ORIGINAL RESEARCH article

Front. Pharmacol., 03 February 2025

Sec. Integrative and Regenerative Pharmacology

Volume 16 - 2025 | https://doi.org/10.3389/fphar.2025.1541869

ELABELA promotes the migration and homing of bone marrow mesenchymal stem cells to myocardial injury sites through the ERK1/2/miR-299a-5p/Exo70 pathway

  • 1. Department of Emergency, The Eighth Affiliated Hospital of Sun Yat-sen University, Shenzhen, Guangdong, China

  • 2. Department of Emergency, Sun Yat-sen Memorial Hospital of Sun Yat-sen University, Guangzhou, Guangdong, China

Abstract

Background:

Bone marrow mesenchymal stem cells (BMSCs) hold promise for repairing myocardial injury following acute myocardial infarction (AMI), but their clinical application is hindered by poor migration, homing efficiency, and survival rates. Previously, we demonstrated that ELABELA (ELA), a small peptide, enhances the survival of rat BMSCs under hypoxia-reoxygenation (H/R) conditions by activating ERK1/2. However, the role of ELA in promoting BMSCs migration and homing to injured cardiomyocytes remains unclear.

Methods:

Primary BMSCs and neonatal rat ventricular myocytes (NRVMs) were isolated and cultured. NRVMs were exposed to H/R to mimic the microenvironment of AMI in vitro. The migration of BMSCs toward the injured myocardium was assessed in different treatment groups using transwell and chemotaxis assays. Additionally, in vivo studies were performed using a rat myocardial infarction/reperfusion injury (MI/RI) model with DIR-labeled BMSCs. Cardiac repair was evaluated through fluorescence imaging, echocardiography, and histological analysis. Transcriptome sequencing and bioinformatics analysis were employed to identify and validate the mechanisms by which ELA promoted the migration of BMSCs. A dual luciferase assay was used to investigate the interaction between Exo70 and miR-299a-5p. Subsequently, a series of experimental procedures were performed, including sequential silencing of APJ or Exo70, overexpression of miR-299a-5p, inhibition of ERK1/2 phosphorylation, assessment of BMSCs migration through transwell and scratch assays, detection of F-actin polymerization via immunofluorescence, and evaluation of the expression levels of each factor using qPCR and Western blotting.

Results:

In vitro, the migration ability of ELA-pretreated BMSCs was significantly augmented in the H/R environment. ELA pretreatment effectively heightened the homing capacity of BMSCs to the site of myocardial injury and their proficiency in repairing myocardial damage in vivo. Transcriptome sequencing revealed upregulation of Exo70 in ELA pretreated BMSCs, which promoted F-actin polymerization and migration. Overexpression of miR-299a-5p reduced Exo70 expression and impaired BMSCs migration. ELA also activated ERK1/2 phosphorylation, while inhibition of ERK1/2·with U0126 abrogated F-actin polymerization and migration, increasing miR-299a-5p levels and reducing Exo70.

Conclusion:

ELA enhances BMSCs migration and homing to injured cardiomyocytes by activating the APJ receptor, promoting ERK1/2 phosphorylation, downregulating miR-299a-5p, and upregulating Exo70, providing a potential therapeutic strategy for improving stem cell-based cardiac repair.

1 Introduction

Cardiovascular diseases (CVDs) are a leading cause of morbidity and mortality worldwide, with acute myocardial infarction (AMI) being one of the most prevalent and clinically challenging forms. Reperfusion, a commonly employed clinical intervention for AMI, has the potential to trigger a series of adverse reactions and worsen myocardial damage, ultimately resulting in increased mortality rates (; ). Thus, it is critical to find strategies that not only mitigate reperfusion injury but also enhance myocardial repair. While conventional pharmaceutical agents and surgical procedures can partially or fully reinstate blood circulation and mitigate inflammation, they are unable to salvage the functional viability of myocardial cells within the infarcted region (). With the development of cell therapy technology, stem cells have received much attention from researchers because of their ability to self-renew, multidirectional differentiation, and paracrine signaling under appropriate conditions (). Among them, bone marrow mesenchymal stem cells (BMSCs) are the most widely studied and relatively easy to obtain mesenchymal stem cells (MSCs). The transplantation of BMSCs after AMI has been shown to be effective in limiting infarct areas and repairing myocardial damage in animal and clinical trials (; ; ). However, clinical application remains limited, as only a tiny number of BMSCs migrate to the local area of the infarcted myocardium and participate in limited post-MI tissue repair when BMSCs are infused locally in the non-infarcted myocardium (e.g., during intravenous infusion or intramyocardial injection) (; ). Enhancing the homing capacity of BMSCs could improve their therapeutic potential by increasing their migration to the damaged site and promoting the secretion of pro-tissue regenerative chemokines, cytokines, and growth factors ().

Cell migration and homing are crucial for the therapeutic efficacy of BMSCs, and the prime mover affecting directed cell migration requires the coordination of actin assembly and membrane remodeling (; ). Exocyst complex component 7 (Exoc7, Exo70) is an essential component of the extracellular secretory complex, which interacts directly with the Actin-related proteins 2/3 (Arp2/3) complex. This core nucleating factor generates the branching actin network and promotes F-actin polymerization for cell morphogenesis and migration (; ). Identifying ways to enhance F-actin polymerization could significantly improve BMSCs migration.

ELABELA (ELA, Toddle) is an endogenous ligand for Angiotensin receptor-like 1 (APLNR, APJ) in early embryonic development, which has a similar sequence to apelin. Still, its receptor affinity is about five times that of apelin. ELA has been found to be promising and relatively safe for treating cardiovascular disease (; ; ). Our previous studies have found that BMSCs pretreated with ELA could be protected by reducing apoptosis and promoting proliferation in a harsh environment of ischemia and hypoxia (; ). However, the molecular mechanisms by which ELA regulates the migration of BMSCs remain unclear. In this study, we aimed to investigate whether ELA can promote the migration and homing of BMSCs to repair injured myocardial tissue by affecting F-actin polymerization.

Through both in vivo rat models and in vitro cell experiments, we aim to investigate whether ELA pretreatment enhances the migration and homing capacity of BMSCs to the damaged myocardial site, and promotes tissue repair in reperfused myocardial injury. Specifically, we hypothesize that this effect is mediated through the downregulation of microRNA-299a-5p (miR-299a-5p) via ERK1/2 phosphorylation, which leads to increased Exo70 expression and subsequent F-actin polymerization. The goal of this study is to elucidate the molecular mechanisms underlying BMSCs migration, which may improve BMSCs transplantation therapy for AMI. Additionally, the findings could contribute to the development of ELA-based therapeutic strategies, facilitating the clinical application of BMSCs transplantation in AMI treatment.

2 Methods

2.1 Ethics statement

Male Sprague-Dawley (SD) rats (80∼120 g and 200∼250 g, SPF grade) and newborn SD suckling rats (aged 1–3 days, SPF grade) were purchased from the Zhuhai BesTest Bio-Tech Co., Ltd. (Zhuhai, China), with license number SYXK (Guangdong) 2020-0051. All animal experiments were approved by the Animal Ethics Committee of the Eighth Affiliated Hospital of Sun Yat-sen University (Approval number: 2022-081-01).

2.2 Chemicals

ELA, a synthetic polypeptide consisting of 32 amino acids (sequence: QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP), was purchased from GL Biochem Co. Ltd. (Shanghai, China). The ELA powder had a purity of 95.31% and was stored at −20°C. Before use, ELA was dissolved in phosphate-buffered saline (PBS) at a final concentration of 5 μM and filtered through a 0.22 μm filter.

2.3 Cell isolation and culture

BMSCs were isolated from the femurs and tibias of SD rats (80∼120 g) as previously described (). BMSCs were cultured in a complete culture medium consisting of low-glucose Dulbecco’s modified Eagle’s medium (GIBCO, United States), supplemented with 10% fetal bovine serum (GIBCO, United States) and 1% penicillin/streptomycin (HyClone, United States). After 24 h, non-adherent cells were discarded, and the medium was replaced. When cells reached 80%–90% confluence, they were passaged at a 1:2 ratio. All experiments were conducted using BMSCs at passage 3 (P3). As previously reported by our research group (), phenotyping of the BMSCs was confirmed via fluorescence-activated cell sorting revealing that the cells were positive for CD44 and CD29 but negative for CD34.

Neonatal rat ventricular myocytes (NRVMs) were isolated from newborn SD suckling rats (aged 1–3 days) following the protocol outlined in our earlier reports (). The collected hearts were cut into 1–2 mm3 and digested with 0.25% trypsin solution (without EDTA) (Beyotime, China) at 37°C for 10 min. The supernatant fractions were discarded, and the remaining tissue samples were further digested using 0.1% type II collagenase (Sigma-Aldrich, United States) for 5-6 times (10 min each) in a 37°C water bath. The cell suspension was collected and filtered through a 70 μm cell strainer and centrifuged at 1,500 rpm for 5 min. The cell pellet was resuspended in high-glucose Dulbecco’s Modified Eagle Medium (DMEM; GIBCO, United States) containing 10% fetal bovine serum (GIBCO, United States) and 1% penicillin-streptomycin. Most fibroblasts were removed from the suspension by two successive adherence steps on plastic (approximately 45 min each). Any remaining fibroblasts in the culture medium containing NRVMs were inhibited using Bromodeoxyuridine (BrdU, 0.1 mM final concentration; Sigma-Aldrich, United States). NRVMs were cultured in a 6-well plate at a density of 5 × 105 cells/well, with media changes every 2–3 days for subsequent experiments after 5–6 days.

2.4 Animal grouping and surgery

SD rats (200–250 g) were ear-tagged by trained technicians using a metal applicator under sterile conditions and local anesthesia. Efforts were made to minimize stress and prevent injury. After ear tagging, rats were acclimated individually in SPF rooms for a week, with controlled temperature (24°C ± 2°C), humidity (50% ± 10%), and a 12-hour light-dark cycle, with ad libitum access to food and water. Daily health checks were conducted, and any rats showing signs of ill health were removed from the study. After acclimation, all rats were healthy, showing no abnormal behavior or ear infections.

As in previous studies (; ), the rats were anesthetized and subjected to localized myocardial ischemia by ligating the left anterior descending branch of the coronary artery. After 45 min, the ligature was released, and reperfusion was initiated for 1 hour. Electrocardiography (ECG) (RM6240E, Chengdu, China) was employed to assess the ischemic cardiac tissue and confirm the successful establishment of the myocardial infarction/reperfusion injury (MI/RI) model. A total of 32 male SD rats were randomly divided into four groups (n = 8 per group): (1) sham group: rats underwent thoracotomy without coronary artery ligation; (2) MI/RI group: rats underwent left anterior descending branch ligation, followed by 1 hour of reperfusion and were injected with 500 μL of PBS via the tail vein; (3) MI/RI + BMSCs group: rats received 500 μL of PBS containing BMSCs (4 × 106 cells/mL) via intravenous injection following MI/RI; (4) MI/RI + ELA + BMSCs group: rats received 500 μL of PBS containing BMSCs pre-treated with ELA (4 × 106 cells/mL) via intravenous injection following MI/RI. In all in vivo experiments, the BMSCs, whether pre-treated with ELA or not, were stained with DiR overnight.

2.5 In vivo imaging of DIR fluorescent dyes

DiR (DiIC18(7), Invitrogen, United States) was a lipophilic dye used for cell tracking in live imaging. Following the manufacturer’s instructions, in vitro staining was performed using a final concentration of 10 μM. SD rats (200–250 g) were anesthetized and injected with DiR-stained BMSCs or DiR-stained ELA pre-treated BMSCs through the tail vein, in accordance with their respective groups. Live imaging was immediately conducted using a small animal living imaging system (Tanon ABL X6pro, Shanghai, China) with an excitation filter of 750 nm and an emission filter of 780 nm. The Tanon imaging analysis system (Tanon, Shanghai, China) was utilized to acquire imaging images at 0 h, 3 h, and 24 h, and the total radiant efficiency of the heart was assessed and compared. Upon the rats’ euthanasia after 28 days, the hearts were extracted and the average radiant efficiency was measured using an IVIS Spectrum imaging system (PerkinElmer, United States).

2.6 Echocardiography

Cardiac function and therapeutic efficacy of BMSCs transplantation in myocardial injury were assessed at 14 and 28 days post-modeling using a real-time molecular imaging system (Vevo2100, Visualsonics, Canada). M-mode ultrasound was employed, with cardiac function measurements taken by ultrasound physicians in a double-blind manner. The parameters assessed included left ventricular internal diameter in systole (LVIDs), left ventricular internal diameter in diastole (LVIDd), Left ventricular ejection fraction (LVEF), left ventricular fractional shortening (LVFS), left ventricular end-systolic volume (LVESV), and left ventricular end-diastolic volume (LVEDV). These measurements were calculated using the Teichholtz formula over three consecutive cardiac cycles. The echocardiographic images were analyzed using Vevo 2100 software (Visualsonics, Canada).

2.7 HE and masson staining

Fresh heart tissue from SD rats was processed by fixing, dehydrating, embedding in paraffin, sectioning, and subsequently subjected to HE and Masson staining. HE staining involved the removal of paraffin and rehydration of the tissue sections using xylene and alcohol, followed by hematoxylin and eosin staining to highlight the cell nuclei and cytoplasm, respectively. The stained sections were then dehydrated through graded alcohol solutions and mounted with neutral gum. The slides were examined using an Aperio GT 450 scanner (Leica Biosystems, United States) and analyzed with ImageScope software (Aperio ImageScope, v12.4.6.5003). Masson staining procedure entailed the removal of paraffin and rehydration of heart tissue sections that had been embedded in paraffin. The sections were stained using the Masson tricolor staining kit (Servicebio, Wuhan, China). The stained sections were dehydrated, mounted, examined under a microscope (Nikon, Japan), and scanned (3DHISTECH, Hungary). The quantification of collagen protein content in the samples was conducted using ImageJ software (ImageJ 1.53t, United States).

2.8 Small interfering RNA (siRNA) transfections

BMSCs were cultured in medium without penicillin/streptomycin. The siRNA targeting APJ (siRNA-APJ), siRNA-APJ negative control (NC), siRNA-Exo70, siRNA-Exo70 NC, miR-299a-5p mimic, mimic NC, miR-299a-5p inhibitor, and inhibitor NC were purchased from RiboBio (RiboBio Co., Ltd., Guangzhou, China). The sequences were listed in Table 1. According to the manufacturer’s instructions, BMSCs were transfected using Lipofectamine RNAi Max Reagent (ThermoFisher, United States).

TABLE 1

NameSequences (5′-3′)
siRNA-APJGCC​TCA​GCT​TTG​ACC​GAT​A
siRNA-Exo70-1CTA​CCA​AGA​AGC​CCA​TCA​A
siRNA-Exo70-2CCA​GAC​AAG​GAG​TAC​AAC​A
siRNA-Exo70-3CGG​AGA​AGA​TCA​TCA​GAG​A
miR-299a-5p mimicF: UGGUUUACCGUCCCACAUACAU
R: ACCAAAUGGCAGGGUGUAUGUA
mimic NCF: UUUGUACUACACAAAAGUACUG
R: AAACAUGAUGUGUUUUCAUGAC
miR-299a-5p inhibitorAUG​UAU​GUG​GGA​CGG​UAA​ACC​A
inhibitor NCCAG​UAC​UUU​UGU​GUA​GUA​CAA​A

Sequences of cell transfection.

2.9 Hypoxia reoxygenation-neonatal rat ventricular myocytes (H/R- NRVMs) model and BMSCs treatments

NRVMs were rinsed twice with PBS and incubated in low-glucose DMEM with serum-free medium (0% serum) in a hypoxia incubator chamber (STEMCELL, Canada) containing 1% O2, 94% N2, and 5% CO2 for 12 h to induce hypoxic injury. Cells were then treated with 10% serum and reoxygenated for 12 h in a 5% CO2 incubator at 37°C. The H/R-NRVMs medium was harvested and centrifuged at 3,000 rpm for 5 min to collect the supernatant, while NRVMs were cultured in low-glucose complete medium for 12 h.

A total of 22 groups were set up with different treatments: (1) siAPJ group: BMSCs transfected with siRNA-APJ; (2) siAPJ NC group: BMSCs transfected with siRNA-APJ NC; (2) siExo70 group: BMSCs transfected with siRNA- Exo70; (4) siExo70 NC group: BMSCs transfected with siRNA- Exo70 NC; (5) mimic NC: BMSCs transfected with NC mimic; (6) miR-299a-5p mimic: BMSCs transfected with miR-299a-5p mimic; (7) inhibitor NC: BMSCs transfected with inhibitor NC; (8) miR-299a-5p inhibitor: BMSCs transfected with miR-299a-5p inhibitor; (9) blank group: BMSCs without any treatment (negative control); (10) ELA group: BMSCs treated with 5 μM ELA for 24 h; (11) control group: BMSCs cultured in NRVMs medium for 12 h; (12) H/R group: BMSCs cultured in H/R-NRVMs medium for 12 h; (13)H/R + ELA group: BMSCs preconditioned with 5 μM ELA and cultured in H/R-NRVM medium for 12 h; (14) H/R + ELA + siAPJ group: BMSCs transfected with siRNA-APJ before treatment with 5 μM ELA; (15) H/R + ELA + siAPJ NC group: BMSCs transfected with siRNA-APJ NC before treatment with 5 μM ELA; (16) H/R + ELA + siExo70 group: BMSCs transfected with siRNA- Exo70 before treatment with 5 μM ELA; (17) H/R + ELA + siExo70 NC group: BMSCs transfected with siRNA-Exo70 NC before treatment with 5 μM ELA; (18) H/R + ELA + mimic NC: BMSCs transfected with NC mimic before treatment with 5 μM ELA; (19) H/R + ELA + miR-299a-5p mimic: BMSCs transfected with miR-299a-5p mimic before treatment with 5 μM ELA; (20) H/R + ELA + inhibitor NC: BMSCs transfected with inhibitor NC before treatment with 5 μM ELA; (21) H/R + ELA + miR-299a-5p inhibitor: BMSCs transfected with miR-299a-5p inhibitor before treatment with 5 μM ELA. (22) H/R + ELA + U0126 group: BMSCs pretreated with 10 μM U0126 (ERK pathway inhibitor; Med Chem Express, United States) for 6 h before 5 μM ELA. Groups (12)–(22) were cultured in H/R-NRVMs medium for 12 h. Groups (13)–(22) were treated with 5 μM ELA for 24 h.

Treatments (1)–(8) involved various siRNA applications to BMSCs. The comparisons in (9) and (10) were pairwise, with specific statistical methods detailed in section 2.18(hereafter the same). Comparisons in (11)–(13) included multiple groups, and subsequent comparisons in (11)–(15) concentrated on pairwise comparisons following Exo70 knockdown and its effects on phenotypes. Similarly, (11)–(13) and (16)–(19) investigated the impact of miR-299a-5p modulation on downstream factors and phenotypes. Comparisons in (11)–(13) and (20) evaluated the effects of ERK pathway inhibition, and (11)–(13), (21), and (22) examined the consequences of APJ receptor inhibition on downstream factors and phenotypes.

2.10 Transwell assays

Transwell assays using Transwell chambers with an 8-μm pore size (Corning, United States) were conducted to examine the targeting efficiency of BMSCs to injured cardiomyocytes in vitro. BMSCs were serum starved for 12 h before transwell assays. NRVMs, subjected to H/R conditions (12 h of hypoxia followed by 12 h of reoxygenation in low-glucose DMEM with 10% serum) were placed in the lower chamber (6-well plates), while BMSCs (5 × 105 cells/well) were seeded in the upper chamber. After incubation for 12 h at 37°C, non-migrated cells in the upper chamber were removed with cotton swabs, and migrated cells were fixed with 4% paraformaldehyde for 30 min. After drying, the upper chambers were stained with 0.1% crystal violet dyes for 20 min at room temperature. The number of migrated cells was observed under an inverted microscope and counted using ImageJ software (ImageJ 1.53t, United States).

2.11 Scratch assay

BMSCs migration was measured using an in vitro scratch wound assay. Briefly, BMSCs were seeded in a 6-well plate to achieve 90% confluency. The culture medium was then removed, and a wound was made in the middle of the well using a 200 µL micropipette tip. Then, each well was washed three times with PBS to eliminate cell debris. NRVMs medium and H/R-NRVMs medium were separately added to the different groups. Wound closure was photographed with an inverted microscope at 0 and 12 h post-wounding. A percentage of wound closure was calculated using ImageJ software (ImageJ 1.53t, United States) by the following formula: (original wound area-remaining wound area)/original wound area ×100%.

2.12 IBIDI cell migration studies and live video microscopy

To dynamically observe the cells’ motility trajectory, BMSCs chemotaxis experiments were performed on the µ-Slide Chemotaxis chamber (Ibidi, #80326, Germany) treated at the bottom of the ibiTreat according to the protocol provided by the manufacturer. Cultures containing 2 × 106 cells were placed in the central channel of μ-slide chambers. After 6 h of incubation, a chemotaxis gradient was established by adding NRVMs culture to the left medium reservoir and H/R-NRVMs culture to the right medium reservoir. The movement of BMSCs in the central channel was recorded over time using a time-lapse image system under an inverted confocal microscope (Nikon Ti2-E, Japan), with temperature and CO2 concentration controlled by a companion live cell workstation (TOKAI HIT, Japan). Light field images were acquired every 10 min for 20 h, and the trajectory of at least 30 cells within the observation area of each image sequence was tracked manually using the ImageJ Manual Tracking plug-in (ImageJ 1.53t, United States). To evaluate the efficacy of ELA on BMSCs, we determined the migration efficiency of BMSCs by a combination of evaluation metrics such as the forward migration index (FMI), migration velocity and distance after multiple experiments.

2.13 Transcriptome sequencing and analysis

Transcriptome sequencing and analysis were conducted by Shanghai GeneChem Co., Ltd. (Shanghai, China). Sequencing libraries were built using NEBNext® UltraTM RNA Library Prep Kit for Illumina® (NEB, United States) following the manufacturer’s recommendations. The library preparations were sequenced on the Illumina Nova6000 platform to generate 150 bp paired-end reads. All the bioinformatic analyses were based on the clean data with high quality.

2.14 Plasmid transfection and luciferase assay

MiR-299a-5p potentially targeting the 3′-UTR of the Exo70 gene was predicted by the TargetScan (http://www.targetscan.org/) and miRWalk (http://mirwalk.umm.uni-heidelberg.de/). 293T cells were seeded in 24-well plates (1 × 105 cells/well) and cultured until the cell confluency reached 60%. Plasmid names were listed in Table 2. Plasmid transfections were performed by using X-tremeGENE HP DNA transfection reagent (Roche, Switzerland) according to the instruction manual. The cells were harvested 48 h after transfection and measured using the Dual-Luciferase Reporter Assay System (Promega, United States).

TABLE 2

PrimerSequences (5′-3′)
Exo70F: CAG​CTA​TTA​CCA​CGT​AGC​CAG​C
R: ATC​TGG​GCT​GTT​GTC​CTG​AAA​G
GAPDHF: CCT​CGT​CTC​ATA​GAC​AAG​ATG​GT
R: GGG​TAG​AGT​CAT​ACT​GGA​ACA​TG
miR-299a-5pF: GCC​GAG​TGG​TTT​ACC​GTC​C
R: GTC​GTA​TCC​AGT​gCA​GGG​TCC​G
RT: GTCGTATCCAGTGCAGGGTCCGAGGTATT
CGCACTGGATACGACATGTATGT
U6F: CCTGCTTCGGCAGCACA
R: AAC​GCC​TCA​CGA​ATT​TGC​GT

Primer sequences of RT-qPCR.

2.15 Reverse transcription-quantitative polymerase chain reaction (RT-qPCR)

Total RNA was extracted from BMSCs using Trizol reagent (Sigma, United States) and quantified using a NanoDrop spectrophotometer (ThermoFisher Scientific). The primer sequences were listed in Table 2. The cDNA was then synthesized by reverse transcription kit (RR047A, TaKaRa, Japan). RT-qPCR was performed on LightCycler® 480 real-time PCR Platform (Roch e, Switzerland) using TB Green® Premix Ex Taq TM (RR820A, TaKaRa, Japan). The relative miRNA levels were normalized to U6 small nuclear RNA levels. The relative RNA level was calculated using the 2−ΔΔCT method. Each group had three replicates, and the experiment was conducted independently three times.

2.16 Western blotting

Total cellular proteins were extracted from BMSCs using RIPA lysis buffer (RIPA, Beyotime, China) supplemented with protease and phosphatase inhibitor cocktail (CWBIO, China) for 30 min on ice. Protein concentration was determined using the bicinchoninic acid (BCA) protein assay kit (CWBIO, China). Protein samples were mixed with 5 × SDS-PAGE sample loading buffer and heated at 70°C for 10 min. Proteins were separated by 10% SDS-PAGE and transferred to a 0.2 μm PVDF membrane (Millipore, United States). Membranes were blocked in 5% skimmed milk for 1 h and incubated overnight at 4°C with primary antibodies [Exo70 (1:1000; #12014-1-AP; Proteintech, United States), phospho-p44/42 MAPK (p-ERK1/2) (1:2000; #4370; Cell Signaling Technology, United States), p44/42 MAPK (ERK1/2) (1:1000; #4695; Cell Signaling Technology, United States) and GAPDH (1:1000; #2118; Cell Signaling Technology, United States)]. After overnight incubated, membranes were washed three times with TBST for 10 min each time and incubated with HRP-linked secondary antibody: anti-rabbit IgG (1:3,000, Cell Signaling Technology, United States). Protein bands were detected using chemiluminescence reagents and visualized with ChemiDoc™ Touch Imaging System (Bio-Rad, United States).

2.17 F-actin staining

Immunofluorescence staining was used to determine polymerized F-actin using the F-actin staining kit-Green Fluorescence-Cytopainter (#ab112125, Abcam, US). BMSCs were fixed with 4% paraformaldehyde for 30 min followed by permeabilization with 0.1% Triton X-100 for 5 min at room temperature. After washing with PBS for three times, the Green Fluorescent Phalloidin Conjugate working solution was added into fixed BMSCs for 20 min at room temperature in the dark. Excess dye was washed with PBS before nuclei were stained with 4′, 6-diamidino-2-phenylindole (DAPI, beyotime, China) for 10 min at room temperature in the dark. Fluorescence images were taken using a confocal laser microscope (LSM880, Zeiss, Germany). The fluorescence intensity was quantified using ImageJ software (ImageJ 1.53t, United States), followed by statistical analysis. An increased fluorescence intensity signifies an enhanced ability for F-actin polymerization.

2.18 Statistical analysis

Data were plotted using GraphPad Prism 8 software (GraphPad, United States). Statistical significance was assessed based on the results of at least three independent experiments. An analysis that involved comparing two groups was conducted using Student's t-test. Comparisons among multiple groups were assessed using one-way analysis of variance (ANOVA) with a Bonferroni post hoc test. Pairwise comparisons between groups (e.g., the blank group vs. the ELA group, the Control group vs. the H/R group, and the H/R group vs. the H/R + ELA group, etc.) were shown in Figures 17. The data were expressed as Mean ± SD. Statistical significance was determined by P < 0.05.

FIGURE 1

FIGURE 2

FIGURE 3

FIGURE 4

FIGURE 5

FIGURE 6

FIGURE 7

3 Results

3.1 ELA pretreatment promoted BMSCs migration and homing under H/R conditions

Cell migration analysis showed that the ELA group exhibited a significantly higher migration ability than the blank group (p < 0.01) (Figures 1A, B). Simultaneously, in the scratch model and transwell migration template as showed in Figure 1C, the migration rate of the H/R + ELA group was notably higher than that of the H/R group (p < 0.05), while the migration rate of the control group was lower than that of the H/R group (p < 0.05) (Figures 1D, E). Dynamic tracking of BMSCs motility was conducted using the Ibidi Chemotaxis and Migration Tool, which visualized individual tracks. Both the H/R and H/R + ELA groups showed enhanced chemotaxis capacity towards the H/R-NRVMs medium (p < 0.05). The H/R + ELA group showed greater migration distance and faster velocity compared to the H/R group (p < 0.05) (Figure 1F).

3.2 ELA pretreatment enhanced BMSCs-mediated myocardial repair

Following the ligation of the left anterior descending branch of the coronary artery, localized myocardial ischemia was visually apparent below the ligature line, with a pale appearance (Figure 2A). One hour after reperfusion, ECG demonstrated ST segment elevation in the precordial leads, confirming the successful establishment of myocardial infarction/reperfusion injury (MI/RI) (Figure 2B). At this stage, DiR-labeled BMSCs and ELA + BMSCs were intravenously administered through the tail vein. Immediate in vivo imaging of rats indicated that DiR fluorescence primarily localized in the heart, with no statistically significant difference observed between the two groups (with and without ELA pre-treatment) immediately and 3 h after cell injection. However, after 24 h, the ELA pre-treatment group exhibited significantly stronger fluorescence intensity in the heart region compared to the non-pretreated group (p < 0.05, Figure 2C). At 28 days post-injection, fluorescence imaging of the heart revealed that the average radiant efficiency of the ELA pre-treatment group was significantly higher than that of the MI/RI + BMSCs group (p < 0.001, Figure 2D). These findings suggested that ELA pre-treatment enhanced BMSCs migration and homing to the injured myocardium.

Cardiac function evaluation at 14 and 28 days post-surgery revealed significant reductions in LVFS (%) and LVEF (%) values in the MI/RI group compared to the sham group (p < 0.05). While the MI/RI + BMSCs group exhibited increased LVFS (%) and LVEF values, the differences were not statistically significant (p > 0.05). In contrast, significant increases in LVFS (%) and LVEF values were observed in the MI/RI + ELA + BMSCs group compared to the MI/RI group, suggesting the beneficial effects of ELA pretreatment in improving myocardial function (Figure 2E). Histological examination through HE staining (Figure 2F) revealed that the myocardial structure in the sham group remained predominantly intact, whereas myocardial damage was observed in the MI/RI, MI/RI + BMSCs, and MI/RI + ELA + BMSCs groups. Within the infarcted area, the MI/RI group retained some myocardial tissue with a relatively ample presence of blood vessels, yet notable myocardial fibrosis was evident. The fibrotic region was distinguished by lax and disordered fibrous regions, accompanied by extensive infiltration of inflammatory cells. In contrast, the MI/RI + BMSCs group exhibited a high density of myocardial scar formation within the infarcted region, indicative of the advanced stage of myocardial infarction repair. Conversely, the MI/RI + ELA + BMSCs group displayed a reduced scar area in comparison to the MI/RI + BMSCs group, suggesting a notable enhanced myocardial repair. Masson’s staining confirmed that the fibrosis area was significantly lower in the MI/RI + ELA + BMSCs group compared to the MI/RI + BMSCs group (p < 0.05, Figure 2G).

3.3 Transcriptome screening and validation of ELA in promoting cell migration

Transcriptome analysis identified 99 differentially expressed genes (Figure 3A), of which 47 were downregulated and 52 were upregulated. Among the top 20 upregulated genes, Exo70 was highly expressed in BMSCs and implicated in cell migration. Exo70 expression was validated at both the RNA and protein levels, showing a significant increase in BMSCs pretreated with ELA (p < 0.05). Additionally, Exo70 expression was increased in the H/R group compared to the control group. Exo70 expression was higher in the H/R + ELA group than in the H/R group (p < 0.05) (Figures 3B–E). The above results showed that ELA played a supranormal role in enhancing cell migration under a H/R environment. The F-actin immunofluorescence assay further revealed that the immunofluorescence intensity was enhanced in the H/R + ELA group, indicating that ELA could promote actin polymerization (Figure 3F), thus promoting cell migration.

3.4 ELA promoted BMSCs migration by modulating Exo70

To confirm the role of Exo70 in BMSCs migration, Exo70 was silenced using siRNA. qPCR and WB showed that the second pair of siExo70 efficiently silenced Exo70 expression (p < 0.05, Figures 4A, B, F). In the H/R condition, the migration rate of the ELA-treated group was higher than that of the ELA-free group but silencing Exo70 with siExo70 significantly reduced migration in the H/R + ELA group (P < 0.05, Figures 4C–E). The above results suggest that siExo70 reversed the effect of ELA in promoting MSC migration and that Exo70 is an essential part in the process of ELA promoting BMSCs migration.

3.5 Exo70 as a target of miR-299a-5p

Bioinformatics prediction indicated a potential interaction between Exo70 and miR-299a-5p (Figure 5A). Transfection of miR-299a-5p mimic significantly increased miR-299a-5p expression (p < 0.01, Figure 5B). A dual luciferase reporter was used to detect microRNAs regulating the expression of target genes mainly through its binding to the 3′end untranslated region (3′UTR) of the target gene mRNA, resulting in degradation of the target mRNA or inhibition of protein synthesis. This implied that comparisons between Firefly/Renilla luminescence fold, calibrated to eliminate differences and re-quantified in the presence of identical miR-299a plasmids, were used to determine whether target gene Exo70 3′UTR null, target gene Exo70 3′UTR, target gene Exo70 3′UTR mutant plasmids bound to miR-299a and inhibited luciferase expression. The results showed that compared to the positive reference miRNA NC group, there was a significant decrease (p < 0.001) in the expression of relative luciferase in the positive reference miRNA group, indicating that there was no problem with the whole transfection assay system. miR-299a-5p bound to the 3′UTR of Exo70 and inhibited its expression, as evidenced by significantly reduced luciferase activity in the Luc-Exo70-3′UTR + miR-299a group (p < 0.001, Figure 5C). At the protein level, the expression of Exo70 was significantly decreased in the H/R + ELA group after overexpression of miR-299a-5p (p < 0.001, Figure 5D). In conclusion, all the above results demonstrated that Exo70 was a direct target of miR-299a-5p.

3.6 ELA regulated miR-299a-5p and Exo70 via the ERK1/2 pathway

To further explore the mechanism of migration promotion by ELA in BMSCs, we examined migration-related kinases. We found that the phosphorylation level of ERK1/2 was increased after treatment with ELA under H/R conditions. The ERK pathway inhibitor U0126 significantly reduced ERK1/2 phosphorylation (Figure 6D) and reversed the pro-migration effect of ELA (Figures 6A, B), as well as affecting F-actin polymerization (Figure 6C). These results suggest that the ERK1/2 pathway was involved in ELA-induced BMSCs migration. Further analysis showed that ERK1/2 phosphorylation modulated miR-299a-5p and Exo70 expression, as both miR-299a-5p levels and Exo70 expression were affected by ERK1/2 inhibition by U0126 (Figures 6D, G). Moreover, combining U0126 with miR-299a-5p Inhibitor did not significantly improve migration (p > 0.05) or F-actin polymerization (Figures 6E, F, H, I), indicating that the ERK1/2 pathway mediates ELA-induced migration through miR-299a-5p and Exo70 regulation.

3.7 ELA regulated miR-299a-5p and Exo70 expression through APJ receptor-activated ERK1/2 pathway

Our previous studies confirmed that APJ is an important receptor regulating BMSCs survival, and the suppression of APJ by siRNA has been demonstrated in our earlier work (). To further explore whether ELA promoted F-actin polymerization and thus affected migration through the APJ receptor, we performed APJ gene silencing and found that siAPJ inhibited BMSCs migration efficiency (Figures 7A, B) and affected F-actin polymerization (Figure 7C). Western blot analysis revealed that silencing APJ suppressed ERK1/2 phosphorylation and reduced Ex070 expression (P < 0.05, Figure 7D). Taken together, our data suggest that ELA regulated miR-299a-5p and Exo70 expression through APJ receptor activation of the ERK1/2 pathway, as depicted in the proposed mechanistic model (Figure 7E).

4 Discussion

In this study, we demonstrated that ELA promotes F-actin polymerization in BMSCs, which facilitates their migration and homing to damaged cardiomyocytes. The underlying mechanism of ELA-enhanced migration was confirmed by transcriptome sequencing, bioinformatics analysis, and experimental validations. We identified that the activation of ERK1/2 phosphorylation, along with thedown-regulation of miR-299a-5p and upregulation of Exo70, played pivotal roles in this process. This study offer novel insights into the molecular mechanisms involved in the transplantation of BMSCs for AMI and provide a more reliable theoretical and experimental basis for exploring ways to enhance the efficacy of BMSCs transplantation.

Currently, most clinical and preclinical research evidence supports the use of MSCs, especially bone marrow-derived MSCs, as a safe and promising biologic therapy in the cellular treatment of AMI, which enhances not only cardiac angiogenesis and significantly improves cardiac function after injury but also has myocardial regenerative potential (; ). Systematic evaluations and in vivo safety trials have demonstrated that BMSCs transplantation is generally safe, with minimal toxic side effects. However, its therapeutic potential in terms of functional recovery has shown mixed results (; ). Autologous MSCs transplantation after MI was not found to significantly promote the recovery of LV function and myocardial viability (), or the improvement was minimal. Meta-analyses in some literature showed only a 2.62% () or 3.78% () increase in LVEF after transplantation. This limited benefit could be attributed to the inadequate migration and homing of MSCs to the infarcted tissue, which is further complicated by the hypoxic-ischemic environment of AMI. The success of BMSCs transplantation largely depends on the migration and homing efficiency of the cells to the damaged myocardium (). Unfortunately, BMSCs face significant challenges in achieving optimal migration and survival rates solely due to environmental factors and inherent characteristics. To address these challenges, researchers tried to promote the migration of BMSCs with natural botanicals or chemically synthesized drugs (; ; ; ). Despite these efforts, no single treatment has yet achieved a substantial improvement in graft survival or migration rates while ensuring patient safety. In our study, ELA showed no adverse effects on the APJ receptor, as confirmed by previous cardiovascular monitoring and safety reports (). Our findings indicate that ELA pre-treatment significantly enhances BMSCs migration both in vitro and in vivo, as evidenced by transwell assays, scratch assays, and an MI/RI rat model. Additionally, ELA-pretreated BMSCs demonstrated significant efficacy in the repair of myocardial injury and preservation of cardiac function.

To further investigate the mechanism by which ELA promotes the migration of BMSCs, we performed transcriptome sequencing and bioinformatics analysis to screen the top 20 differentially expressed genes and found significant differences in the presence of the Exo70 gene between the two groups (p < 0.05). Exo70 is a key component of an octameric protein complex that facilitates the association of the Arp2/3 complex with the Wiskott-Aldrich syndrome protein family verproline-homologous protein-2 (WAVE2), thereby influencing F-actin polymerization and playing a crucial role in the formation of lamellar pseudopods and the maintenance of cell migration orientation persistence (; ; ), While Exo70 has been implicated in tumor cell migration, its role in stem cell therapy has not been fully explored. Our study found that ELA upregulates Exo70 in BMSCs, and silencing Exo70 with siRNA significantly impairs BMSCs migration and reduces F-actin polymerization indicating that Exo70 is a key mediator in ELA-induced BMSCs migration. This suggests that ELA pre-treatment may promote the migration of MSCs to damaged cardiomyocytes by upregulating Exo70.

MicroRNAs (miRNAs) are small endogenous RNAs consisting of 18–23 nucleotides that regulate the expression of target genes. Combined with bioinformatics analysis (TargetScan, http://www.targetscan.org), miR-299-5p (miR-299a-5p) was predicted to bind to the 3′-UTR of Exo70 in this study. MiR-299-5p, one of many miRNA molecules, played an essential biological function in inflammation and tumor development, participating in critical cellular processes such as epithelial-mesenchymal transition, proliferation, and migration (). ()analyzed the GSE21032 dataset available on the GEO website and concluded that miR-299-5p showed a significant and statistically significant trend of downregulated expression from normal tissue to localized tumors to metastatic tumors. Another study suggested that miR-299-5p was closely associated with the migration and invasion of papillary thyroid cancer (). Although the role of miR-299a-5p in MSC migration is less well-studied, one study indicated that MSCs could secrete miR-299a-5p, which influences osteogenic differentiation (). In our study, we observed a significant downregulation of miR-299a-5p in ELA-pretreated BMSCs, inhibition of cell migration function after overexpression of miR-299a-5p, and an impact on F-actin polymerization. The double luciferase assay verified that Exo70 was a direct target gene of miR-299a-5p. MiR-299a-5p could bind to Exo70 and inhibit Exo70 expression, thus affecting its ability to promote the polymerization of F-actin. These findings indicate that ELA promotes BMSCs migration to injured cardiomyocytes by down-regulating miR-299a-5p, leading to an upregulation of Exo70 and subsequent F-actin polymerization.

The intermediate mechanism underlying ELA-induced downregulation of miR-299a-5p attracted our interest. Activation of the ERK1/2 signaling pathway has been shown to regulate miRNA expression and promote cell migration (; ). Our previous study demonstrated that ELA could significantly attenuate ischemia-reperfusion-induced apoptosis and improve the survival rate of BMSCs by regulating ERK1/2 phosphorylation (). However, it has not been reported whether the mechanism by which ELA promotes migration and homing of BMSCs is achieved through the ERK1/2 pathway. In recent years, activation of the ERK1/2 pathway has been shown to enhance the proliferation and migration of MSCs (; ). In our study, inhibition of ERK1/2 phosphorylation by U0126 did affect the migration of BMSCs in the ELA group, suggesting that ELA promotes the migration of BMSCs in the H/R environment through ERK1/2 phosphorylation. The ERK1/2 pathway can regulate miRNA levels through multiple pathways, thereby regulating various cellular life activities (). During osteogenic differentiation of MSCs, periostin (POSTN) could regulate the expression of miR-299-5p (), while in another study, POSTN exerted cell migration proliferation and angiogenesis induced by ERK1/2 activation (). We hypothesized that activation of ERK1/2 might regulate the expression of miR-299a-5p. In our study, ERK1/2 phosphorylation activated by ELA could regulate the expression of miR-299a-5p and its target gene Exo70, just as in tumor studies, Exo70 could be phosphorylated by ERK1/2 thereby promoting tumor metastasis (). Our experiments culminated in the downregulation of miR-299a-5p through ERK1/2 phosphorylation and the upregulation of Exo70, which promoted the polymerization of F-actin and the migration of BMSCs to injured cardiomyocytes ultimately.

ERK1/2 is an essential downstream signaling factor of ELA/APJ, playing a pivotal role in cardiovascular development and protection from MI (). Our previous in vitro studies confirmed that ELA/APJ significantly attenuated apoptosis in MSCs through the ERK1/2 pathway (). The majority of ELA functions were achieved through the APJ receptor (; ; ). Still, in embryonic stem cell studies, there was a possibility that the Receptor X played a specific function (). To exclude the involvement of other receptors, we performed APJ receptors blockade, which resulted in a significant reduction in BMSCs migration. These findings demonstrate that ELA facilitates BMSCs migration through the APJ receptor in BMSCs. However, there are certain limitations in our study. Although we have identified the key mechanisms through which ELA facilitates the migration and homing of BMSCs to the injured myocardium, further studies are necessary to clarify the exact pathways that enable BMSCs to restore the impaired cardiac tissue subsequent to successful migration to the site of heart injury. Moreover, in vivo experiments are needed to assess the safety and efficacy of ELA pre-treatment in clinical applications.

5 Conclusion

In conclusion, our study reveals a novel mechanism through which ELA enhances BMSCs migration and homing to myocardial injury. ELA promotes the activation of ERK1/2 signaling, leading to the downregulation of miR-299a-5p and upregulation of Exo70, which in turn facilitates F-actin polymerization and cell migration. The study indicates that ELA exhibits potential as a therapeutic agent for enhancing stem cell therapy. Additionally, our results provide a robust theoretical foundation for the development and clinical implementation of ELA drugs, as well as the advancement of BMSCs transplantation in the treatment of AMI.

Statements

Data availability statement

The original contributions presented in the study are publicly available. This data can be found here: https://www.ncbi.nlm.nih.gov/sra/PRJNA1216908.

Ethics statement

The animal study was approved by the Animal Ethics Committee of the Eighth Affiliated Hospital of Sun Yat-sen University. The study was conducted in accordance with the local legislation and institutional requirements.

Author contributions

J-YH: Writing–original draft, Methodology, Validation, Writing–review and editing. HW: Conceptualization, Writing–original draft, Writing–review and editing. S-ML: Methodology, Writing–original draft, Writing–review and editing. X-JL: Data curation, Formal Analysis, Writing–review and editing. S-JY: Formal Analysis, Software, Writing–review and editing. X-XC: Methodology, Resources, Writing–review and editing. C-QZ: Project administration, Resources, Writing–review and editing. H-BL: Conceptualization, Supervision, Writing–review and editing. H-DW: Resources, Supervision, Writing–review and editing. J-YF: Validation, Visualization, Writing–review and editing. Y-JG: Funding acquisition, Supervision, Writing–review and editing. TW: Funding acquisition, Project administration, Resources, Supervision, Writing–review and editing.

Funding

The author(s) declare that financial support was received for the research, authorship, and/or publication of this article. This study was supported by the National Natural Science Foundation of China (No. 81070125, 81270213, 81670306); the Science and Technology Foundation in Guangdong Province (No. 2010B031600032, 2014A020211002); the National Natural Science Foundation of Guangdong Province (No. 2017A030313503); the Science and Technology Foundation in Guangzhou City (No. 201806020084); the Fundamental Research Funds for the Central Universities (No. 13ykzd16, 17ykjc18); the Futian District Health and Public Welfare Research Project of Shenzhen City (No. FTWS2019001, FTWS2021016, FTWS2022018, FTWS2023064), the Shenzhen Fundamental Research Program (No.JCYJ20190808101405466, JCYJ20210324115003008, JCYJ20220530144404009).

Acknowledgments

We thank the Central Laboratory of the Eighth Affiliated Hospital of Sun Yat-sen University for its experimental platform and technical support.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Generative AI statement

The author(s) declare that no Generative AI was used in the creation of this manuscript.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Abbreviations

MSCs, Mesenchymal stem cells; BMSCs, Bone marrow mesenchymal stem cells; NRVMs, Neonatal rat ventricular myocytes; CVDs, Cardiovascular diseases; AMI, Acute myocardial infarction; ELA (Toddle), ELABELA; H/R, hypoxia-reoxygenation; MI/RI, Myocardial infarction/reperfusion injury; SD rats, Sprague-Dawley rats; PBS, Phosphate-buffered saline; BrdU, Bromodeoxyuridine; Exo70 (Exoc7), Exocyst complex component 7; Arp2/3, Actin-related proteins 2/3; ERK1/2, Extracellular regulated protein kinases 1/2; p-ERK1/2, Phosphorylated ERK1/2; t-ERK1/2, Total ERK1/2; APJ (APLNR), Angiotensin receptor-like 1; miRNAs, MicroRNAs; miR-299-5p (miR-299a-5p), microRNA-299-5p; siRNA, small interfering RNA; ECG, Electrocardiography; LVID; s, Left ventricular internal diameter in systole; LVID; d, Left ventricular internal diameter in diastole; LVEF, Left ventricular ejection fraction; LVFS, Left ventricular fractional shortening; LVESV, Left ventricular end-systolic volume; LVEDV, Left ventricular end-diastolic volume; RT-qPCR, Reverse transcription-quantitative polymerase chain reaction.

References

  • 1

    AndersenT.WorthmullerD.ProbstD.WangI.MoreauP.FitzpatrickV.et al (2023). Cell size and actin architecture determine force generation in optogenetically activated cells. Biophys. J.122 (4), 684696. 10.1016/j.bpj.2023.01.011

  • 2

    AttarA.Bahmanzadegan JahromiF.KavousiS.MonabatiA.KazemiA. (2021). Mesenchymal stem cell transplantation after acute myocardial infarction: a meta-analysis of clinical trials. Stem Cell Res. Ther.12 (1), 600. 10.1186/s13287-021-02667-1

  • 3

    Barrere-LemaireS.VincentA.JorgensenC.PiotC.NargeotJ.DjouadF. (2024). Mesenchymal stromal cells for improvement of cardiac function following acute myocardial infarction: a matter of timing. Physiol. Rev.104 (2), 659725. 10.1152/physrev.00009.2023

  • 4

    BuiT. V. A.HwangJ. W.LeeJ. H.ParkH. J.BanK. (2021). Challenges and limitations of strategies to promote therapeutic potential of human mesenchymal stem cells for cell-based cardiac repair. Korean Circ. J.51 (2), 97113. 10.4070/kcj.2020.0518

  • 5

    ChapmanF. A.MaguireJ. J.NewbyD. E.DavenportA. P.DhaunN. (2023). Targeting the apelin system for the treatment of cardiovascular diseases. Cardiovasc Res.119 (17), 26832696. 10.1093/cvr/cvad171

  • 6

    ChenJ.ZhengS.HuangH.HuangS.ZhouC.HouJ.et al (2014). Mesenchymal stem cells enhanced cardiac nerve sprouting via nerve growth factor in a rat model of myocardial infarction. Curr. Pharm. Des.20 (12), 20232029. 10.2174/13816128113199990451

  • 7

    ChenX.ZhouC.XuD.LiuX.LiS.HouJ.et al (2022). Peptide hormone ELABELA promotes rat bone marrow-derived mesenchymal stem cell proliferation and migration by manipulating the cell cycle through the PI3K/AKT pathway under the hypoxia and ischemia microenvironment. Stem Cell Res. Ther.13 (1), 32. 10.1186/s13287-021-02691-1

  • 8

    CuiX.DongH.LuoS.ZhuangB.LiY.ZhongC.et al (2024). Long non-coding RNA-cardiac-inducing RNA 6 mediates repair of infarcted hearts by inducing mesenchymal stem cell differentiation into cardiogenic cells through cyclin-dependent kinase 1. Int. J. Mol. Sci.25 (6), 3466. 10.3390/ijms25063466

  • 9

    DawidM.MlyczynskaE.JurekM.RespektaN.PichK.KurowskaP.et al (2021). Apelin, APJ, and ELABELA: role in placental function, pregnancy, and foetal development-an overview. Cells11 (1), 99. 10.3390/cells11010099

  • 10

    FaixJ.RottnerK. (2022). Ena/VASP proteins in cell edge protrusion, migration and adhesion. J. Cell Sci.135 (6), jcs259226. 10.1242/jcs.259226

  • 11

    FatehA.FeiziM. A. H.SafaralizadehR.AzarbarzinS. (2017). Importance of miR-299-5p in colorectal cancer. Ann. Gastroenterol.30 (3), 322326. 10.20524/aog.2017.0139

  • 12

    FormosaA.MarkertE. K.LenaA. M.ItalianoD.Finazzi-AgroE.LevineA. J.et al (2014). MicroRNAs, miR-154, miR-299-5p, miR-376a, miR-376c, miR-377, miR-381, miR-487b, miR-485-3p, miR-495 and miR-654-3p, mapped to the 14q32.31 locus, regulate proliferation, apoptosis, migration and invasion in metastatic prostate cancer cells. Oncogene33 (44), 51735182. 10.1038/onc.2013.451

  • 13

    FuJ.ChenX.LiuX.XuD.YangH.ZengC.et al (2020). ELABELA ameliorates hypoxic/ischemic-induced bone mesenchymal stem cell apoptosis via alleviation of mitochondrial dysfunction and activation of PI3K/AKT and ERK1/2 pathways. Stem Cell Res. Ther.11 (1), 541. 10.1186/s13287-020-02063-1

  • 14

    GaoS.JinY.MaJ.WangJ.WangJ.ShaoZ.et al (2022). Preclinical study of human umbilical cord mesenchymal stem cell sheets for the recovery of ischemic heart tissue. Stem Cell Res. Ther.13 (1), 252. 10.1186/s13287-022-02919-8

  • 15

    GolpanianS.El-KhorazatyJ.MendizabalA.DiFedeD. L.SuncionV. Y.KarantalisV.et al (2015). Effect of aging on human mesenchymal stem cell therapy in ischemic cardiomyopathy patients. J. Am. Coll. Cardiol.65 (2), 125132. 10.1016/j.jacc.2014.10.040

  • 16

    GourdyP.CazalsL.ThalamasC.SommetA.CalvasF.GalitzkyM.et al (2018). Apelin administration improves insulin sensitivity in overweight men during hyperinsulinaemic-euglycaemic clamp. Diabetes Obes. Metab.20 (1), 157164. 10.1111/dom.13055

  • 17

    HanX. J.LiH.LiuC. B.LuoZ. R.WangQ. L.MouF. F.et al (2019). Guanxin Danshen Formulation improved the effect of mesenchymal stem cells transplantation for the treatment of myocardial infarction probably via enhancing the engraftment. Life Sci.233, 116740. 10.1016/j.lfs.2019.116740

  • 18

    HeuschG. (2020). Myocardial ischaemia-reperfusion injury and cardioprotection in perspective. Nat. Rev. Cardiol.17 (12), 773789. 10.1038/s41569-020-0403-y

  • 19

    HoL.TanS. Y.WeeS.WuY.TanS. J.RamakrishnaN. B.et al (2015). ELABELA is an endogenous growth factor that sustains hESC self-renewal via the PI3K/AKT pathway. Cell Stem Cell17 (4), 435447. 10.1016/j.stem.2015.08.010

  • 20

    JiS. T.KimH.YunJ.ChungJ. S.KwonS. M. (2017). Promising therapeutic strategies for mesenchymal stem cell-based cardiovascular regeneration: from cell priming to tissue engineering. Stem Cells Int.2017, 3945403. 10.1155/2017/3945403

  • 21

    JiangL.YangA.LiX.LiuK.TanJ. (2021). Down-regulation of VCAM-1 in bone mesenchymal stem cells reduces inflammatory responses and apoptosis to improve cardiac function in rat with myocardial infarction. Int. Immunopharmacol.101 (Pt A), 108180. 10.1016/j.intimp.2021.108180

  • 22

    JiangW.ZhangY.ZhangW.PanX.LiuJ.ChenQ.et al (2023). Hirsutine ameliorates myocardial ischemia-reperfusion injury through improving mitochondrial function via CaMKII pathway. Clin. Exp. Hypertens.45 (1), 2192444. 10.1080/10641963.2023.2192444

  • 23

    Kaneda-IkedaE.IwataT.MizunoN.NagaharaT.KajiyaM.TakedaK.et al (2020). Periodontal ligament cells regulate osteogenesis via miR-299-5p in mesenchymal stem cells. Differentiation112, 4757. 10.1016/j.diff.2020.01.001

  • 24

    KimS.LeeE. W.OhD. B.SeoJ. (2024). BAP1 controls mesenchymal stem cell migration by inhibiting the ERK signaling pathway. BMB Rep.57 (5), 250255. 10.5483/BMBRep.2023-0174

  • 25

    KullmannJ. A.MeyerS.PipicelliF.KyrousiC.SchneiderF.BartelsN.et al (2020). Profilin1-Dependent F-actin assembly controls division of apical radial glia and neocortex development. Cereb. Cortex30 (6), 34673482. 10.1093/cercor/bhz321

  • 26

    LiN.GuoX. Y.ZhouJ.YanX. L.YuF. F. (2021). Atorvastatin pretreatment ameliorates mesenchymal stem cell migration through miR-146a/CXCR4 signaling. Tissue Eng. Regen. Med.18 (5), 863873. 10.1007/s13770-021-00362-z

  • 27

    LiuJ.ZhaoY.SunY.HeB.YangC.SvitkinaT.et al (2012). Exo70 stimulates the Arp2/3 complex for lamellipodia formation and directional cell migration. Curr. Biol.22 (16), 15101515. 10.1016/j.cub.2012.05.055

  • 28

    LiuW.YanJ.PanW.TangM. (2020). Apelin/Elabela-APJ: a novel therapeutic target in the cardiovascular system. Ann. Transl. Med.8 (5), 243. 10.21037/atm.2020.02.07

  • 29

    LiuZ.TaoB.FanS.PuY.XiaH.XuL. (2019). MicroRNA-145 protects against myocardial ischemia reperfusion injury via CaMKII-mediated antiapoptotic and anti-inflammatory pathways. Oxid. Med. Cell Longev.2019, 8948657. 10.1155/2019/8948657

  • 30

    LuX.LiJ.ZhouB.LuX.LiW.OuyangJ. (2023). Taohong Siwu Decoction enhances human bone marrow mesenchymal stem cells proliferation, migration and osteogenic differentiation via VEGF-FAK signaling in vitro. J. Ethnopharmacol.307, 116203. 10.1016/j.jep.2023.116203

  • 31

    MaoL.ZhanY. Y.WuB.YuQ.XuL.HongX.et al (2020). ULK1 phosphorylates Exo70 to suppress breast cancer metastasis. Nat. Commun.11 (1), 117. 10.1038/s41467-019-13923-7

  • 32

    NtantieE.FletcherJ.AmissahF.SalakoO. O.NkemboA. T.PokuR. A.et al (2017). Polyisoprenylated cysteinyl amide inhibitors disrupt actin cytoskeleton organization, induce cell rounding and block migration of non-small cell lung cancer. Oncotarget8 (19), 3172631744. 10.18632/oncotarget.15956

  • 33

    PerjesA.KilpioT.UlvilaJ.MaggaJ.AlakoskiT.SzaboZ.et al (2016). Characterization of apela, a novel endogenous ligand of apelin receptor, in the adult heart. Basic Res. Cardiol.111 (1), 2. 10.1007/s00395-015-0521-6

  • 34

    SaeediM.NezhadM. S.MehranfarF.GolpourM.EsakandariM. A.RashmeieZ.et al (2021). Biological aspects and clinical applications of mesenchymal stem cells: key features you need to be aware of. Curr. Pharm. Biotechnol.22 (2), 200215. 10.2174/1389201021666200907121530

  • 35

    SunH. L.CuiR.ZhouJ.TengK. Y.HsiaoY. H.NakanishiK.et al (2016). ERK activation globally downregulates miRNAs through phosphorylating exportin-5. Cancer Cell30 (5), 723736. 10.1016/j.ccell.2016.10.001

  • 36

    SveeggenT. M.AbbeyC. A.SmithR. L.SalinasM. L.ChapkinR. S.BaylessK. J. (2023). Annexin A2 modulates phospholipid membrane composition upstream of Arp2 to control angiogenic sprout initiation. FASEB J.37 (1), e22715. 10.1096/fj.202201088R

  • 37

    SzokodiI.KerkelaR.KubinA. M.SarmanB.PikkarainenS.KonyiA.et al (2008). Functionally opposing roles of extracellular signal-regulated kinase 1/2 and p38 mitogen-activated protein kinase in the regulation of cardiac contractility. Circulation118 (16), 16511658. 10.1161/CIRCULATIONAHA.107.758623

  • 38

    SzydlakR. (2021). Biological, chemical and mechanical factors regulating migration and homing of mesenchymal stem cells. World J. Stem Cells13 (6), 619631. 10.4252/wjsc.v13.i6.619

  • 39

    SzydlakR. (2023). Mesenchymal stem cells in ischemic tissue regeneration. World J. Stem Cells15 (2), 1630. 10.4252/wjsc.v15.i2.16

  • 40

    ThavapalachandranS.LeT. Y. L.RomanazzoS.RashidF. N.OgawaM.KilianK. A.et al (2021). Pluripotent stem cell-derived mesenchymal stromal cells improve cardiac function and vascularity after myocardial infarction. Cytotherapy23 (12), 10741084. 10.1016/j.jcyt.2021.07.016

  • 41

    WangF.DaiH.ZhouZ.ShanY.YuM.SunJ.et al (2024). Astragalus polysaccharides augment BMSC homing via SDF-1/CXCR4 modulation: a novel approach to counteract peritoneal mesenchymal transformation and fibrosis. BMC Complement. Med. Ther.24 (1), 204. 10.1186/s12906-024-04483-5

  • 42

    WangX. D.LiF.MaD. B.DengX.ZhangH.GaoJ.et al (2016). Periostin mediates cigarette smoke extract-induced proliferation and migration in pulmonary arterial smooth muscle cells. Biomed. Pharmacother.83, 514520. 10.1016/j.biopha.2016.07.007

  • 43

    WangZ.HeL.SunW.QinY.DongW.ZhangT.et al (2018). miRNA-299-5p regulates estrogen receptor alpha and inhibits migration and invasion of papillary thyroid cancer cell. Cancer Manag. Res.10, 61816193. 10.2147/CMAR.S182625

  • 44

    XiY.LiY.RenW.BoW.MaY.PanS.et al (2023). ELABELA-APJ-akt/YAP signaling Axis: a novel mechanism of aerobic exercise in cardioprotection of myocardial infarction rats. Med. Sci. Sports Exerc55 (7), 11721183. 10.1249/MSS.0000000000003143

  • 45

    XuP.KongL.TaoC.ZhuY.ChengJ.LiW.et al (2023). Elabela-APJ axis attenuates cerebral ischemia/reperfusion injury by inhibiting neuronal ferroptosis. Free Radic. Biol. Med.196, 171186. 10.1016/j.freeradbiomed.2023.01.008

  • 46

    YanW.GuoY.TaoL.LauW. B.GanL.YanZ.et al (2017). C1q/Tumor necrosis factor-related protein-9 regulates the fate of implanted mesenchymal stem cells and mobilizes their protective effects against ischemic heart injury via multiple novel signaling pathways. Circulation136 (22), 21622177. 10.1161/CIRCULATIONAHA.117.029557

  • 47

    YuJ.ZhangR. F.MaoY. L.ZhangH. (2022). Efficacy and safety of mesenchymal stem cell therapy in patients with acute myocardial infarction: a systematic review and meta-analysis of randomized controlled trials. Curr. Stem Cell Res. Ther.17 (8), 793807. 10.2174/1574888X16666210816111031

  • 48

    ZhangR.YuJ.ZhangN.LiW.WangJ.CaiG.et al (2021b). Bone marrow mesenchymal stem cells transfer in patients with ST-segment elevation myocardial infarction: single-blind, multicenter, randomized controlled trial. Stem Cell Res. Ther.12 (1), 33. 10.1186/s13287-020-02096-6

  • 49

    ZhangS.ZhangR.QiaoP.MaX.LuR.WangF.et al (2021a). Metformin-induced MicroRNA-34a-3p downregulation alleviates senescence in human dental pulp stem cells by targeting CAB39 through the AMPK/mTOR signaling pathway. Stem Cells Int.2021, 113. 10.1155/2021/6616240

  • 50

    ZhouM.WuY. (2022). Effects and signaling pathways of Elabela in the cardiovascular system. Peptides147, 170674. 10.1016/j.peptides.2021.170674

  • 51

    ZhuY.WuB.GuoW. (2019). The role of Exo70 in exocytosis and beyond. Small GTPases10 (5), 331335. 10.1080/21541248.2017.1328998

Summary

Keywords

Elabela, bone marrow mesenchymal stem cells, migration and homing, myocardial injury, Exo70

Citation

Hou J-Y, Wu H, Li S-M, Li X-J, Yang S-J, Chen X-X, Zhou C-Q, Long H-B, Wu H-D, Fu J-Y, Guo Y-J and Wang T (2025) ELABELA promotes the migration and homing of bone marrow mesenchymal stem cells to myocardial injury sites through the ERK1/2/miR-299a-5p/Exo70 pathway. Front. Pharmacol. 16:1541869. doi: 10.3389/fphar.2025.1541869

Received

08 December 2024

Accepted

14 January 2025

Published

03 February 2025

Volume

16 - 2025

Edited by

Roberta Stilhano, Santa Casa of Sao Paulo, Brazil

Reviewed by

Ilya D. Klabukov, National Medical Research Radiological Center, Russia

Igor Prudovsky, Maine Medical Center, United States

Updates

Copyright

*Correspondence: Tong Wang, ; Ya-Jie Guo,

‡ These authors have contributed equally to this work

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics