Abstract
Proteasomes catalyze the degradation of endogenous proteins into oligopeptides, but can concurrently create spliced oligopeptides through ligation of previously non-contiguous peptide fragments. Recent studies have uncovered a formerly unappreciated role for proteasome-catalyzed peptide splicing (PCPS) in the generation of non-genomically templated human leukocyte antigen class I (HLA-I)-bound cis-spliced peptides that can be targeted by CD8+ T cells in cancer and infection. However, the mechanisms defining PCPS reactions are poorly understood. Here, we experimentally define the biochemical constraints of proteasome-catalyzed cis-splicing reactions by examination of in vitro proteasomal digests of a panel of viral- and self-derived polypeptide substrates using a tailored mass-spectrometry-based de novo sequencing workflow. We show that forward and reverse PCPS reactions display unique splicing signatures, defined by preferential fusion of distinct amino acid residues with stringent peptide length distributions, suggesting sequence- and size-dependent accessibility of splice reactants for proteasomal substrate binding pockets. Our data provide the basis for a more informed mechanistic understanding of PCPS that will facilitate future prediction of spliced peptides from protein sequences.
Introduction
Proteasomes are multi-subunit enzyme complexes in eukaryotic cells that selectively degrade “unwanted” endogenous proteins into oligopeptides. Their activity is important for protein quality control and for regulation of many intracellular processes including cell cycle progression, signaling pathways and transcription (1). The oligopeptides generated by proteasomes can be degraded to provide a source of amino acids (aas) for protein synthesis, but a subset of these peptides is translocated from the cytoplasm into the endoplasmic reticulum (ER) by the transporter associated with antigen presentation (TAP), where they may associate with newly-synthesized human leukocyte antigen class I (HLA-I) molecules (2). Peptide-loaded HLA-I molecules then traffic to the cell surface for display to CD8+ T cells, enabling immunosurveillance of tumors and infected cells.
The peptides comprising the cellular HLA-bound repertoire (the immunopeptidome) were classically thought to be contiguous sequences originating from self- or foreign proteins. However, following initial anecdotal reports of recognition of non-templated peptides generated by proteasome-catalyzed “cut-and-pasting” of non-contiguous fragments of a polypeptideby tumor-specific CD8+ T cells (3–5), increasing evidence has accumulated to support the concept that proteasome-catalyzed peptide splicing (PCPS) reactions comprise an additional source of peptides that can be presented on HLA-I molecules for CD8+ T cell recognition (6–14). In addition to generating peptides composed of fragments from within the same protein/polypeptide via cis-splicing, proteasomes have also been suggested to catalyze trans-splicing of fragments from polypeptides derived from separate proteins in vitro (14). However, the contribution of trans-spliced peptides to the immunopeptidome remains controversial and no examples of CD8+ T cell recognition of trans-spliced epitopes have been reported to date, leaving the in vivo significance of proteasome-catalyzed trans-splicing unclear. Interestingly, CD4+ T cell recognition of HLA-II-bound epitopes composed of proinsulin peptides fused to other peptides present in beta-cell secretory granules has been implicated in the pathogenesis of diabetes (15), although the enzyme(s) responsible for the generation of these spliced epitopes were not identified.
The constitutive proteasome (CP) and the immunoproteasome (IP) both mediate PCPS reactions (6, 7), and the thymoproteasome has recently also been shown to do so (16). PCPS is initiated at proteasomal active sites by catalytic threonine residues which perform nucleophilic attack on carbonyl groups within an unfolded polypeptide chain, and can occur in either a forward or reverse sense (5, 6, 8, 17). This forms an acyl-enzyme intermediate (contained in the N-terminal portion of the final spliced peptide) which is tethered to the proteasome by an ester linkage (18). Nucleophilic attack of the acyl-enzyme intermediate by a free amine group liberated by proteasomal cleavage of a non-adjacent peptide fragment within the precursor substrate then hydrolyses the ester linkage, appending the C-terminal portion of the final spliced peptide product (4). This process is likely to be governed by inherent properties of each proteasomal active site as well as those of the constituent splice partners such as sequence, length, and affinity for the substrate binding sites.
Although progress has been made in understanding proteasomal cleavage specificities during events generating non-spliced peptides (16, 19, 20), the physical constraints and biochemical preferences governing peptide splicing reactions remain undefined. Systematic analysis of PCPS reactions generating a source of peptides for HLA-I presentation has been hindered by the limited number of fully-validated spliced epitopes identified to date. The only study attempting to experimentally assign preferred “rules” for PCPS was limited by its restriction to the binding preferences of HLA-A*02:01, and only considered the ligation efficiency of N- and C-terminal sequence variants of fixed lengths in a single 9-mer peptide (21).
Here, by employing a liquid chromatography tandem mass spectrometry (LC–MS/MS)-based de novo sequencing workflow to analyze the in vitro digestion products of a panel of 25 unique polypeptide substrates by the 20S CP, we have experimentally elucidated the biochemical characteristics of cis-PCPS reactions. We document preferred splice partner length distributions, cis-splicing distances, and amino acid enrichments proximal to splice sites that are specifically attributable to 20S proteasomal activity and not confounded by other in cellulo antigen processing events, thus shedding light on the biochemical constraints inherent in both forward and reverse cis-PCPS reactions. Elucidation of these splicing signatures will enable refinement of a mechanistic basis for PCPS, with the eventual aim of facilitating the prediction of spliced peptides from protein sequences to enable investigation of their roles in antigen presentation and putative contribution to broader aspects of cell biology.
Materials and Methods
Synthetic Peptides
Ten peptides derived from the sequences of NL4.3 or IIIB laboratory-adapted human immunodeficiency virus type 1 (HIV-1) strains or patient viruses, 13 “self” peptides from different human protein sequences from the SwissProt Homo sapiens reference proteome and two polypeptides originating from a publicly available sORF database (22) (Table 1) were employed as substrates for proteasomal digestion. Peptides were synthesized by Genscript (USA) using Fmoc solid phase chemistry.
Table 1
| Polypeptide ID | Protein ID | Sequence | Length (aa) |
|---|---|---|---|
| PP1 | sORF-encoded polypeptide: APITD1 | SSCLPCPLSFEKFK | 14 |
| PP2 | Q92879: CUGBP Elav-like family member 1 | EGCSSPMVVKFADTQK | 16 |
| PP3 | Q5CZC0: Fibrous sheath-interacting protein 2 | LVSIQKSIVSRSPIMIDQ | 18 |
| PP4 | P15882: N-chimerin | LTSLVRRATLKENEQIPK | 18 |
| PP5 | sORF-encoded polypeptide: CD81 | LPRFESRVCGHSLPSCTCP | 19 |
| PP6 | HIV-1 CH529 enr: Vif | DQLIHLYYFDCFSESAIRK | 19 |
| PP7 | P37275: Zinc finger E-box-binding homeobox 1 | SLIPVNGRPRTGLKTSQCS | 19 |
| PP8 | Q8TDU5: Putative vomeronasal receptor-like protein 4 | HLPLIHILLLFTQAILVSS | 19 |
| PP9 | HIV-1 IIIB: Vif | ALIKPKQIKPPLPSVRKLTE | 20 |
| PP10 | HIV-1 CH390 enr: Vif | TADQLIHLYYFDCFSESAIRK | 21 |
| PP11 | Q9NW13: RNA-binding protein 28 | IRNLSFKCSEDDLKTVFAQFGA | 22 |
| PP12 | HIV-1 CH945 enr: Vif | LADQLIHLYHFDCFTESAIRNA | 22 |
| PP13 | HIV-1 CH945 enr: Vif mutant | LQPQLIHLYYFDCFSESAIRK | 22 |
| PP14 | HIV-1 NL4-3: Gag | FGEETTTPSQKQEPIDKELYPLA | 23 |
| PP15 | HIV-1 NL4-3: Gag | AAMQMLKETINEEAAEWDRLHPVHA | 25 |
| PP16 | P46013: Antigen KI-67 | KSWADVVKLGAKQTQTKVIKHGPQR | 25 |
| PP17 | Q00887:Pregnancy-specific beta-1-glycoprotein 9 | EMTDLYHYIISYIVDGKIIIYGPAY | 25 |
| PP18 | HIV-1 IIIB: Cryptic ORF | VAAPRLLPCALQQAESCVERSPLALLS | 27 |
| PP19 | P47989: Xanthine dehydrogenase/oxidase | PRKQLRFEGERVTWIQASTLKELLDLK | 27 |
| PP20 | Q92608: Dedicator of cytokinesis protein 2 | YLDTSSRGEQCEPILRTLKALEYVFKFI | 28 |
| PP21 | Q5T7P8: Synaptotagmin-6 | KLKDPSTLGFLEAAVKISHTSPDIPAEVQM | 30 |
| PP22 | HIV-1 NL4-3: Pol | AELELAENREILKEPVHGAYYDPSKDLIAEL | 31 |
| PP23 | Q14894: Thiomorphine-carboxylate dehydrogenase | ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNG | 34 |
| PP24 | HIV-1 NL4-3: Pol | IRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVAS | 44 |
| PP25 | Q9H8V3: Protein ECT2 | KALKTIKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESV | 47 |
Synthetic polypeptides subjected to in vitro proteasomal digestion.
In vitro Proteasomal Digests
For constitutive proteasomal digests, 5 μg of synthetic polypeptide were incubated with 500 ng of the 20S constitutive proteasome (CP) (Enzo Life Sciences) in 20 mM 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid (HEPES) (pH 7.8), 5 mM magnesium chloride, 2 mM dithiothreitol (DTT) for 2 or 20 h at 37°C. Control incubations (lacking the CP) were performed for each peptide in parallel. Following incubation, reactions were terminated by addition of 5 μL of acetic acid, and digest material was bound to a C18 ZipTip column (Merck), eluted in 30% acetonitrile (ACN) in 5% trifluoroacetic acid (TFA), dried down and resuspended in 20 μL LC–MS/MS loading buffer (1% ACN, 0.1% TFA in water).
LC–MS/MS Analysis
1 μL of each digest sample was injected onto a 3 μm particle size 0.075 mm x 150 mm PepMap C18 trap column followed by loading onto a 2 μm particle size, 75 μm x 50 cm analytical column on the Ultimate 3,000 nUPLC system (Thermo Scientific). A gradient was applied for 30 min from 8 to 50% buffer B (0.1% TFA in 100% ACN) in buffer A (1% ACN, 0.1% TFA in water). Peptides were introduced to the Fusion Lumos mass spectrometer (Thermo Scientific) using an Easy-Spray source at 2,000 V and 40°C. The ion transfer tube temperature was set to 305°C. Full MS spectra were recorded from 300–1,500 m/z in the Orbitrap at 120,000 resolution with an automatic gain control (AGC) target of 400,000. Precursor selection was performed using Top Speed mode at a cycle time of 2 s. Peptide ions were isolated using a width of 1.2 amu, followed by trapping at a maximal injection time of 120 ms, setting an AGC target of 300,000. Higher-energy collisional dissociation (HCD) fragmentation was induced at an energy setting of 28 for peptides with a charge state of 2–4, while singly charged peptides were fragmented at an energy setting of 32 at lower priority. Fragments were analyzed in the Orbitrap at 30,000 resolution.
Discovery Workflow for Identification of Non-spliced and Spliced Peptides
PEAKS v8.0 (Bioinformatic Solutions) software was employed for the analysis of all LC–MS/MS datasets (.raw files). Matching against precursor polypeptide sequences was conducted without enzyme specification, using a mass tolerance precursor setting of 5 ppm for peptides and 0.03 Da for fragment ions. PEAKS de novo assisted sequencing was implemented for the assignment of non-spliced peptides derived from individual polypeptide sequences following proteasomal digest of each of the 25 precursor substrates, and no PTMs were included in the de novo search space. A false discovery rate of 5% was set using a parallel decoy database search. Following matching of spectra to respective polypeptide sequences, MS/MS spectra assigned as post-translationally modified or originating from the 20S CP were removed from the analysis, as were peptides assigned a PEAKS-10lgP score of <20, yielding a final list of non-spliced peptide sequences.
For identification of spliced peptides, a tailored bioinformatics workflow was employed similar to that previously described (9). De novo sequences originating from peptide spectra with average local confidence (ALC) scores of ≥50% that did not match contiguous sequences within the polypeptide precursors were considered. These were termed “de novo unmatched peptides” (DNUPs), and only the top 5 scoring sequence interpretations for each scan were included in the analysis. As the mass:charge ratios of leucine (L) and isoleucine (I) are identical, LC–MS/MS cannot differentiate between L and I residues within peptides. Hence, PEAKS de novo sequencing reports all L or I residues as Ls. Therefore, for DNUPs containing a total of ‘n' leucine residues, all permutations (2n) of L/I variants were computed prior to in silico splicing – e.g. for de novo sequence LTSLTLKE originating from polypeptide precursor LTSLVRRATLKENEQIPK, 23 combinations of the original de novo sequence would be computed (LTSLTLKE, LTSITLKE, ITSLTLKE, LTSLTIKE, LTSITIKE, ITSLTIKE, ITSITLKE, ITSITIKE) and each sequence input to the splicing algorithm. If a match to a contiguous polypeptide sequence within the SwissProt proteome resulted following L/I permutations, the whole LC–MS/MS spectrum/scan was removed from the analysis.
In silico splicing of the resulting DNUP sequence interpretations in each scan was then implemented. Briefly, each DNUP of length “n” amino acids was split into two fragments from (n−1) aa to 1 aa. The (n-1)th fragment was first scanned for a contiguous match across the polypeptide, and when found, its corresponding splice partner fragment was scanned for a contiguous match within the remainder of the polypeptide sequence. Due to the lack of an applied false discovery rate (FDR) for identification of spliced peptides from de novo sequencing of LC-MS/MS spectra that were not matched to a pre-defined database, very short spliced peptide sequences (5-7 aa) were omitted from analysis, and only sequences with a length of 8 aa or greater were considered. Trans-spliced peptides were omitted from the analysis. Contiguous and spliced peptides identified in control experiments involving incubation of polypeptides without the 20S CP were removed prior to further data analysis, to exclude degradation products that may not arise directly from proteasome-induced hydrolysis.
Data Analysis
Data analysis, plotting, and determination of statistical significance was implemented using Graphpad Prism version 8.0. Non-spliced peptide identifications were retrieved from PEAKS PTM searches and corresponding LC–MS/MS intensity values were extracted to plot abundance comparisons. For extraction of abundance values for de novo sequenced cis-spliced peptides, matching of scan number and m/z value for a given identified cis-spliced peptide (obtained from the all de novo candidates PEAKS file) was implemented to extract corresponding intensity values from the de novo output. Peptide length and fragment length distributions were plotted using Prism, and peptide splicing heat maps were generated using gnuplot version 5.2.4.
Statistical Analysis
Unless otherwise stated, two-tailed unpaired Mann–Whitney t-tests were carried out to assess the statistical significance of differences between groups using GraphPad Prism v8.0. Differences were considered statistically significant at a P-value of <0.05.
Results
The Relative Proportions of Unique Non-spliced and Cis-Spliced Peptides Generated by the Constitutive Proteasome Are Dependent on Precursor Peptide Length
To enable characterization of non-spliced and cis-spliced peptides generated by the 20S CP, 25 unique polypeptides (14–47 aa long, median = 22 aa) were individually incubated with the CP for 2 or 20 h at 37°C. Of the 25 polypeptides studied, 10 were derived from the clinically-important viral pathogen HIV-1, 13 were “self” peptides derived from human protein sequences in the SwissProt reference proteome, and 2 originated from a publicly available short open reading frame database (22) (Table 1). The total amino acid content of these polypeptides closely reflected that of the combined HIV-1 and human proteomes (Table 2). Following digestion, purification, and de novo sequencing of proteolytic products from precursor substrates by MS, identification of both contiguous and spliced peptide products was achieved using a bioinformatics workflow (9), adapted as described in Materials and Methods section. Control digestion reactions (lacking the CP) were conducted in parallel to enable removal of background products arising from non-proteasomal polypeptide degradation or peptide synthesis artifacts.
Table 2
| Amino acida | Frequency in polypeptides (%) | Frequency in combined HIV-1/human proteomes (%) |
|---|---|---|
| A | 7.16 | 8.25 |
| C | 2.65 | 1.37 |
| D | 4.56 | 5.45 |
| E | 7.49 | 6.75 |
| F | 4.23 | 3.86 |
| G | 3.09 | 7.07 |
| H | 2.76 | 2.27 |
| I | 7.65 | 5.96 |
| K | 8.31 | 5.84 |
| L | 11.24 | 9.66 |
| M | 1.63 | 2.42 |
| N | 1.63 | 4.06 |
| P | 6.19 | 4.7 |
| Q | 4.40 | 3.93 |
| R | 4.23 | 5.53 |
| S | 8.31 | 6.56 |
| T | 4.89 | 5.34 |
| V | 5.86 | 6.87 |
| W | 0.65 | 1.08 |
| Y | 3.09 | 2.92 |
Amino acid frequencies within synthetic polypeptides and combined HIV-1 and UniProt human proteomes.
Amino acids are denoted using single letter code.
To assess the degradation of each polypeptide, we compared the abundance (as determined from LC–MS/MS intensity values) of the precursor substrates digested by the CP at the 2 and 20 h time points, and expressed these as a ratio of the abundance of undigested precursor (incubated without CP) at 2 h. It was observed that overall, the undigested precursors underwent a significant decrease in abundance from 2 to 20 h (Supplementary Figure 1A), indicating that saturation of available cleavage sites was not achieved at the 2 h time point in our study. We also assessed the abundance of the shortest non-spliced peptides (5–8-mers) derived from each polypeptide substrate between the 2 and 20 h time points. Here, we observed a significant increase in the median abundance of the shortest products at 20 h, showing that more efficient substrate degradation was achieved by this time point (Supplementary Figure 1B). In addition, we observed a 4.5% increase in diversity of non-spliced peptides at 20 h (Supplementary Figure 1C). However, the 2 h time point was selected for analysis in order to minimize potential proteasomal re-entry of cleavage products and ensuing trans-splicing events, which could confound characterization of cis-splicing products.
The full repertoire of unique spliced and non-spliced peptides generated following a 2 h proteasomal digest is presented in Supplementary Tables 1, 2. Overall, we observed a total of 1,200 unique non-spliced (72.9%) and 446 cis-spliced (27.1%) peptides (Figure 1A). The relative proportions of spliced and non-spliced peptides within all unique peptide products at the 2 h time point were mirrored at the 20 h time point, where 1,270 unique non-spliced (73.1%) and 469 cis-spliced (26.9%) peptides were observed (Supplementary Figure 1D), indicating that spliced peptide generation was not under-estimated by consideration of the earlier 2 h time point. Interestingly, however, although non-spliced peptides predominated overall, with spliced peptides constituting only approximately a quarter of the unique peptides generated, spliced peptides constituted almost half (47.6% at the 2 h time point) of all unique peptides generated following digestion of the 12 shortest polypeptide precursors (14–22 aa) (Figure 1A). Furthermore, within the digestion products from precursors of all lengths, when peptide fragments containing the N- or C-terminal aa of the original polypeptide and those generated from within the polypeptide substrate (that did not then contain the N- or C-terminal aa residues) were considered separately, spliced peptides constituted a markedly lower proportion of all unique peptides in the latter category, but constituted approximately half of the peptide products containing one of the original peptide termini (Supplementary Figure 1E). Together, these results suggest that a substantially greater diversity of non-spliced than spliced peptides may be generated as long polypeptides derived from ubiquitinated protein substrates are digested by the proteasome within cells.
Figure 1
Comparison of the relative abundance (based on LC–MS/MS intensity values) of the spliced and non-spliced peptides generated from all 25 precursor polypeptides following an in vitro 2 h proteasomal digest revealed that the median abundance of the non-spliced peptide products was significantly greater than that of the spliced peptide products (Figure 1B), suggesting that, at least in vitro, the relative efficiency of generation of non-spliced peptides is greater. Notably, the relative abundance of non-spliced peptides containing one of the terminal aas of the precursor polypeptide was significantly higher than that of peptide products generated from within the precursor (Supplementary Figure 1F). This is likely because non-spliced peptides containing the N- or C-termini of parental polypeptides can be generated by just a single excision event, and if higher concentrations of these peptide fragments are present they may then be preferentially incorporated into splicing events in vitro. However, no significant difference was observed in the median abundance of terminal amino acid-containing spliced peptides and those generated solely from within the substrate. Thus, to limit potential bias introduced in determination of PCPS signatures introduced by the differential frequencies of amino acid residues comprising the start and end of each polypeptide precursor (Table 1), both non-spliced and spliced peptides containing the precursor N- or C-terminal amino acid residues were excluded from subsequent analyses. Most of the splicing parameters described below remained consistent irrespective of whether analyses were performed with or without these, and any minor differences observed are noted.
Cis-Spliced Peptides Follow a Narrower Length Distribution Than Non-spliced Peptides
Comparison of the length distributions of cis-spliced and non-spliced peptides revealed that PCPS reactions generated peptides with a narrower length distribution than hydrolysis events generating non-spliced peptides (Figure 1C). For spliced peptides, 90% of PCPS reactions generated products that were 14 aa or smaller. In contrast, the 90th percentile length for non-spliced peptides was 20 aa (Figure 1C). When both spliced and non-spliced peptides containing one of the terminal amino acids of the precursor were included, the respective 90th percentile length values were 17 aa (for spliced) and 22 aa (for non-spliced) peptides (Supplementary Figure 2A). To demonstrate that this distribution was not biased by the median length (22 aa) of the precursor polypeptides studied, the length distributions of cis-spliced and non-spliced peptides derived from just the 5 longest precursors (30–47 aa) were considered. Here we observed very similar trends, where 90% of spliced peptide products were 17 aa or shorter, while the corresponding 90th percentile for non-spliced peptides was 24 aa (Supplementary Figure 2B). Overall, our results thus indicate that cis-PCPS reactions are typically biased toward the generation of a larger proportion of shorter peptides than canonical cleavage events giving rise to non-spliced peptides. Hence, we next sought to address whether constraints such as splice partner length or other physical and biochemical factors governing splicing reactions could be identified, and whether these differed between forward and reverse cis-PCPS reactions.
Forward and Reverse Cis-Splicing Events Demonstrate Unique Preferences for N- and C-Terminal Splice Partner Lengths
Cis-PCPS reactions occur in either a forward or reverse sense as illustrated in Figure 2A. To characterize the physical and biochemical properties pertaining to each type of PCPS reaction, we separated the spliced peptides identified into forward and reverse spliced subsets. Forward and reverse spliced peptides constituted similar proportions of all unique spliced peptides (48.1% forward vs. 51.8% reverse spliced) (Figure 2B). Both sets of spliced peptides also displayed similar length distributions, indicating that both reactions predominantly generated peptides of 8–15 aa in length (Figure 2C). Furthermore, we found no significant difference in the median abundance of forward and reverse spliced peptides (Figure 2D), indicating that both forward and reverse spliced peptides can be generated with similar efficiency by the CP in vitro.
Figure 2
In both types of PCPS reaction, N-terminal splice reactants were found to comprise many fragments of shorter lengths (2–5 aa) (80% in forward and 66.6% in reverse spliced peptides), while longer splice reactants (6–12 aa) constituted a high proportion of the C-terminal fragments of the full-length spliced peptides (Figure 2E). When we considered only the 5 longest precursors, we found that the fragment length distributions of forward and reverse spliced peptides were not biased by the selected polypeptide lengths, as only 12/75 (16%) of the splice partners in peptides generated from these substrates were >10 aa long (Supplementary Figure 3A). This broadly reflected the overall distribution of splice partner fragments in Figure 2E, where 10.4% of the spliced partners were >10 aa in length.
Cis-Splicing Events Are Biased Toward Splicing Over Shorter Intervening Distances Within Polypeptide Substrates
Although cis-PCPS reactions as a whole were found to occur preferentially over shorter distances (Figure 2F), differences were observed in the preferred intervening cis-splicing distances between forward and reverse PCPS reactions. Forward spliced peptides demonstrated a more marked preference for shorter cis-splicing distances, with the majority of splicing events (63%) involving excision of 1–2 aa and a further 18.5% occurring over cis-splicing distances of 3–8 aa. In contrast, only 10% of reverse PCPS events occurred over a distance of 1–2 aa within the polypeptide, with the proportion of PCPS events spanning a 3–8 aa gap increasing to 38.6%, and 37.1% of events occurring over still longer distances. Notably, we also observed that 14.3% of reverse spliced peptides occurred with no intervening distance between splice reactants (i.e., 0 aa) (Figure 2F). For the 5 longest polypeptides (30–47 aa) undergoing proteolysis, 10/37 (27%) of forward and 23/38 (60.5%) of reverse PCPS reactions occurred at a distance of >8 aa (Supplementary Figure 3B). These values were greater than the proportions for each class of spliced peptide generated at a cis-splicing distance of >8 aa observed across the entire substrate panel (18.4% for forward spliced and 37.1% for reverse spliced peptides). Thus, by using precursor polypeptides of moderate length, we may be underestimating the distances over which cis-PCPS can occur in vivo during the degradation of ubiquitinylated proteins.
Proteasomal Cleavage Signatures in Canonical Hydrolysis and PCPS Reactions Demonstrate Preferences for Particular Residues
Next, we analyzed the overall frequency of cleavage after each of the 20 amino acid residues across the 25 synthetic polypeptides following both canonical hydrolysis and PCPS reactions. Global cleavage frequencies were first obtained by incorporating all cleavage sites for each set of peptides—i.e., 2 sites for non-spliced, 3 or 4 sites for reverse spliced (depending on the intervening sequence length between splice partners) and 4 sites for forward spliced peptides. These cleavage sites are denoted by red bars in Figure 3A. Amino acid frequencies were then normalized relative to the overall frequency of that amino acid within all 25 precursor polypeptides in order to ascertain whether enrichment of cleavage after particular residues was evident (Figure 3B). For non-spliced peptides, cleavage after certain amino acids (A, D, E, F, G, H, I, L, M, V, and W) was higher than would be expected given their overall frequency within the substrate precursors.
Figure 3
However, for spliced peptides, cleavage preferences were more restricted, with F, I, M, N, V, W, and Y residues being over-represented relative to their respective frequencies in the substrate precursors. Furthermore, because PCPS is characteristically thought to involve nucleophilic attack of a stable acyl-enzyme intermediate by the free amine group of a non-adjacent amino acid sequence, we next sought to identify amino acid residues predominantly participating as either acyl-enzyme intermediates, denoted in Figure 3A by X1 or X2 (for forward and reverse spliced peptides respectively), or nucleophilic free amines (denoted as Z1 or Z2 for forward and reverse spliced peptides). Here, we observed differences between each reaction (Figures 3C–D). During reverse PCPS, E, F, G, I, N, and S predominantly acted as anchor residues for stable acyl-enzyme intermediates, while D, F, G, K, M, N, V, W, and Y were typically favored in forward splicing reactions (Figure 3C). Residues involved in nucleophilic attack of the N-terminal fragments were more restricted, with N specifically favored in reverse splicing reactions and M, N, and W preferred in forward PCPS (Figure 3D). Importantly, however, in addition to cleavage site residues, because proximal amino acids within splice partners would also dictate the affinity of each fragment for particular substrate binding pockets, we sought to determine preferred splice site signatures that may elaborate on the sequence-dependent accessibility of splice partners in forward and reverse PCPS reactions.
Unique Splice Site Signatures Are Observed in Forward and Reverse Splicing Reactions
To elucidate preferred splice site signatures, amino acid pairing combinations ± 3 residues from the fusion junction were determined. To avoid bias introduced by potential re-inclusion of proximal amino acids from multiple unique splicing events that may share the same 3 amino acids at the fusion junction (e.g., [NMD]–[KVGFVKME] and [INMD]–[KVGFVKM]), only one of the splicing events was considered to deduce the biochemical characteristics of N- and C-terminal splice partners preferentially accommodated within substrate binding pockets during PCPS (Figure 4A). Here, distinct patterns were observed for forward and reverse PCPS reactions (Figures 4B,C). In forward PCPS reactions, immediately proximal to the fusion junction at [P1]–[P1′] we observed preferred [P1]–[P1′] pairings (e.g., [V]–[K/N/M/W], [D]–[K], [N]–[D], and [K]–[P]) (Figure 4B). Conversely, in reverse PCPS reactions, we observed hotspots at [E]–[L], [F]–[S], and [D/E/S]–[K/L] at the [P1]–[P1′] position that were not evident in forward PCPS reactions (Figure 4C). While most acyl-enzyme intermediate and nucleophilic free amine residues participating in both forward and reverse PCPS reactions at the [P1]–[P1′] position corresponded to the dominant cleavage events (depicted in Figure 3B), residues from “minor” cleavage sites (such as P and S) were also over-represented at [P1]–[P1′], indicating that PCPS is not entirely dictated by the efficiency of cleavage events producing the constitutive splice reactants, but is also sequence-dependent. Indeed, further differences between forward and reverse PCPS reactions were observed at [P2]–[P2′] and [P3]–[P3′] positions (Figures 4B,C), which will also determine the biochemical suitability of reactants for proteasomal substrate binding pockets.
Figure 4
Discussion
Despite over a decade of research, the properties governing PCPS are poorly understood. By employing a tailored MS-based de novo sequencing approach to identify peptides generated by proteasomal splicing in vitro, our study has provided novel insight into both the steric length constraints and biochemical preferences of PCPS mediated by the CP. Recent studies using MS-based approaches to investigate the characteristics of antigen processing by proteasomal isoforms have primarily focused on identification of peptides generated by canonical cleavage events (20). The development of more complex bioinformatics approaches arising concomitantly with dramatic improvements in the sensitivity of detection of MS-based technologies has yielded opportunities to more accurately and comprehensively investigate the repertoire of spliced peptides through both database-dependent as well as database-independent methodologies (9, 12, 14, 16). However, systematic analysis of PCPS has been hampered by the limited number of spliced peptides that have been experimentally validated to date.
Although it has been proposed that PCPS reactions may be sequence-dependent (23), the only study attempting to define preferred sequence-dependent “rules” for PCPS reactions to date has been limited by its restriction to the binding preferences of HLA-A*02:01, and only considered the ligation efficiency of N- and C-terminal sequence variants of fixed lengths in a single 9-mer spliced peptide [YLDW]–[KLPSV] (21). Here, the authors sought to gain insight into amino acid preferences at the splice site by either sequentially mutating the O-acyl enzyme intermediate of the N-terminal fragment (whilst keeping every other amino acid in the C-terminal fragment fixed), and vice versa for the nucleophilic free amine position. The two fragments were incubated with the proteasome and ligation efficiencies measured in fluorescence polarization assays. Here, it was found that D, N, Q, and S predominantly functioned as O-acyl enzyme intermediates, whilst R was preferred as a nucleophilic free amine. This was also implemented in similar fashion for residues at [P2]–[P2′] and [P3]–[P3′]. However, importantly, the A*02:01 anchor residues were not varied in the study, and this may bias the affinities of splice partner fragments for the substrate binding pockets. Furthermore, no information could be gained on reverse-splicing events in this study, nor the length-dependent requirements and splicing distances over which PCPS events may be favored during the degradation of proteasomal substrates. Here, we experimentally define the biochemical signatures of PCPS by using a de novo sequencing-based approach to define spliced peptides generated following in vitro digestion of precursor polypeptides by the CP.
A caveat of this approach is that conditions in vitro do not precisely mirror those in cellulo, e.g., there are likely to be differences in the substrate:proteasome ratio and there is an absence of other cytoplasmic components, so it cannot be precluded that this introduces bias into the results obtained. However, we considered and took steps to minimize potential sources of bias that may be introduced by analysis of the spliced peptide products generated during in vitro PCPS reactions. In line with a previous study which showed that saturation of cleavage site usage was achieved at 480 min (20), we found that saturation of available cleavage sites was not achieved at the 2 h time point in our study. Nonetheless, the 2 h time point was selected for the investigation of PCPS reactions to minimize potential proteasomal re-entry of cleavage products as well as additional trans-splicing events, which could confound characterization of cis-splicing products. An additional source of bias during in vitro processing of polypeptide substrates may arise due to systematic differences in products generated which may either have required only one cut or multiple cuts, and ensuing over-representation of N- or C-terminal amino acid residues from the precursor substrate occurring in splice site motifs. Indeed, non-spliced peptides containing the N- or C-terminal amino acid residue of the precursor polypeptide were generated in significantly greater abundance than those peptide products generated from within the precursor. However, this was not observed for spliced peptides, suggesting that the efficiency of generation of spliced peptides may not be predominantly dictated by the lower number of cleavages required to generate more highly abundant terminal amino acid-containing products, but rather by additional factors that may determine the efficiency of the PCPS reaction, such as length restrictions and biochemical properties of the splice partners themselves. These factors are likely to influence the affinity and optimal orientation of the precursor fragments for proteasomal substrate binding pockets. However, to limit bias introduced in the splice site signatures by inclusion of splice partner fragments containing terminal amino acids, the 135 of the original 444 spliced peptides that were solely generated from within the precursor substrates were utilized for analysis of PCPS characteristics.
One question we sought to address was the relative efficiency with which spliced and non-spliced peptides are generated by the CP. In the in vitro system studied here, spliced peptides were found to constitute a relatively low proportion of the products generated from within precursor polypeptides, suggesting that a greater diversity of non-spliced than spliced peptides may be generated as long polypeptides derived from ubiquitinated protein substrates are digested by the CP in vivo; and the abundance of the spliced peptides was also found to be significantly lower than that of non-spliced peptides (Figures 1A,B). Prior studies where the relative abundance of spliced and non-spliced peptides generated by other types of proteasomes was addressed have not yielded a consensus about this (7, 9), but these utilized only very small numbers of polypeptide substrates, suggesting a need for more comprehensive future analyses to clarify whether there are differences in the efficiency with which spliced and non-spliced peptides are generated by different proteasomal isoforms both in vitro and in cellulo.
To date, it has been unclear whether stringent length requirements of splice reactants are required for enhanced efficiency of PCPS reactions. We observed that cis-PCPS reactions typically generated a larger proportion of shorter peptides than cleavage events giving rise to non-spliced peptides, and that the majority of N- and C-terminal splice partner fragments were typically between 2 and 7aa in length (Figure 2E). We postulate that this could be due to the nature of the substrate binding pockets and/or amino acid residues surrounding the catalytic subunits, which in turn govern the optimum lengths of splice partner fragments that can be accommodated in the correct orientation to facilitate peptide splicing. The similar splice partner fragment length distributions observed for the five longest polypeptide precursors (Supplementary Figure 3A) further suggests that steric constraints within proteasomal substrate binding pockets may limit the length of splice partners that can be accommodated in PCPS reactions. Although it has previously been shown that the minimal length of a C-terminal splice reactant required to perform nucleophilic attack on a stable acyl-enzyme intermediate was 3 aa (8), no upper bound for the length of splice partners has previously been described. Based on our results, this value may typically lie between 9 and 12 aa. However, although unlikely at the 2 h digestion time point analyzed here, we cannot entirely preclude that post-PCPS processing (via proteasomal re-entry and cleavage of previously spliced peptide products) may bias the fragment length distributions observed.
Data from our study also elucidate the distances over which PCPS can occur within a polypeptide substrate, and show that these distributions differ markedly between forward and reverse splicing reactions. We demonstrate that while forward splicing typically involves the excision of 1–2aas, a larger proportion of reverse PCPS reactions occur over distances >3 aas (Figure 2F). However, we also show that the use of precursor polypeptides of moderate length may lead to an underestimation of the distances over which cis-PCPS can occur, particularly with regard to reverse PCPS events (Supplementary Figure 3B). Indeed, an experimentally validated fibroblast growth factor (FGF)-5-derived spliced epitope in renal cell carcinoma was experimentally shown to be generated by a transpeptidation reaction spanning 40 aa (3). However, it was subsequently demonstrated that cis-PCPS reaction efficiencies displayed an inverse correlation with increasing intervening sequence length (6), indicating that PCPS reactions are likely to occur with greater efficiency over shorter distances.
Finally, we sought to determine both cleavage and sequence-dependent fusion preferences of splice reactants within the proteasomal chamber. As PCPS is characteristically thought to involve nucleophilic attack of a stable acyl-enzyme intermediate by the free amine group of a non-adjacent amino acid sequence [it has also been shown that certain spliced peptides may be produced within cells without the formation of a semi-stable O-acyl-enzyme intermediate via a condensation reaction (7)], we experimentally defined residues predominantly acting as stable O-acyl-enzyme intermediates and nucleophilic free amines. Although the global sequence context of individual precursor polypeptides may influence cleavage specificity, our data suggest that in addition to preferred length constraints for N- and C-terminal splice partners, certain residues may preferentially function as more stable reactive intermediates or as nucleophilic free amines in forward and reverse PCPS reactions, which may facilitate optimal positioning or stability within the proteasomal chamber to enable splicing. For non-spliced peptides, although we did not observe pronounced tryptic-like activity (cleavage after basic residues) our data are largely in accordance with results from a recent analysis of non-spliced proteasomal cleavage products derived from a set of 228 rationally-designed synthetic 14-mer peptides, where preferential cleavage after A, F, H, and L residues was observed (20). Additionally, while it is established that the catalytically active subunits (β1, β2, and β5) of the CP predominantly initiate cleavage after acidic (D and E), hydrophobic (F, W, and Y) and basic residues (K and R), respectively (18), cleavages following branched chain (L, I, and V) or small neutral amino acids (A, S, T, and V) also predominate (24), and were likewise observed in our study.
As with cleavage signatures, we also found differences in the enrichment of particular amino acid pairings in forward and reverse PCPS reactions by examination of splice site signatures (Figure 4B). These data may suggest that forward and reverse PCPS events may occur in distinct substrate binding sites within the proteasomal chamber. Interestingly, we observed that at the fusion site, in addition to amino acid residues derived from the dominant cleavage events, residues from “minor” cleavage sites were also enriched at the [P1]–[P1′] position, demonstrating that PCPS is sequence-dependent, and not entirely governed by the frequency of splice reactant precursors generated by the dominant cleavage events. Importantly, inspection of splice site signatures defined following in vitro proteasomal digests in our study revealed that these differed from those of previously-reported HLA-I bound spliced peptides identified from MS-based immunopeptidome profiling datasets (12, 14). Previously proposed amino acid splicing preferences determined by inspection of immunopeptidomic datasets could be biased by selective pressures imposed on proteasome-generated peptide pools during subsequent steps of antigen processing/presentation, e.g., TAP-mediated peptide translocation into the ER, HLA-I binding preferences, and ER-mediated peptide trimming, resulting in omission of PCPS-derived peptides (25). The repertoire of spliced peptides detected in HLA-I-bound peptide repertoires may also be restricted by the peptide length preferences of class I alleles. For instance, in our study, ~35% of cis-spliced peptides generated following in vitro proteasomal polypeptide digestion were >12 aa in length, and would thus be under-represented in HLA-I bound peptide datasets.
Taken together, our experimental characterization of PCPS reactions using in vitro digests of polypeptide substrates indicate certain well-defined characteristics of peptide splicing by the CP, and allows us to propose a model for peptide splicing by the CP. Figure 5 illustrates the key features of forward and reverse PCPS reactions defined in our study. We note that in both forward and reverse PCPS reactions (Figures 5A–C) N-terminal fragments were usually shorter, while C-terminal splice reactants were of longer lengths. However, cis-splicing distances in reverse PCPS were typically much longer than in forward PCPS reactions. The etiology of this major difference is unclear, although one may postulate that steric constraints within the proteasomal binding chamber may require the N-terminal portion of the precursor to re-orientate and perform nucleophilic attack of the C-terminal end in an adjacent substrate binding pocket (Figure 5B), thus causing the polypeptide to re-orientate and bend within the proteasomal chamber. Longer intervening cis-splicing distances might thus allow for greater flexibility of the polypeptide chain. This may occur similarly in reverse PCPS reactions with no intervening cis-splicing distance (Figure 5C).
Figure 5
Future analysis of in vitro peptide splicing by other proteasomal isoforms, and comparative analysis of the HLA-I bound spliced peptides generated in cells expressing different proteasomal subunits, and in immunopeptidomes generated by direct vs. cross-presentation would be of interest. Importantly, the delineation of cleavage and splice site signatures reported here will facilitate a more informed investigation of the mechanisms of PCPS, and the development of algorithms to predict spliced peptide generation from protein sequences. This will in turn expedite future work to define spliced peptides derived from pathogen and tumor antigens that could be targeted for prophylaxis or therapy. In addition, a more thorough understanding of the repertoire of spliced peptides produced within cells could uncover roles of these peptides in aspects of cell biology beyond antigen presentation.
Statements
Data availability statement
Mass spectrometry proteomics datasets have been deposited to the ProteomeXchange Consortium via the PRIDE partner repository (https://www.ebi.ac.uk/pride) with project accession numbers PXD025893 (for undigested precursor substrates) and PXD021339 (for proteasomal digests of precursor substrates). Computer scripts have likewise also been made privately available in GitHub and are available on request.
Author contributions
WP, GL, TP, NT, and PB conceived the study. WP designed and conducted experiments, analyzed data, prepared figures, and drafted the manuscript. AN and NT acquired MS data. GL, TP, NT, and PB contributed to data analysis and manuscript editing. All authors read and approved the final version of the manuscript.
Funding
This work was funded by Medical Research Council (MRC) programme Grant MR/K012037 (PB), and by grants from the National Institutes of Health [R01 AI 118549 and the Duke Center for HIV/AIDS Vaccine Immunology-Immunogen Discovery (UM1 AI 100645)] (PB). Mass spectrometry samples were acquired in the Target Discovery Institute Mass Spectrometry laboratory led by Benedikt Kessler. PB and NT are Jenner Institute Investigators.
Acknowledgments
The authors would like to thank Professor Benoit van den Eynde for helpful discussions about the study. This manuscript has been released as a pre-print at bioRxiv (26).
Conflict of interest
The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.
Supplementary material
The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2020.563800/full#supplementary-material
References
1.
SaekiYTanakaK. Assembly and function of the proteasome. Methods Mol Biol. (2012) 832:315–37. 10.1007/978-1-61779-474-2_22
2.
MurataSTakahamaYKasaharaMTanakaK. The immunoproteasome and thymoproteasome: functions, evolution and human disease. Nat Immunol. (2018) 19:923–31. 10.1038/s41590-018-0186-z
3.
HanadaKYewdellJWYangJC. Immune recognition of a human renal cancer antigen through post-translational protein splicing. Nature. (2004) 427:252–6. 10.1038/nature02240
4.
VigneronNStroobantVChapiroJOomsADegiovanniGMorelSet al. An antigenic peptide produced by peptide splicing in the proteasome. Science. (2004) 304:587–90. 10.1126/science.1095522
5.
WarrenEHVigneronNJGavinMACouliePGStroobantVDaletAet al. An antigen produced by splicing of noncontiguous peptides in the reverse order. Science. (2006) 313:1444–7. 10.1126/science.1130660
6.
DaletAVigneronNStroobantVHanadaKVan den EyndeBJ. Splicing of distant peptide fragments occurs in the proteasome by transpeptidation and produces the spliced antigenic peptide derived from fibroblast growth factor-5. J Immunol. (2010) 184:3016–24. 10.4049/jimmunol.0901277
7.
EbsteinFTextoris-TaubeKKellerCGolnikRVigneronNVan den EyndeBJet al. Proteasomes generate spliced epitopes by two different mechanisms and as efficiently as non-spliced epitopes. Sci Rep. (2016) 6:24032. 10.1038/srep24032
8.
MichauxALarrieuPStroobantVFonteneauJFJotereauFVan den EyndeBJet al. A spliced antigenic peptide comprising a single spliced amino acid is produced in the proteasome by reverse splicing of a longer peptide fragment followed by trimming. J Immunol. (2014) 192:1962–71. 10.4049/jimmunol.1302032
9.
PaesWLeonovGPartridgeTChikataTMurakoshiHFrangouAet al. Contribution of proteasome-catalyzed peptide cis-splicing to viral targeting by CD8(+) T cells in HIV-1 infection. Proc Natl Acad Sci USA. (2019) 116:24748–59. 10.1073/pnas.1911622116
10.
PlatteelACMishtoMTextoris-TaubeKKellerCLiepeJBuschDHet al. CD8(+) T cells of Listeria monocytogenes-infected mice recognize both linear and spliced proteasome products. Eur J Immunol. (2016) 46:1109–18. 10.1002/eji.201545989
11.
PlatteelACMLiepeJTextoris-TaubeKKellerCHenkleinPSchalkwijkHHet al. Multi-level strategy for identifying proteasome-catalyzed spliced epitopes targeted by CD8(+) T cells during bacterial infection. Cell Rep. (2017) 20:1242–53. 10.1016/j.celrep.2017.07.026
12.
LiepeJMarinoFSidneyJJekoABuntingDESetteAet al. A large fraction of HLA class I ligands are proteasome-generated spliced peptides. Science. (2016) 354:354–8. 10.1126/science.aaf4384
13.
MylonasRBeerIIseliCChongCPakHSGfellerDet al. Estimating the contribution of proteasomal spliced peptides to the HLA-I ligandome. Mol Cell Proteomics. (2018) 17:2347–57. 10.1074/mcp.RA118.000877
14.
FaridiPLiCRamarathinamSHVivianJPIllingPTMifsudNAet al. A subset of HLA-I peptides are not genomically templated: evidence for cis- and trans-spliced peptide ligands. Sci Immunol. (2018) 3:eaar3947. 10.1126/sciimmunol.aar3947
15.
DelongTWilesTABakerRLBradleyBBarbourGReisdorphRet al. Pathogenic CD4 T cells in type 1 diabetes recognize epitopes formed by peptide fusion. Science. (2016) 351:711–4. 10.1126/science.aad2791
16.
KuckelkornUStublerSTextoris-TaubeKKilianCNiewiendaAHenkleinPet al. Proteolytic dynamics of human 20S thymoproteasome. J Biol Chem. (2019) 294:7740–54. 10.1074/jbc.RA118.007347
17.
DaletARobbinsPFStroobantVVigneronNLiYFEl-GamilMet al. An antigenic peptide produced by reverse splicing and double asparagine deamidation. Proc Natl Acad Sci USA. (2011) 108:E323–31. 10.1073/pnas.1101892108
18.
VigneronNFerrariVStroobantVAbi HabibJVan den EyndeBJ. Peptide splicing by the proteasome. J Biol Chem. (2017) 292:21170–9. 10.1074/jbc.R117.807560
19.
MishtoMLiepeJTextoris-TaubeKKellerCHenkleinPWeberrussMet al. Proteasome isoforms exhibit only quantitative differences in cleavage and epitope generation. Eur J Immunol. (2014) 44:3508–21. 10.1002/eji.201444902
20.
WinterMBLa GrecaFArastu-KapurSCaiazzaFCimermancicPBuchholzTJet al. Immunoproteasome functions explained by divergence in cleavage specificity and regulation. Elife. (2017) 6:e27364. 10.7554/eLife.27364
21.
BerkersCRde JongASchuurmanKGLinnemannCMeiringHDJanssenLet al. Definition of proteasomal peptide splicing rules for high-efficiency spliced peptide presentation by MHC class I molecules. J Immunol. (2015) 195:4085–95. 10.4049/jimmunol.1402455
22.
OlexioukVCrappeJVerbruggenSVerhegenKMartensLMenschaertG. sORFs.org: a repository of small ORFs identified by ribosome profiling. Nucleic Acids Res. (2016) 44:D324–9. 10.1093/nar/gkv1175
23.
MishtoMGoedeATaubeKTKellerCJanekKHenkleinPet al. Driving forces of proteasome-catalyzed peptide splicing in yeast and humans. Mol Cell Proteomics. (2012) 11:1008–23. 10.1074/mcp.M112.020164
24.
OrlowskiMCardozoCMichaudC. Evidence for the presence of five distinct proteolytic components in the pituitary multicatalytic proteinase complex. Properties of two components cleaving bonds on the carboxyl side of branched chain and small neutral amino acids. Biochemistry. (1993) 32:1563–72. 10.1021/bi00057a022
25.
NeefjesJJongsmaMLPaulPBakkeO. Towards a systems understanding of MHC class I and MHC class II antigen presentation. Nat Rev Immunol. (2011) 11:823–36. 10.1038/nri3084
26.
PaesWLeonovGPartridgeTNicastriATernetteNBorrowP. Elucidating the signatures of proteasome-catalysed peptide splicing. bioRxiv [Preprint]. (2020). 10.1101/2020.04.05.025908
Summary
Keywords
peptide splicing, proteasome, splicing mechanism, antigen processing, peptide epitopes
Citation
Paes W, Leonov G, Partridge T, Nicastri A, Ternette N and Borrow P (2020) Elucidation of the Signatures of Proteasome-Catalyzed Peptide Splicing. Front. Immunol. 11:563800. doi: 10.3389/fimmu.2020.563800
Received
19 May 2020
Accepted
26 August 2020
Published
24 September 2020
Volume
11 - 2020
Edited by
Peter M. Van Endert, Institut National de la Santé et de la Recherche Médicale (INSERM), France
Reviewed by
Alice Sijts, Utrecht University, Netherlands; Peter Michael Kloetzel, Charité—Universitätsmedizin Berlin, Germany
Updates
Copyright
© 2020 Paes, Leonov, Partridge, Nicastri, Ternette and Borrow.
This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) and the copyright owner(s) are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
*Correspondence: Wayne Paes wayne.paes@ndm.ox.ac.ukPersephone Borrow persephone.borrow@ndm.ox.ac.uk
This article was submitted to Antigen Presenting Cell Biology, a section of the journal Frontiers in Immunology
Disclaimer
All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.