ORIGINAL RESEARCH article

Front. Pharmacol., 02 June 2021

Sec. Experimental Pharmacology and Drug Discovery

Volume 12 - 2021 | https://doi.org/10.3389/fphar.2021.685161

Discovery of New Potent anti-MERS CoV Fusion Inhibitors

  • 1. Department of Biomedical Sciences, College of Veterinary Medicine, King Faisal University, Al-Ahsa, Saudi Arabia

  • 2. Department of Pharmacology, Faculty of Veterinary Medicine, Kafrelsheikh University, Kafrelsheikh, Egypt

  • 3. Research Center for Asian Infectious Diseases, Institute of Medical Science, The University of Tokyo, Tokyo, Japan

  • 4. Division of Cellular and Molecular Biology, Department of Cancer Biology, Institute of Medical Science, University of Tokyo, Tokyo, Japan

  • 5. Department of Microbiology, Hallym University College of Medicine, Chuncheon, South Korea

  • 6. Division of Molecular Virology, Department of Microbiology and Immunology, The Institute of Medical Science, The University of Tokyo, Tokyo, Japan

  • 7. Department of Chemistry and Biomolecular Science, Faculty of Engineering, Gifu University, Gifu, Japan

  • 8. Senior Professor Office, The University of Tokyo, Tokyo, Japan

Abstract

Middle East respiratory syndrome coronavirus (MERS-CoV), capable of zoonotic transmission, has been associated with emerging viral pneumonia in humans. In this study, a set of highly potent peptides were designed to prevent MERS-CoV fusion through competition with heptad repeat domain 2 (HR2) at its HR1 binding site. We designed eleven peptides with stronger estimated HR1 binding affinities than the wild-type peptide to prevent viral fusion with the cell membrane. Eight peptides showed strong inhibition of spike-mediated MERS-CoV cell-cell fusion with IC50 values in the nanomolar range (0.25–2.3 µM). Peptides #4–6 inhibited 95–98.3% of MERS-CoV plaque formation. Notably, peptide four showed strong inhibition of MERS-CoV plaques formation with EC50 = 0.302 µM. All peptides demonstrated safe profiles without cytotoxicity up to a concentration of 10 μM, and this cellular safety, combined with their anti-MERS-CoV antiviral activity, indicate all peptides can be regarded as potential promising antiviral agents.

Introduction

The Middle East respiratory syndrome coronavirus (MERS-CoV) causes severe respiratory manifestations, including fever, persistent cough, and pneumonia, with occasional gastrointestinal symptoms such as vomiting, diarrhea, and death from renal failure (Assiri et al., 2013; Nassar et al., 2018). MERS-CoV is fatal for approximately one-third of people infected (Ahmadzadeh et al., 2020), which is regarded as a high fatality rate.

There is no vaccine or drug currently approved to prevent or treat MERS-CoV. The current preventative measures comprise avoidance of behaviors that lead to transmission and general health practices of handwashing, avoiding contact between the hands and the eyes and nose, and covering the nose and mouth when sneezing. Medical care comprises general supportive treatment of body organs and the use of previously known antivirals in combination with interferon (Sheahan et al., 2020). However, there is still no specific treatment produced specifically for MERS-CoV control.

The MERS-CoV genome produces four structural proteins: spike (S), membrane (M), envelope (E), and nucleocapsid (N). Fusion between the viral and cell membrane is accomplished by the two subunits of viral S protein (S1 and S2), important for completing the virus replication cycle (Bosch et al., 2003). The S1 subunit recognizes the host cell receptor, while S2 mediates the fusion process (Song et al., 2018; Hoffmann et al., 2020). Membrane fusion starts with the interaction of the HR1 and HR2 domains of S2, bringing the viral and cell membranes in proximity. Virus entry inhibitors, including attachment and fusion inhibitors, comprise an important class of antiviral drugs. Attachment inhibitors usually interfere with S binding to its receptors, which is more frequently affected by the high mutation rate (Xia et al., 2019). Fusion inhibitors interfere with the replication cycle following the attachment step and interfere with the consecutive steps of viral and cell membrane fusion. Therefore, fusion inhibitors remain an attractive strategy for discovering new antiviral drugs, especially as they affect conserved viral sequences.

Drug discovery trials against MERS-CoV comprised the production of monoclonal antibodies (Widjaja et al., 2019; Hussen et al., 2020) or repurposing previously utilized antiviral agents (Falzarano et al., 2013). In addition, a peptide sequence found in the HR2 region of wild-type MERS-CoV has been shown to have some inhibitory effect on MERS-CoV membrane fusion (Lu et al., 2014). However, this previous work has not resulted in new MERS-CoV inhibitors.

Our research group recently revealed the structure of new potential small inhibitors of the MERS-CoV fusion process by targeting cavities on the surface of HR1 (Kandeel et al., 2020). In this study, stronger fusion inhibitor peptides were designed by modification or mutation of the wild-type MERS-CoV HR2 domain, a portion of the fusion protein. The designed peptides inhibited spike protein-mediated MERS-CoV cell-cell fusion and MERS-CoV infection of cells. Thus, these peptides may be useful in preventing or treat MERS-CoV infection.

Material and Methods

Peptide Design

S2 HR2 was selected as the targeted peptide design site based on the findings of several studies targeting SARS-CoV, MERS-CoV, and HIV. These studies demonstrated that HR2-derived peptides were more potent than HR1 analogs (Liu et al., 2004; Lu et al., 2014; Shabane et al., 2019). In this study, the 36-amino acids wild-type HR2 peptide (Table 1, peptide 1 or SEQ ID NO: 1) was modified to obtain analogs demonstrating stronger inhibition of MERS-CoV replication (Accepted Patent, USPTO application no. 16/857136). This parent peptide was synthesized and used as a reference for comparison with the other eleven mutant peptides.

TABLE 1

NamePeptide sequence
Peptide 1 (WT)SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKEL
Peptide 2SLTQINTTLLDLTYEMLSLQQVVKALNESYIDLKHL
Peptide 3SLTQINTTLLDLTYEMKSLQQVVKALNESYIDLKEL
Peptide 4SLTQINWTLLDLTYEMESLQQVVKALNESYIDLKEL
Peptide 5SLTQINWTLLDLTYEMESLQQVVKALNEYYIDLKEL
Peptide 6SLTQINWTLLDLTYEMESLQQVVKALNEYYIDLKHL
Peptide 7SLTQINWTLLDLTYEMESLQQVMKALNEYYIDLKHL
Peptide 8SLTQINTTLLDLEYEMLSLQQVVKALNESYIDLKEL
Peptide 9SLTQINTTLLDLEYEMRSLQQVVKALNESYIDLKEL
Peptide 10SLTQINTTLLDLEYEMRSLEEVVKALNESYIDLKEL
Peptide 11SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDLKEL
Peptide 12SLTQINTTLLDLEYEMRSLEEVVKKLNESYIDEKEL

The sequence of peptides used in this study. The sites of WT peptide mutations are underlined.

Several computational trials were performed to optimize a new sequence related to peptide 1. Several systematic point mutations were initially generated for each amino acid in the peptide 1 sequence, providing 684 candidates with potentially improved binding energies between HR1 and HR2 (Dehouck et al., 2013). Several point mutations were then combined to yield peptides with a lower free energy of binding with HR1. Finally, eleven peptides were synthesized (Cambridge, ON, Canada, Table 1, Peptides 2-12 or SEQ ID NOs: 2-12). The peptides were purified by HPLC, and the exact mass was determined by mass spectrometry to ensure maximal purity.

Cell Lines and Virus

Two 293FT-based reporter cell lines that constitutively express individual split proteins (DSP1-7 and DSP8-11 proteins) were used for cell-cell fusion assays (Wang et al., 2014). The cells were maintained in Dulbecco’s modified Eagle’s medium (DMEM) containing 10% fetal bovine serum (FBS) and 1 g/ml puromycin.

Vero cells were purchased from the American Type Culture Collection (ATCC, Manassas, VA, United States) for the plaque assay. The cells were maintained in DMEM containing 10% FBS (Thermo Fisher Scientific, Waltham, MA, United States), 25 mm HEPES, 100 U/ml penicillin, and 100 μg/ml streptomycin.

MERS-CoV was obtained with permission from the Korea Centers for Disease Control and Prevention (CoV/KOR/KNIH/002_05_2015, Permission No. 1-001-MER-IS-2015001). MERS-CoV amplification and quantification were performed as described previously (Kandeel et al., 2020).

Dual Split Protein Assay to Monitor Middle East Respiratory Syndrome Coronavirus Membrane Fusion

MERS-CoV-S-mediated membrane fusion was quantitatively evaluated via DSP assay using 293FT cells as previously described (Yamamoto et al., 2016). The dimerization of DSP1-7 and DSP8-11 after cell-cell fusion can be quantified based on the values of fluorescence/luminescence upon formation of tight DSP complexes. The effector cells express MERS-CoV-S protein with DSP8-11, while the target cells express the MERS-CoV receptor and transmembrane serine protease 2 (TMPRSS2) with DSP1-7. The cells were grown in 10 cm culture dishes (4 × 106 cells/10 ml) 24 h before the assays. Cells were treated with 6 µM EnduRen (Promega, Madison, WI, United States), a substrate for Renilla luciferase, for 2 h to activate EnduRen. Each peptide was dissolved in dimethyl sulfoxide (DMSO) and added to 384-well plates (Greiner Bioscience, Frickenhausen, Germany), then 50 µl of each single-cell suspension (effector and target cells) was added to the wells using a Multidrop dispenser (Thermo Fisher Scientific). After incubation at 37°C for 4 h, luciferase activity was measured using a Centro xS960 luminometer (Berthold, Germany).

Plaque Assay After Treatment With Middle East Respiratory Syndrome Coronavirus Inhibitor Peptides and Cytotoxicity Studies

The plaque reduction assay was performed as reported previously (Kandeel et al., 2020). Briefly, Vero cells were cultivated on six-well plates for 12 h at 6 × 105 cells/well. In an initial study, MERS-CoV was mixed with each peptide at a final concentration of 10 µM for 30 min at 37 °C. The mixtures of MERS-CoV and each peptide were added to Vero cells in each well and then incubated for 1 h. The supernatants were subsequently removed, and DMEM/F12 medium (Thermo Fisher Scientific) containing 0.6% oxoid agar was transferred to each well. Four days after infection, plaque formation was observed by staining with crystal violet, and plaque numbers were counted. The plaque reduction assay was repeated in a dose-dependent manner using 2-fold serially diluted samples of Peptides 4, 5, or 6 to investigate the inhibitory properties of candidate peptides.

For the cytotoxicity assay, Vero cells (1 × 103 cells/well) were incubated in 96-well plates for 12 h. The peptides were dissolved in dimethyl sulfoxide (DMSO), and cells were treated with the peptides or DMSO only for three days. The proliferation of Vero cells was analyzed using Cell Counting Kit-8 (CCK-8) (Dojindo, Rockville, MD, United States). CCK-8 solution was added to each well and incubated for 4 h at 37 °C. CCK-8 absorbance was read at 450 nm using a microplate reader (Thermo Fisher Scientific).

Peptide Properties

Markers of peptide properties were computationally analyzed by CLC genomics software. The parameters included α-helix (residues range), α-helix%, counts of the negative charge, positive charge and non-charged residues, counts of hydrophobic, hydrophilic, other residues, and half-life in mammals.

Results

The Peptide Sequences

The site of peptide design is shown in Figure 1. The MERS-CoV S protein is composed of two subunits S1 and S2 (Figure 1A). The S2 subunits share in the membrane fusion process, and in the full fusion state, trimers of HR1 and HR2 form the fusion core (Figure 1B). The peptides were designed to target the HR1 cavity that binds HR2 during the fusion core formation. The designed peptides were 36 amino acids long, similar to the wild type HR2 or mutated with an estimated stronger binding with HR1. The site and alignment of peptides are provided in Figures 1C,D. The peptides contained from 1 to 10 amino acid mutations, with predicted improved binding with MERS CoV HR1. The upper diagonal panel in Figure 2 shows the number of amino acid differences between each peptide. The lower diagonal panel provides the % identity, between 72.22 and 97.22%. Peptides 9, 11, and 12 showed the largest differences in amino acid composition from the wild type.

FIGURE 1

FIGURE 2

DSP Assay for Middle East Respiratory Syndrome Coronavirus S-Mediated Cell-Cell Fusion

The strength of the 12 synthesized peptides on S protein-mediated MERS-CoV fusion was evaluated as previously established (Yamamoto et al., 2016). All peptides showed significant inhibition at 10 µM (Figure 3A), yet no peptide demonstrated direct inhibition of DSP reporter activity at 10 µM (Figure 3B). The peptides inhibited MERS-CoV fusion in a dose-dependent manner. The IC50 values were from the low nanomolar to the low micromolar range (Table 2). The most effective peptides were 11 and 12 (IC50 = 0.25 µM), followed by three peptides (#5, 8, and 10) with IC50 = 0.3–0.6 µM.

FIGURE 3

TABLE 2

PeptideEC50 (µM)
1 (SEQ. ID NO:1)1.3
2 (SEQ. ID NO:2)0.94
3 (SEQ. ID NO:3)0.93
4 (SEQ. ID NO:4)1.7
5 (SEQ. ID NO:5)0.58
6 (SEQ. ID NO:6)0.82
7 (SEQ. ID NO:7)2.3
8(SEQ. ID NO:8)0.34
9 (SEQ. ID NO:9)1.2
10 (SEQ. ID NO:10)0.48
11 (SEQ. ID NO:11)0.25
12(SEQ. ID NO:12)0.25

EC50 values of peptides determined by cell-cell fusion assay.

Plaque Inhibition Assay

The peptides were initially screened at 10 µM concentration in MERS-CoV plaque assay (Figure 4). All peptides inhibited MERS-CoV plaque formation. Based on the degree of plaque inhibition, three peptide classes were identified: strong, moderate, and weak inhibitors. Three peptides (Bosch et al., 2003; Bosch et al., 2003; Song et al., 2018; Sheahan et al., 2020) strongly reduced MERS-CoV plaque formation by more than 95%. Five other peptides, 2, 7, 10, 11, and 12, showed 69–74% inhibition of plaque formation. Peptides 1 and 3 showed a 64% decrease in MERS CoV replication. To quantitatively evaluate the effect of peptides on viral replication, the plaque assay was repeated at different concentrations of peptides 4, 5, and 6 using two-fold serially diluted concentration from 50 µM. As shown in Figure 5, MERS-CoV plaque formation decreased in a concentration-dependent manner.

FIGURE 4

FIGURE 5

Cytotoxicity and Viability

The cytotoxicity of peptides 4, 5 or 6, or DMSO (control) was examined in Vero cells for 3 days using concentrations up to 50 µM. No cytotoxicity was observed at or below 10 µM for any tested peptide (Figure 6). Thus, peptides 4, 5, and 6 have a safe cellular profile without cytotoxicity.

FIGURE 6

Molecular Properties of Peptides

The designed peptides computationally demonstrated stronger binding with MERS-CoV HR1. The peptides showed 1–6 mutations relative to the wild type. Despite the mutations, all peptides maintained high α-helix content with a constant residues range of 2–34 and a high helix content rate of 91.7% (Table 3). The negative and positive charged residues were in the ranges 4–9 and 2–4, respectively. Most of the peptide compositions were from the non-charged regions (23–30 residues).

TABLE 3

IDα-helix (residues range)α-helix %Counts of residuesFrequency of residues
Negative chargePositive chargeNon-chargedHydrophobicHydrophilicOtherHalf-life in mammals (h)
# 12–3491.75229151471.9
# 22–3491.74230151471.9
# 32–3491.75328141481.9
# 42–3491.76228151381.9
# 52–3491.76228151381.9
# 62–3491.75229151381.9
# 72–3491.75229151381.9
# 82–3491.76228151381.9
# 92–3491.76327141391.9
# 102–3491.783251411111.9
# 112–3491.784241311121.9
# 122–3491.794231211131.9

The protein structure statistics of the MERS CoV inhibitor peptides.

Discussion

Despite the emerging and fatal nature of MERS-CoV, structure-based drug discovery studies to combat this virus are very limited. Computational studies have substantially contributed to the drug discovery process, especially through lead identification and optimization (Koutsoukas et al., 2011). Small molecule inhibitors against several MERS-CoV targets were provided to the research community (Xia et al., 2014; Kumar et al., 2016; Galasiti Kankanamalage et al., 2018). Recently, we designed the first generation of small chemical MERS-CoV fusion inhibitor molecules (Kandeel et al., 2020). In addition, several designed peptides were proven efficient in inhibiting SARS-CoV-2 replication (Kandeel et al., 2021). Complementing these efforts were short peptides demonstrating stronger inhibition in the nanomolar range than the previously provided small molecules, which showed inhibition of MERS-CoV fusion in the low micromolar range. The discovery of new drugs and the design of novel vaccines are the two most powerful tools for controlling viral diseases. In this context, fusion inhibitors were a promising class of antiviral drugs extensively studied in treating influenza virus (Kadam et al., 2017), dengue virus (De La Guardia & Lleonart, 2014), respiratory syncytial virus (Feng et al., 2015), African swine fever virus (Hakobyan et al., 2018), measles virus (Welsch et al., 2013), HIV (Jing et al., 2002), SARS-CoV (Liu et al., 2004; Sainz et al., 2006; Chu et al., 2008; Liu et al., 2009), and MERS-CoV (Lu et al., 2014).

Recently, peptide-based therapeutics have contributed enormously in terms of improved stability and systemic bioavailability. The advantages of developing peptide drugs are their predictable and optimizable absorption distribution, metabolism, and excretion properties (Fosgerau & Hoffmann, 2015). The premise of using peptide drugs as fusion inhibitors has successfully delivered a clinical drug for treating HIV (Ding et al., 2017). Cell membranes and body barrier penetration have been improved using optimized amphipathic and α-helical peptides (Stalmans et al., 2015). More robust tools have been used to improve the oral bioavailability of therapeutic peptides, e.g., oral application of insulin-polyarginine conjugates (Morishita et al., 2007). Inhalable peptides were also used with promising results in treating pulmonary and systemic diseases (Greene et al., 2020; Waxman et al., 2021). These technologies offer a promising future for peptide drug development.

The spike-activated CoV entry into cells was proven to be by either direct membrane fusion or endocytosis (Seyedpour et al., 2020). In these entry paths, the viral spike must be activated by cellular proteases such as TMPRSS2 and cathepsin L for membrane fusion and endocytosis, respectively. The expression of TMPRSS2 in human tissues was found to be specific for each cell type (Sungnak et al., 2020; Ziegler et al., 2020). In mouse models, the spread of SARS-CoV and MERS-CoV was limited by a TMPRSS2-knockout (Iwata-Yoshikawa et al., 2019). In this study, the S-mediated dual split cell-cell fusion in 293FT cells was dependent on TMPRSS2 expression. Thus, these findings suggest that the peptides may inhibit the TMPRSS2-dependent plasma membrane fusion of MERS-CoV. The 293FT cell lines utilized were overexpressing TMPRSS2. As Vero cells lack expression of TMPRSS2, viruses enter by the endocytic pathway (Hoffmann et al., 2020). Therefore, the observed effect of peptides suggests the potential dual action of the peptides on both membrane fusion and endocytosis paths.

The selection of a peptide 36 amino acids in length was based on previous cell-cell fusion assays (Lu et al., 2014). In this study, the 36-mer peptide inhibited MERS-CoV S-mediated cell-cell fusion in the low nanomolar to the low micromolar range. In the drug discovery process, the binding of the fragment to its target is usually in the millimolar to micromolar range (Li, 2020). Current clinically used drugs operate within the micromolar range (Lomenick et al., 2009). Weak binding affinity has been defined as within the millimolar or high micromolar range (Li, 2020). Novel antiviral compounds with IC50 values in the low micromolar range are expected to be promising lead structures (Liu et al., 2004). One example is enfuvirtide, an FDA-approved fusion inhibitor of HIV-1 that showed extended IC50 values from 10 ng/ml to 7 μg/ml (2  nm–7 µM concentrations) (Greenberg, 2007). Based on these data, the reported peptides in our work could have clinical implications in controlling MERS-CoV infection.

The mechanism of action of fusion inhibitors is provided in Figure 7. The MERS-CoV S protein is composed of the S1 and S2 subunits (Figure 7A). The S1 subunit recognizes the host cell membrane through the receptor binding domain (RBD). After cleavage by host proteases, the fusion protein (FP) of S2 binds the host cell membrane in the presence of viral proteins across the host membrane (TM) and an intracellular portion called the cytoplasmic domain (CP). For fusion to occur, the host and viral membranes come in close apposition via the interaction of HR1 and HR2 (Figure 7C). The peptides developed in this study were designed to target a surface cavity on HR1, thus competing with HR2 for their binding sites on HR1 and preventing the viral fusion process.

FIGURE 7

Recent reports indicate that the improved α–helicity of HR2 in SARS-CoV-2 produced stronger fusion complexes with HR1, compared with SARS-CoV (Zhu et al., 2020). In addition, fusion peptides with enhanced α-helical content have been associated with higher antiviral efficacy (Sainz et al., 2006). In this study, all peptides showed similar α-helical content of 91.7% (Table 3). The strong MERS-CoV S-mediated inhibition we observed in the cell-cell fusion assays might be attributed to the combination of the improved energy of binding as well as the improved peptide α–helicity. Interestingly, a CoV HR2 derived peptide (HKU4-HR2P2) from a bat was able to inhibit MERS-CoV-mediated cell-cell fusion at a concentration of 380 nm (Xia et al., 2019). In another study, the EC50 of strong peptide P1 against MERS-CoV infection was 3.013 µM (Gao et al., 2013). Multiple systematic mutations with charged residues in MERS-CoV HR2 lead to the discovery of potent peptides that inhibited cell-cell fusion with IC50 values of 550–930 nm. Based on these data, the present peptides demonstrated notable potency by inhibiting cell-cell fusion at 250 nm concentration.

In conclusion, in the search for new anti-MERS-CoV agents, a structure-based approach was used to develop a MERS-CoV fusion protein inhibitor. A set of peptides were provided with potent inhibition of cell-cell fusion and MERS CoV replication. These peptides may be effective in optimizing specific anti-MERS CoV agents.

Statements

Data availability statement

The original contributions presented in the study are included in the article/Supplementary Material, further inquiries can be directed to the corresponding authors.

Author contributions

MK designed research, performed research, collected data, analyzed data, wrote the paper. MY performed research, collected data, analyzed data. AA-T Analyzed the data. BKP performed research, analyzed data. AW performed research, analyzed data. JG analyzed data. YK analyzed data. H-JK designed research, performed research, collected data, analyzed data, revised the paper. KO-h analyzed data. J-iI designed research, performed research, collected data, analyzed data, revised the paper.

Funding

This project is funded by the Deanship of Scientific Research at King Faisal University under Strategic projects track (Grant No. 171001). H-JK was supported by grants from the National Research Foundation (2016M3A9B6916708) funded by the Ministry of Science and ICT in the Republic of Korea. This work was supported in part by grants-in-aid from the Ministry of Education, Culture, Sports, Science, and Technology, Japan (16H06575 to JI), from the Japan Society for the Promotion of Science (18K15235 and 20K07610 to MY), and by the Japan Agency for Medical Research and Development (AMED) (Program of Japan Initiative for Global Research Network on Infectious Diseases (JGRID) JP20wm0125002 to MY, JG, and YK).

Acknowledgments

The authors acknowledge the Deanship of Scientific Research at King Faisal University for the financial support under Strategic projects track (Grant No. 171001).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  • 1

    AhmadzadehJ.MobarakiK.MousaviS. J.Aghazadeh-AttariJ.Mirza-Aghazadeh-AttariM.MohebbiI. (2020). The Risk Factors Associated with MERS-CoV Patient Fatality: A Global Survey. Diagn. Microbiol. Infect. Dis.96 (3), 114876. 10.1016/j.diagmicrobio.2019.114876

  • 2

    AssiriA.Al-TawfiqJ. A.Al-RabeeahA. A.Al-RabiahF. A.Al-HajjarS.Al-BarrakA.et al (2013). Epidemiological, Demographic, and Clinical Characteristics of 47 Cases of Middle East Respiratory Syndrome Coronavirus Disease from Saudi Arabia: a Descriptive Study. Lancet Infect. Dis.13 (9), 752761. 10.1016/s1473-3099(13)70204-4

  • 3

    BoschB. J.Van der ZeeR.De HaanC. A. M.RottierP. J. M. (2003). The Coronavirus Spike Protein Is a Class I Virus Fusion Protein: Structural and Functional Characterization of the Fusion Core Complex. J. Virol.77 (16), 88018811. 10.1128/jvi.77.16.8801-8811.2003

  • 4

    ChuL.-H. M.ChanS.-H.TsaiS.-N.WangY.ChengC. H.-K.WongK.-B.et al (2008). Fusion Core Structure of the Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV): In Search of Potent SARS-CoV Entry Inhibitors. J. Cel. Biochem.104 (6), 23352347. 10.1002/jcb.21790

  • 5

    De La GuardiaC.LleonartR. (2014). Progress in the Identification of Dengue Virus Entry/fusion Inhibitors. Biomed. Research International2014. 10.1155/2014/825039

  • 6

    DehouckY.KwasigrochJ. M.RoomanM.GilisD. (2013). BeAtMuSiC: Prediction of Changes in Protein-Protein Binding Affinity on Mutations. Nucleic Acids Res.41(Web Server issue), W333W339. 10.1093/nar/gkt450

  • 7

    DingX.ZhangX.ChongH.ZhuY.WeiH.WuX.et al (2017). Enfuvirtide (T20)-Based Lipopeptide Is a Potent HIV-1 Cell Fusion Inhibitor: Implications for Viral Entry and Inhibition. J. Virol.91 (18), e00831. 10.1128/jvi.00831-17

  • 8

    FalzaranoD.De WitE.RasmussenA. L.FeldmannF.OkumuraA.ScottD. P.et al (2013). Treatment with Interferon-Α2b and Ribavirin Improves Outcome in MERS-CoV-Infected Rhesus Macaques. Nat. Med.19 (10), 13131317. 10.1038/nm.3362

  • 9

    FengS.HongD.WangB.ZhengX.MiaoK.WangL.et al (2015). Discovery of Imidazopyridine Derivatives as Highly Potent Respiratory Syncytial Virus Fusion Inhibitors. ACS Med. Chem. Lett.6 (3), 359362. 10.1021/acsmedchemlett.5b00008

  • 10

    FosgerauK.HoffmannT. (2015). Peptide Therapeutics: Current Status and Future Directions. Drug Discov. Today20 (1), 122128. 10.1016/j.drudis.2014.10.003

  • 11

    Galasiti KankanamalageA. C.KimY.DamalankaV. C.RathnayakeA. D.FehrA. R.MehzabeenN.et al (2018). Structure-guided Design of Potent and Permeable Inhibitors of MERS Coronavirus 3CL Protease that Utilize a Piperidine Moiety as a Novel Design Element. Eur. J. Med. Chem.150, 334346. 10.1016/j.ejmech.2018.03.004

  • 12

    GaoJ.LuG.QiJ.LiY.WuY.DengY.et al (2013). Structure of the Fusion Core and Inhibition of Fusion by a Heptad Repeat Peptide Derived from the S Protein of Middle East Respiratory Syndrome Coronavirus. J. Virol.87 (24), 1313413140. 10.1128/jvi.02433-13

  • 13

    GreenbergM. L. (2007). Enfuvirtide: from Basic Science to FDA Approval. Entry Inhibitors HIV Ther.1, 161177. 10.1007/978-3-7643-7783-0_11

  • 14

    GreeneS. F.NikulaK. J.PoulinD.McInallyK.ReynoldsJ. A. (2020). Long-Term Nonclinical Pulmonary Safety Assessment of Afrezza, a Novel Insulin Inhalation Powder. Toxicol. Pathol.42, 334. 10.1177/0192623320960420

  • 15

    HakobyanA.GalindoI.NañezA.ArabyanE.KaralyanZ.ChistovA. A.et al (2018). Rigid Amphipathic Fusion Inhibitors Demonstrate Antiviral Activity against African Swine Fever Virus. J. Gen. Virol.99 (1), 148156. 10.1099/jgv.0.000991

  • 16

    HoffmannM.Kleine-WeberH.SchroederS.KrügerN.HerrlerT.ErichsenS.et al (2020). SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor. Cell181 (2), 271280.e8. 10.1016/j.cell.2020.02.052

  • 17

    HussenJ.KandeelM.HemidaM. G.Al-MubarakA. I. A. (2020). Antibody-Based Immunotherapeutic Strategies for COVID-19. Pathogens9 (11), 917. 10.3390/pathogens9110917

  • 18

    Iwata-YoshikawaN.OkamuraT.ShimizuY.HasegawaH.TakedaM.NagataN. (2019). TMPRSS2 Contributes to Virus Spread and Immunopathology in the Airways of Murine Models after Coronavirus Infection. J. Virol.93 (6). 10.1128/jvi.01815-18

  • 19

    JingS.ZhaoQ.DebnathA. (2002). Peptide and Non-peptide HIV Fusion Inhibitors. Curr. Pharm. Des.8 (8), 563580. 10.2174/1381612024607180

  • 20

    KadamR. U.JuraszekJ.BrandenburgB.BuyckC.SchepensW. B. G.KesteleynB.et al (2017). Potent Peptidic Fusion Inhibitors of Influenza Virus. Science358 (6362), 496502. 10.1126/science.aan0516

  • 21

    KandeelM.YamamotoM.TaniH.KobayashiA.GohdaJ.KawaguchiY.et al (2021). Discovery of New Fusion Inhibitor Peptides against SARS-CoV-2 by Targeting the Spike S2 Subunit. Biomol. Ther. (Seoul)29, 282. 10.4062/biomolther.2020.201

  • 22

    KandeelM.YamamotoM.Al-TaherA.WatanabeA.Oh-HashiK.ParkB. K.et al (2020). Small Molecule Inhibitors of Middle East Respiratory Syndrome Coronavirus Fusion by Targeting Cavities on Heptad Repeat Trimers. Biomolecules Ther.28 (4), 311319. 10.4062/biomolther.2019.202

  • 23

    KoutsoukasA.SimmsB.KirchmairJ.BondP. J.WhitmoreA. V.ZimmerS.et al (2011). From In Silico Target Prediction to Multi-Target Drug Design: Current Databases, Methods and Applications. J. Proteomics74 (12), 25542574. 10.1016/j.jprot.2011.05.011

  • 24

    KumarV.TanK.-P.WangY.-M.LinS.-W.LiangP.-H. (2016). Identification, Synthesis and Evaluation of SARS-CoV and MERS-CoV 3C-like Protease Inhibitors. Bioorg. Med. Chem.24 (13), 30353042. 10.1016/j.bmc.2016.05.013

  • 25

    LiQ. (2020). Application of Fragment-Based Drug Discovery to Versatile Targets. Front. Mol. Biosciences7, 180. 10.3389/fmolb.2020.00180

  • 26

    LiuI.-J.KaoC.-L.HsiehS.-C.WeyM.-T.KanL.-S.WangW.-K. (2009). Identification of a Minimal Peptide Derived from Heptad Repeat (HR) 2 of Spike Protein of SARS-CoV and Combination of HR1-Derived Peptides as Fusion Inhibitors. Antivir. Res.81 (1), 8287. 10.1016/j.antiviral.2008.10.001

  • 27

    LiuS.XiaoG.ChenY.HeY.NiuJ.EscalanteC. R.et al (2004). Interaction between Heptad Repeat 1 and 2 Regions in Spike Protein of SARS-Associated Coronavirus: Implications for Virus Fusogenic Mechanism and Identification of Fusion Inhibitors. The Lancet363 (9413), 938947. 10.1016/s0140-6736(04)15788-7

  • 28

    LomenickB.HaoR.JonaiN.ChinR. M.AghajanM.WarburtonS.et al (2009). Target Identification Using Drug Affinity Responsive Target Stability (DARTS). Proc. Natl. Acad. Sci.106 (51), 2198421989. 10.1073/pnas.0910040106

  • 29

    LuL.LiuQ.ZhuY.ChanK. H.QinL.LiY.et al (2014). Structure-based Discovery of Middle East Respiratory Syndrome Coronavirus Fusion Inhibitor. Nat. Commun.5, 3067. 10.1038/ncomms4067

  • 30

    MorishitaM.KameiN.EharaJ.IsowaK.TakayamaK. (2007). A Novel Approach Using Functional Peptides for Efficient Intestinal Absorption of Insulin. J. Controlled Release118 (2), 177184. 10.1016/j.jconrel.2006.12.022

  • 31

    NassarM. S.BakhrebahM. A.MeoS. A.AlsuabeylM. S.ZaherW. A. (2018). Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Infection: Epidemiology, Pathogenesis and Clinical Characteristics. Eur. Rev. Med. Pharmacol. Sci.22 (15), 49564961. 10.26355/eurrev_201808_15635

  • 32

    SainzB.Jr.MosselE. C.GallaherW. R.WimleyW. C.PetersC. J.WilsonR. B.et al (2006). Inhibition of Severe Acute Respiratory Syndrome-Associated Coronavirus (SARS-CoV) Infectivity by Peptides Analogous to the Viral Spike Protein. Virus. Res.120 (1-2), 146155. 10.1016/j.virusres.2006.03.001

  • 33

    SeyedpourS.KhodaeiB.LoghmanA. H.SeyedpourN.KisomiM. F.BalibeglooM.et al (2020). Targeted Therapy Strategies against SARS-CoV-2 Cell Entry Mechanisms: A Systematic Review of In Vitro and In Vivo Studies. J. Cel Physiol236, 2364. 10.1002/jcp.30032

  • 34

    ShabaneP. S.IzadiS.OnufrievA. V. (2019). General Purpose Water Model Can Improve Atomistic Simulations of Intrinsically Disordered Proteins. J. Chem. Theor. Comput.15 (4), 26202634. 10.1021/acs.jctc.8b01123

  • 35

    SheahanT. P.SimsA. C.LeistS. R.SchäferA.WonJ.BrownA. J.et al (2020). Comparative Therapeutic Efficacy of Remdesivir and Combination Lopinavir, Ritonavir, and Interferon Beta against MERS-CoV. Nat. Commun.11 (1), 114. 10.1038/s41467-019-13940-6

  • 36

    SongW.GuiM.WangX.XiangY. (2018). Cryo-EM Structure of the SARS Coronavirus Spike Glycoprotein in Complex with its Host Cell Receptor ACE2. PLoS Pathog.14 (8), e1007236. 10.1371/journal.ppat.1007236

  • 37

    StalmansS.BrackeN.WynendaeleE.GevaertB.PeremansK.BurvenichC.et al (2015). Cell-Penetrating Peptides Selectively Cross the Blood-Brain Barrier In Vivo. PloS one10 (10), e0139652. 10.1371/journal.pone.0139652

  • 38

    SungnakW.HuangN.HuangN.BécavinC.BergM.QueenR.et al (2020). SARS-CoV-2 Entry Factors Are Highly Expressed in Nasal Epithelial Cells Together with Innate Immune Genes. Nat. Med.26 (5), 681687. 10.1038/s41591-020-0868-6

  • 39

    WangH.LiX.NakaneS.LiuS.IshikawaH.IwamotoA.et al (2014). Co-expression of Foreign Proteins Tethered to HIV-1 Envelope Glycoprotein on the Cell Surface by Introducing an Intervening Second Membrane-Spanning Domain. PloS one9 (5), e96790. 10.1371/journal.pone.0096790

  • 40

    WaxmanA.Restrepo-JaramilloR.ThenappanT.RavichandranA.EngelP.BajwaA.et al (2021). Inhaled Treprostinil in Pulmonary Hypertension Due to Interstitial Lung Disease. N. Engl. J. Med.384, 325. 10.1056/NEJMoa2008470

  • 41

    WelschJ. C.TalekarA.MathieuC.PessiA.MosconaA.HorvatB.et al (2013). Fatal Measles Virus Infection Prevented by Brain-Penetrant Fusion Inhibitors. J. Virol.87 (24), 1378513794. 10.1128/jvi.02436-13

  • 42

    WidjajaI.WangC.van HaperenR.Gutiérrez-ÁlvarezJ.van DierenB.OkbaN. M. A.et al (2019). Towards a Solution to MERS: Protective Human Monoclonal Antibodies Targeting Different Domains and Functions of the MERS-Coronavirus Spike Glycoprotein. Emerging Microbes & Infections8 (1), 516530. 10.1080/22221751.2019.1597644

  • 43

    XiaS.YanL.XuW.AgrawalA. S.AlgaissiA.TsengC. K.et al (2019). A Pan-Coronavirus Fusion Inhibitor Targeting the HR1 Domain of Human Coronavirus Spike. Sci. Adv.5 (4), eaav4580. 10.1126/sciadv.aav4580

  • 44

    XiaS.LanQ.PuJ.WangC.LiuZ.XuW.et al (2019). Potent MERS-CoV Fusion Inhibitory Peptides Identified from HR2 Domain in Spike Protein of Bat Coronavirus HKU4. Viruses11 (1), 56. 10.3390/v11010056

  • 45

    XiaS.LiuQ.WangQ.SunZ.SuS.DuL.et al (2014). Middle East Respiratory Syndrome Coronavirus (MERS-CoV) Entry Inhibitors Targeting Spike Protein. Virus. Res.194, 200210. 10.1016/j.virusres.2014.10.007

  • 46

    YamamotoM.MatsuyamaS.LiX.TakedaM.KawaguchiY.InoueJ.-i.et al (2016). Identification of Nafamostat as a Potent Inhibitor of Middle East Respiratory Syndrome Coronavirus S Protein-Mediated Membrane Fusion Using the Split-Protein-Based Cell-Cell Fusion Assay. Antimicrob. Agents Chemother.60 (11), 65326539. 10.1128/aac.01043-16

  • 47

    ZhuY.YuD.YanH.ChongH.HeY. (2020). Design of Potent Membrane Fusion Inhibitors against SARS-CoV-2, an Emerging Coronavirus with High Fusogenic Activity. J. Virol.94 (14). 10.1128/jvi.00635-20

  • 48

    ZieglerC. G. K.AllonS. J.NyquistS. K.MbanoI. M.MiaoV. N.TzouanasC. N.et al (2020). SARS-CoV-2 Receptor ACE2 Is an Interferon-Stimulated Gene in Human Airway Epithelial Cells and Is Detected in Specific Cell Subsets across Tissues. Cell181 (5), 10161035.e19. 10.1016/j.cell.2020.04.035

Summary

Keywords

coronavirus, MERS-CoV, fusion inhibitors, antivirals, drug discovery

Citation

Kandeel M, Yamamoto M, Park BK, Al-Taher A, Watanabe A, Gohda J, Kawaguchi Y, Oh-hashi K, Kwon H-J and Inoue J (2021) Discovery of New Potent anti-MERS CoV Fusion Inhibitors. Front. Pharmacol. 12:685161. doi: 10.3389/fphar.2021.685161

Received

24 March 2021

Accepted

06 May 2021

Published

02 June 2021

Volume

12 - 2021

Edited by

Abdur Rauf, University of Swabi, Pakistan

Reviewed by

Oscar Herrera-Calderon, Universidad Nacional Mayor de San Marcos, Peru

Naveed Muhammad, Abdul Wali Khan University Mardan, Pakistan

Updates

Copyright

*Correspondence: Mahmoud Kandeel, ; Hyung-Joo Kwon, ; Jun-ichiro Inoue,

This article was submitted to Experimental Pharmacology and Drug Discovery, a section of the journal Frontiers in Pharmacology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics