B.McDanielJ. R.LiX.TangL.et al (2017). Encapsulating a hydrophilic chemotherapeutic into rod-like nanoparticles of a genetically encoded asymmetric triblock polypeptide improves its efficacy. Adv. Funct. Mater27, 1605421. 10.1002/adfm.201605421

  • 10

    BhopatkarA. A.UverskyV. N.RangachariV. (2020). Granulins modulate liquid-liquid phase separation and aggregation of the prion-like C-terminal domain of the neurodegeneration-associated protein TDP-43. J. Biol. Chem.295, 2506–2519. 10.1074/jbc.ra119.011501

  • 11

    CastroF.PintoM. L.AlmeidaR.PereiraF.SilvaA. M.PereiraC. L.et al (2019). Chitosan/poly(γ-glutamic acid) nanoparticles incorporating IFN-γ for immune response modulation in the context of colorectal cancer. Biomater. Sci.7, 3386–3403. 10.1039/c9bm00393b

  • 12

    ChenC.YamanakaY.UedaK.LiP.MiyagiT.HaradaY.et al (2021). Phase separation and toxicity of C9orf72 poly(PR) depends on alternate distribution of arginine. J. Cell Biol.220, e202103160. 10.1083/jcb.202103160

  • 13

    ChuH.GaoJ.ChenC. W.HuardJ.WangY. (2011). Injectable fibroblast growth factor-2 coacervate for persistent angiogenesis. Proc. Natl. Acad. Sci. U. S. A.108, 13444–13449. 10.1073/pnas.1110121108

  • 14

    ChuH.GaoJ.WangY. (2012). Design, synthesis, and biocompatibility of an arginine-based polyester. Biotechnol. Prog.28, 257–264. 10.1002/btpr.728

  • 15

    DespanieJ.DhandhukiaJ. P.Hamm-AlvarezS. F.MacKayJ. A. (2016). Elastin-like polypeptides: Therapeutic applications for an emerging class of nanomedicines. J. Control Release240, 93–108. 10.1016/j.jconrel.2015.11.010

  • 16

    Dora TangT. Y.van SwaayD.deMelloA.Ross AndersonJ. L.MannS. (2015). In vitro gene expression within membrane-free coacervate protocells. Chem. Commun. (Camb)51, 11429–11432. 10.1039/c5cc04220h

  • 17

    DuH.HuX.DuanH.YuL.QuF.HuangQ.et al (2019). Principles of inter-amino-acid recognition revealed by binding energies between homogeneous oligopeptides. ACS Cent. Sci.5, 97–108. 10.1021/acscentsci.8b00723

  • 18

    FracciaT. P.JiaT. Z. (2020). Liquid crystal coacervates composed of short double-stranded DNA and cationic peptides. ACS Nano14, 15071–15082. 10.1021/acsnano.0c05083

  • 19

    GaurD.DubeyN. C.TripathiB. P. (2022). Biocatalytic self-assembled synthetic vesicles and coacervates: From single compartment to artificial cells. Adv. Colloid Interface Sci.299, 102566. 10.1016/j.cis.2021.102566

  • 20

    GlabT. K.BoratynskiJ. (2017). Potential of casein as a carrier for biologically active agents. Top. Curr. Chem. (Cham)375, 71. 10.1007/s41061-017-0158-z

  • 21

    HenningerJ. E.OksuzO.ShrinivasK.SagiI.LeRoyG.ZhengM. M.et al (2021). RNA-mediated feedback control of transcriptional condensates. Cell184, 207–225. e24. 10.1016/j.cell.2020.11.030

  • 22

    HwangM. P.FecekR. J.QinT.StorkusW. J.WangY. (2020). Single injection of IL-12 coacervate as an effective therapy against B16-F10 melanoma in mice. J. Control Release318, 270–278. 10.1016/j.jconrel.2019.12.035

  • 23

    Iglesias-ArtolaJ. M.DrobotB.KarM.FritschA. W.MutschlerH.Dora TangT. Y.et al (2022). Charge-density reduction promotes ribozyme activity in RNA-peptide coacervates via RNA fluidization and magnesium partitioning. Nat. Chem.14, 407–416. 10.1038/s41557-022-00890-8

  • 24

    JainA.KassemS.FisherR. S.WangB.LiT. D.WangT.et al (2022). Connected peptide modules enable controlled Co-existence of self-assembled fibers inside liquid condensates. J. Am. Chem. Soc.144, 15002–15007. 10.1021/jacs.2c05897

  • 25

    JiaT. Z.FahrenbachA. C.KamatN. P.AdamalaK. P.SzostakJ. W. (2016). Oligoarginine peptides slow strand annealing and assist non-enzymatic RNA replication. Nat. Chem.8, 915–921. 10.1038/nchem.2551

  • 26

    JoH.GajendiranM.KimK. (2019). Development of polymer coacersome structure with enhanced colloidal stability for therapeutic protein delivery. Macromol. Biosci.19, e1900207. 10.1002/mabi.201900207

  • 27

    JohnsonN. R.AmbeT.WangY. (2014). Lysine-based polycation:heparin coacervate for controlled protein delivery. Acta Biomater.10, 40–46. 10.1016/j.actbio.2013.09.012

  • 28

    JohnsonN. R.WangY. (2014). Coacervate delivery systems for proteins and small molecule drugs. Expert Opin. Drug Deliv.11 (12), 1829–1832. 10.1517/17425247.2014.941355

  • 29

    KaminkerI.WeiW.SchraderA. M.TalmonY.ValentineM. T.IsraelachviliJ. N.et al (2017). Simple peptide coacervates adapted for rapid pressure-sensitive wet adhesion. Soft Matter13, 9122–9131. 10.1039/c7sm01915g

  • 30

    KangH. J.KumarS.D'EliaA.DashB.NandaV.HsiaH. C.et al (2021). Self-assembled elastin-like polypeptide fusion protein coacervates as competitive inhibitors of advanced glycation end-products enhance diabetic wound healing. J. Control Release333, 176–187. 10.1016/j.jconrel.2021.03.032

  • 31

    KimS.KimJ.GajendiranM.YoonM.HwangM. P.WangY.et al (2018). Enhanced skull bone regeneration by sustained release of BMP-2 in interpenetrating composite hydrogels. Biomacromolecules19, 4239–4249. 10.1021/acs.biomac.8b01013

  • 32

    KuroyanagiS.ShimadaN.FujiiS.FurutaT.HaradaA.SakuraiK.et al (2019). Highly ordered polypeptide with UCST phase separation behavior. J. Am. Chem. Soc.141, 1261–1268. 10.1021/jacs.8b10168

  • 33

    LauH. C.JeongS.KimA. (2018). Gelatin-alginate coacervates for circumventing proteolysis and probing intermolecular interactions by SPR. Int. J. Biol. Macromol.117, 427–434. 10.1016/j.ijbiomac.2018.05.093

  • 34

    LauK.ReichheldS.SharpeS.CerrutiM. (2022). Globule and fiber formation with elastin-like polypeptides: A balance of coacervation and crosslinking. Soft Matter18, 3257–3266. 10.1039/d2sm00049k

  • 35

    Le VayK.SongE. Y.GhoshB.TangT. D.MutschlerH. (2021). Enhanced ribozyme-catalyzed recombination and oligonucleotide assembly in peptide-RNA condensates. Angew. Chem. Int. Ed. Engl.60, 26300–26308. 10.1002/ange.202109267

  • 36

    LeeK. M.KimJ. H.ChoiE. S.KimE.ChoiS. K.JeonW. B. (2019). RGD-containing elastin-like polypeptide improves islet transplantation outcomes in diabetic mice. Acta Biomater.94, 351–360. 10.1016/j.actbio.2019.06.011

  • 37

    LiN. K.XieY.YinglingY. G. (2021). Insights into structure and aggregation behavior of elastin-like polypeptide coacervates: All-atom molecular dynamics simulations. J. Phys. Chem. B125, 8627–8635. 10.1021/acs.jpcb.1c02822

  • 38

    LiX.ZhengT.LiuX.DuZ.XieX.LiB.et al (2019). Coassembly of short peptide and polyoxometalate into complex coacervate adapted for pH and metal ion-triggered underwater adhesion. Langmuir35, 4995–5003. 10.1021/acs.langmuir.9b00273

  • 39

    LiZ.SreekumarP. G.PeddiS.HintonD. R.KannanR.MacKayJ. A. (2020). The humanin peptide mediates ELP nanoassembly and protects human retinal pigment epithelial cells from oxidative stress. Nanomedicine24, 102111. 10.1016/j.nano.2019.102111

  • 40

    LimJ.KumarA.LowK.VermaC. S.MuY.MiserezA.et al (2021). Liquid-liquid phase separation of short histidine- and tyrosine-rich peptides: Sequence specificity and molecular topology. J. Phys. Chem. B125, 6776–6790. 10.1021/acs.jpcb.0c11476

  • 41

    LimZ. W.PingY.MiserezA. (2018). Glucose-responsive peptide coacervates with high encapsulation efficiency for controlled release of insulin. Bioconjug Chem.29, 2176–2180. 10.1021/acs.bioconjchem.8b00369

  • 42

    LimZ. W.VarmaV. B.RamanujanR. V.MiserezA. (2020). Magnetically responsive peptide coacervates for dual hyperthermia and chemotherapy treatments of liver cancer. Acta Biomater.110, 221–230. 10.1016/j.actbio.2020.04.024

  • 43

    LiuJ. F.WeeY.LuoS. D.ChangS. F.JiaS.FengS. W.et al (2022). Proanthocyanidins-loaded complex coacervates-based drug delivery attenuates oral squamous cell carcinoma cells metastatic potential through down-regulating the Akt signaling pathway. Front. Oncol.12, 1001126. 10.3389/fonc.2022.1001126

  • 44

    LiuQ.WanK.ShangY.WangZ. G.ZhangY.DaiL.et al (2021). Cofactor-free oxidase-mimetic nanomaterials from self-assembled histidine-rich peptides. Nat. Mater20, 395–402. 10.1038/s41563-020-00856-6

  • 45

    LongoL. M.DespotovicD.Weil-KtorzaO.WalkerM. J.JablonskaJ.Fridmann-SirkisY.et al (2020). Primordial emergence of a nucleic acid-binding protein via phase separation and statistical ornithine-to-arginine conversion. Proc. Natl. Acad. Sci. U. S. A.117, 15731–15739. 10.1073/pnas.2001989117

  • 46

    LuT.NakashimaK. K.SpruijtE. (2021). Temperature-responsive peptide-nucleotide coacervates. J. Phys. Chem. B125, 3080–3091. 10.1021/acs.jpcb.0c10839

  • 47

    MatsuoM.KuriharaK. (2021). Proliferating coacervate droplets as the missing link between chemistry and biology in the origins of life. Nat. Commun.12, 5487. 10.1038/s41467-021-25530-6

  • 48

    MatveevV. V. (2019). Cell theory, intrinsically disordered proteins, and the physics of the origin of life. Prog. Biophys. Mol. Biol.149, 114–130. 10.1016/j.pbiomolbio.2019.04.001

  • 49

    McCallP. M.SrivastavaS.PerryS. L.KovarD. R.GardelM. L.TirrellM. V. (2018). Partitioning and enhanced self-assembly of actin in polypeptide coacervates. Biophys. J.114, 1636–1645. 10.1016/j.bpj.2018.02.020

  • 50

    MecoE.LampeK. J. (2019). Impact of elastin-like protein temperature transition on PEG-ELP hybrid hydrogel properties. Biomacromolecules20, 1914–1925. 10.1021/acs.biomac.9b00113

  • 51

    MelloL. R.HamleyI. W.CastellettoV.GarciaB. B. M.LourencoT. C.VassiliadesS. V.et al (2020). Self-assembly and intracellular delivery of DNA by a truncated fragment derived from the Trojan peptide Penetratin. Soft Matter16, 4746–4755. 10.1039/d0sm00347f

  • 52

    MountainG. A.KeatingC. D. (2020). formation of multiphase complex coacervates and partitioning of biomolecules within them. Biomacromolecules21, 630–640. 10.1021/acs.biomac.9b01354

  • 53

    Muriel MundoJ. L.LiuJ.TanY.ZhouH.ZhangZ.McClementsD. J. (2020). Characterization of electrostatic interactions and complex formation of ɣ-poly-glutamic acid (PGA) and ɛ-poly-l-lysine (PLL) in aqueous solutions. Food Res. Int.128, 108781. 10.1016/j.foodres.2019.108781

  • 54

    NakashimaK. K.van HarenM. H. I.AndreA. A. M.RobuI.SpruijtE. (2021). Active coacervate droplets are protocells that grow and resist Ostwald ripening. Nat. Commun.12, 3819. 10.1038/s41467-021-24111-x

  • 55

    NakashimaK. K.VibhuteM. A.SpruijtE. (2019). Biomolecular chemistry in liquid phase separated compartments. Front. Mol. Biosci.6, 21. 10.3389/fmolb.2019.00021

  • 56

    NasrS. S.LeeS.ThiyagarajanD.BoeseA.LoretzB.LehrC. M. (2021). Co-delivery of mRNA and pDNA using thermally stabilized coacervate-based core-shell nanosystems. Pharmaceutics13 (11), 1924. 10.3390/pharmaceutics13111924

  • 57

    NavonY.ZhouM.MatsonJ. B.BittonR. (2016). Dendritic elastin-like peptides: The effect of branching on thermoresponsiveness. Biomacromolecules17, 262–270. 10.1021/acs.biomac.5b01371

  • 58

    NiuF.KouM.FanJ.PanW.FengZ. J.SuY.et al (2018). Structural characteristics and rheological properties of ovalbumin-gum Arabic complex coacervates. Food Chem.260, 1–6. 10.1016/j.foodchem.2018.03.141

  • 59

    OnuchicP. L.MilinA. N.AlshareedahI.DenizA. A.BanerjeeP. R. (2019). Divalent cations can control a switch-like behavior in heterotypic and homotypic RNA coacervates. Sci. Rep.9, 12161. 10.1038/s41598-019-48457-x

  • 60

    ParkT. Y.MaengS. W.JeonE. Y.JooK. I.ChaH. J. (2021). Adhesive protein-based angiogenesis-mimicking spatiotemporal sequential release of angiogenic factors for functional regenerative medicine. Biomaterials272, 120774. 10.1016/j.biomaterials.2021.120774

  • 61

    ParkU.LeeM. S.JeonJ.LeeS.HwangM. P.WangY.et al (2019). Coacervate-mediated exogenous growth factor delivery for scarless skin regeneration. Acta Biomater.90, 179–191. 10.1016/j.actbio.2019.03.052

  • 62

    PatelA.LeeH.JawerthL.MaharanaS.JahnelM.HeinM.et al (2015). A liquid-to-solid phase transition of the ALS protein FUS accelerated by disease mutation. Cell162, 1066–1077. 10.1016/j.cell.2015.07.047

  • 63

    PhamN. B.LiuW.SchuellerN. R.GawaltE. S.FanY.MengW. S. (2019). Toward reducing biomaterial antigenic potential: A miniaturized fc-binding domain for local deposition of antibodies. Biomater. Sci.7, 760–772. 10.1039/c8bm01220b

  • 64

    PillaiP. K.GuldikenB.NickersonM. T. (2021). Complex coacervation of pea albumin-pectin and ovalbumin-pectin assessed by isothermal titration calorimeter and turbidimetry. J. Sci. Food Agric.101, 1209–1217. 10.1002/jsfa.10733

  • 65

    PoudyalR. R.Guth-MetzlerR. M.VeenisA. J.FrankelE. A.KeatingC. D.BevilacquaP. C. (2019). Template-directed RNA polymerization and enhanced ribozyme catalysis inside membraneless compartments formed by coacervates. Nat. Commun.10, 490. 10.1038/s41467-019-08353-4

  • 66

    PriftisD.FarinaR.TirrellM. (2012). Interfacial energy of polypeptide complex coacervates measured via capillary adhesion. Langmuir28, 8721–8729. 10.1021/la300769d

  • 67

    PriftisD.LeonL.SongZ.PerryS. L.MargossianK. O.TropnikovaA.et al (2015). Self-assembly of alpha-helical polypeptides driven by complex coacervation. Angew. Chem. Int. Ed. Engl.54, 11128–11132. 10.1002/anie.201504861

  • 68

    PullaraP.AlshareedahI.BanerjeeP. R. (2022). Temperature-dependent reentrant phase transition of RNA-polycation mixtures. Soft Matter18, 1342–1349. 10.1039/d1sm01557e

  • 69

    Rodriguez-CabelloJ. C.Gonzalez de TorreI.Ibanez-FonsecaA.AlonsoM. (2018). Bioactive scaffolds based on elastin-like materials for wound healing. Adv. Drug Deliv. Rev.129, 118–133. 10.1016/j.addr.2018.03.003

  • 70

    SabariB. R.Dall’AgneseA.BoijaA.KleinI. A.CoffeyE. L.ShrinivasK.et al (2018). Coactivator condensation at super-enhancers links phase separation and gene control. Science361, eaar3958. 10.1126/science.aar3958

  • 71

    SahaB.ChatterjeeA.RejaA.DasD. (2019). Condensates of short peptides and ATP for the temporal regulation of cytochrome c activity. Chem. Commun. (Camb)55, 14194–14197. 10.1039/c9cc07358b

  • 72

    SantosM. B.CostaA. R. d.Garcia-RojasE. E. (2018). Heteroprotein complex coacervates of ovalbumin and lysozyme: Formation and thermodynamic characterization. Int. J. Biol. Macromol.106, 1323–1329. 10.1016/j.ijbiomac.2017.08.132

  • 73

    SchaalJ. L.LiX.MastriaE.BhattacharyyaJ.ZalutskyM. R.ChilkotiA.et al (2016). Injectable polypeptide micelles that form radiation crosslinked hydrogels in situ for intratumoral radiotherapy. J. Control Release228, 58–66. 10.1016/j.jconrel.2016.02.040

  • 74

    SealM.Weil-KtorzaO.DespotovicD.TawfikD. S.LevyY.MetanisN.et al (2022). Peptide-RNA coacervates as a cradle for the evolution of folded domains. J. Am. Chem. Soc.144, 14150–14160. 10.1021/jacs.2c03819

  • 75

    SeligO.CunhaA. V.van EldijkM. B.van HestJ. C. M.JansenT. L. C.BakkerH. J.et al (2018). Temperature-induced collapse of elastin-like peptides studied by 2DIR spectroscopy. J. Phys. Chem. B122, 8243–8254. 10.1021/acs.jpcb.8b05221

  • 76

    SheehanF.SementaD.JainA.KumarM.Tayarani-NajjaranM.KroissD.et al (2021). Peptide-based supramolecular systems chemistry. Chem. Rev.121, 13869–13914. 10.1021/acs.chemrev.1c00089

  • 77

    ShirzadianT.NourbakhshM. S.FattahiA.BahramiG.MohammadiG. (2021). Characterization and optimization of de-esterified tragacanth-chitosan nanocomposite as a potential carrier for oral delivery of insulin: In vitro and ex vivo studies. J. Biomed. Mater Res. A109, 2164–2172. 10.1002/jbm.a.37202

  • 78

    SinghA. N.YethirajA. (2020). Driving force for the complexation of charged polypeptides. J. Phys. Chem. B124, 1285–1292. 10.1021/acs.jpcb.9b09553

  • 79

    SinghA. N.YethirajA. (2021). Liquid-liquid phase separation as the second step of complex coacervation. J. Phys. Chem. B125, 3023–3031. 10.1021/acs.jpcb.0c07349

  • 80

    SinghS.DemcoD. E.RahimiK.FecheteR.Rodriguez-CabelloJ. C.MollerM. (2016). Coacervation of elastin-like recombinamer microgels. Macromol. Rapid Commun.37, 181–186. 10.1002/marc.201500457

  • 81

    SpathF.DonauC.BergmannA. M.KranzleinM.SynatschkeC. V.RiegerB.et al (2021). Molecular design of chemically fueled peptide-polyelectrolyte coacervate-based assemblies. J. Am. Chem. Soc.143, 4782–4789. 10.1021/jacs.1c01148

  • 82

    StrobergW.SchnellS. (2018). Do cellular condensates accelerate biochemical reactions? Lessons from microdroplet chemistry. Biophys. J.115, 3–8. 10.1016/j.bpj.2018.05.023

  • 83

    SunJ.XiaoL.LiB.ZhaoK.WangZ.ZhouY.et al (2021). Genetically engineered polypeptide adhesive coacervates for surgical applications. Angew. Chem. Int. Ed. Engl.60, 23880–23887. 10.1002/ange.202100064

  • 84

    SunY.LauS. Y.LimZ. W.ChangS. C.GhadessyF.PartridgeA.et al (2022). Phase-separating peptides for direct cytosolic delivery and redox-activated release of macromolecular therapeutics. Nat. Chem.14, 274–283. 10.1038/s41557-021-00854-4

  • 85

    SunY.WollenbergA. L.O’SheaT. M.CuiY.ZhouZ. H.SofroniewM. V.et al (2017). Conformation-Directed formation of self-healing diblock copolypeptide hydrogels via polyion complexation. J. Am. Chem. Soc.139, 15114–15121. 10.1021/jacs.7b08190

  • 86

    SuyamaK.MawatariM.TatsuboD.MaedaI.NoseT. (2021). Simple regulation of the self-assembling ability by multimerization of elastin-derived peptide (FPGVG)n using nitrilotriacetic acid as a building block. ACS Omega6, 5705–5716. 10.1021/acsomega.0c06140

  • 87

    SuyamaK.ShimizuM.MaedaI.NoseT. (2022). Flexible customization of the self-assembling abilities of short elastin-like peptide Fn analogs by substituting N-terminal amino acids. Biopolymers113, e23521. 10.1002/bip.23521

  • 88

    TabandehS.LeonL. (2019). Engineering peptide-based polyelectrolyte complexes with increased hydrophobicity. Molecules24, 868. 10.3390/molecules24050868

  • 89

    TangJ. D.CaliariS. R.LampeK. J. (2018). Temperature-dependent complex coacervation of engineered elastin-like polypeptide and hyaluronic acid polyelectrolytes. Biomacromolecules19, 3925–3935. 10.1021/acs.biomac.8b00837

  • 90

    TaylorP. A.HuangH.KiickK. L.JayaramanA. (2020). Placement of tyrosine residues as a design element for tuning the phase transition of elastin-peptide-containing conjugates: Experiments and simulations. Mol. Syst. Des. Eng.5, 1239–1254. 10.1039/d0me00051e

  • 91

    ViereggJ. R.LueckheideM.MarcielA. B.LeonL.BolognaA. J.RiveraJ. R.et al (2018). Oligonucleotide-peptide complexes: Phase control by hybridization. J. Am. Chem. Soc.140, 1632–1638. 10.1021/jacs.7b03567

  • 92

    WangC.YouJ.GaoM.ZhangP.XuG.DouH. (2020). Bio-inspired gene carriers with low cytotoxicity constructed via the assembly of dextran nanogels and nano-coacervates. Nanomedicine15, 1285–1296. 10.2217/nnm-2020-0065

  • 93

    WangL.CaoY.ZhangK.FangY.NishinariK.PhillipsG. O. (2015). Hydrogen bonding enhances the electrostatic complex coacervation between κ-carrageenan and gelatin. Colloids Surfaces A Physicochem. Eng. Aspects482, 604–610. 10.1016/j.colsurfa.2015.07.011

  • 94

    WangM.TaoX.JacobM. D.BennettC. A.HoJ. D.GonzalgoM. L.et al (2018). Stress-induced low complexity RNA activates physiological amyloidogenesis. Cell Rep.24, 1713–1721. e4. 10.1016/j.celrep.2018.07.040

  • 95

    WangP.FangX.DuR.WangJ.LiuM.XuP.et al (2022). Principles of amino-acid-nucleotide interactions revealed by binding affinities between homogeneous oligopeptides and single-stranded DNA molecules. Chembiochem23, e202200048. 10.1002/cbic.202200048

  • 96

    WeeW. A.SugiyamaH.ParkS. (2021). Photoswitchable single-stranded DNA-peptide coacervate formation as a dynamic system for reaction control. iScience24, 103455. 10.1016/j.isci.2021.103455

  • 97

    WeiW.PetroneL.TanY.CaiH.IsraelachviliJ. N.MiserezA.et al (2016). An underwater surface-drying peptide inspired by a mussel adhesive protein. Adv. Funct. Mater26, 3496–3507. 10.1002/adfm.201600210

  • 98

    WeinbreckF.de VriesR.SchrooyenP.de KruifC. G. (2003). Complex coacervation of whey proteins and gum Arabic. Biomacromolecules4, 293–303. 10.1021/bm025667n

  • 99

    WieduwildR.WetzelR.HusmanD.BauerS.El-SayedI.DuinS.et al (2018). Coacervation-mediated combinatorial synthesis of biomatrices for stem cell culture and directed differentiation. Adv. Mater30, e1706100. 10.1002/adma.201706100

  • 100

    WuY.WangZ.CaiP.JiangT.LiY.YuanY.et al (2018). Dual delivery of bFGF- and NGF-binding coacervate confers neuroprotection by promoting neuronal proliferation. Cell Physiol. Biochem.47, 948–956. 10.1159/000490139

  • 101

    XiaoW.JakimowiczM. D.ZampetakisI.NeelyS.ScarpaF.DavisS. A.et al (2020). Biopolymeric coacervate microvectors for the delivery of functional proteins to cells. Adv. Biosyst.4, e2000101. 10.1002/adbi.202000101

  • 102

    YinY.ChangH.JingH.ZhangZ.YanD.MannS.et al (2018). Electric field-induced circulation and vacuolization regulate enzyme reactions in coacervate-based protocells. Soft Matter14, 6514–6520. 10.1039/c8sm01168k

  • 103

    YuL.ZhengY.XuJ.QuF.LinY.ZouY.et al (2017). Site-specific determination of TTR-related functional peptides by using scanning tunneling microscopy. Nano Res.11, 577–585. 10.1007/s12274-017-1825-7

  • 104

    Zai-RoseV.WestS. J.KramerW. H.BishopG. R.LewisE. A.CorreiaJ. J. (2018). Effects of Doxorubicin on the liquid-liquid phase change properties of elastin-like polypeptides. Biophys. J.115, 1431–1444. 10.1016/j.bpj.2018.09.006

  • 105

    ZhaoH.IbarboureE.IbrahimovaV.XiaoY.GarangerE.LecommandouxS. (2021). Spatiotemporal dynamic assembly/disassembly of organelle-mimics based on intrinsically disordered protein-polymer conjugates. Adv. Sci. (Weinh)8, e2102508. 10.1002/advs.202102508

  • 106

    ZhengY.YuL.ZouY.YangY.WangC. (2019). Steric dependence of chirality effect in surface-mediated peptide assemblies identified with scanning tunneling microscopy. Nano Lett.19, 5403–5409. 10.1021/acs.nanolett.9b01904

  • 107

    ZhouT.ZhangZ.ZhangX.WangC.XuG.YangY. (2017). Self-assembled chiral nanostructures of amphiphilic peptide: From single molecule to aggregate. J. Pept. Sci.23, 803–809. 10.1002/psc.3032

  • 108

    ZhuJ.XiaK.YuW.WangY.HuaJ.LiuB.et al (2019). Sustained release of GDF5 from a designed coacervate attenuates disc degeneration in a rat model. Acta Biomater.86, 300–311. 10.1016/j.actbio.2019.01.028

  • 109

    ZubarevaA.IlyinaA.ProkhorovA.KurekD.EfremovM.VarlamovV.et al (2013). Characterization of protein and peptide binding to nanogels formed by differently charged chitosan derivatives. Molecules18, 7848–7864. 10.3390/molecules18077848

Summary

Keywords

peptide, coacervate, liquid liquid phase separation, self-assembly, complex assembly

Citation

Ma L, Fang X and Wang C (2023) Peptide-based coacervates in therapeutic applications. Front. Bioeng. Biotechnol. 10:1100365. doi: 10.3389/fbioe.2022.1100365

Received

16 November 2022

Accepted

12 December 2022

Published

04 January 2023

Volume

10 - 2022

Edited by

Chenxuan Wang, Chinese Academy of Medical Sciences and Peking Union Medical College, China

Reviewed by

Lixue Tang, Capital Medical University, China

Wenbo Zhang, Chinese Academy of Medical Sciences and Peking Union Medical College, China

Qing Liu, Kansai University, Japan

Updates

Copyright

*Correspondence: Xiaocui Fang, ; Chen Wang,

This article was submitted to Biomaterials, a section of the journal Frontiers in Bioengineering and Biotechnology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics