ORIGINAL RESEARCH article

Front. Microbiol., 14 November 2018

Sec. Microbiotechnology

Volume 9 - 2018 | https://doi.org/10.3389/fmicb.2018.02743

In silico Design of Laccase Thermostable Mutants From Lacc 6 of Pleurotus Ostreatus

  • 1. Laboratory of Biotechnology, Research Center for Biological Sciences, Autonomous University of Tlaxcala, Tlaxcala, Mexico

  • 2. Agrobiotechnology Laboratory, Polytechnic University of Pachuca, Hidalgo, Mexico

  • 3. Division of Environmental Engineering Technology of Higher Studies of East Mexico State, Mexico City, Mexico

  • 4. Area of Biophysical Chemistry, Department of Chemistry, Metropolitan Autonomous University-Iztapalapa, Mexico City, Mexico

Abstract

Fungal laccase enzymes have a great biotechnological potential for bioremediation processes due to their ability to degrade compounds such as ρ-diphenol, aminophenols, polyphenols, polyamines, and aryldiamines. These enzymes have activity at different pH and temperature values, however, high temperatures can cause partial or total loss of enzymatic activity, so it is appropriate to do research to modify their secondary and/or tertiary structure to make them more resistant to extreme temperature conditions. In silico, a structure of the Lacc 6 enzyme of Pleurotus ostreatus was constructed using a laccase of Trametes versicolor as a template. From this structure, 16 mutants with possible resistance at high temperature due to ionic interactions, salt bridges and disulfide bonds were also obtained in silico. It was determined that 12 mutants called 4-DB, 3-DB, D233C-T310C, F468P, 3-SB, L132T, N79D, N372D, P203C, P203V, T147E, and W85F, presented the lowest thermodynamic energy. Based on the previous criterion and determining the least flexibility in the protein structures, three mutants (4-DB, 3-DB, and P203C) were selected, which may present high stability at high temperatures without affecting their active site. The obtained results allow the understanding of the molecular base that increase the structural stability of the enzyme Lacc 6 of Pleurotus ostreatus, achieving the in silico generation of mutants, which could have activity at high temperatures.

Introduction

One of the greatest qualities studied and demanded by protein engineering in the environmental and biotechnological fields is the search for conformational and structural stability of proteins when subjected to high temperatures, due to the fact that a high percentage of industrial processes are carried out in such conditions.

The native structure of a protein is stabilized by physicochemical interactions (Djikaev and Ruckenstein, 2008; Das et al., 2018); nevertheless, the free energy between the folded and unfolded states has been estimated in an order of 5–20 kcal/mol, which would be equivalent to breaking a small number of such interactions (Venkataramani et al., 2013; Nawaz et al., 2015; Dubey et al., 2017), in this way, structural stability turns out to be a delicate balance of interactions. Proteins can lose their stability and be denatured by various physicochemical treatments such as: heat, pressure, pH, urea or guanidine chloride, among others (Govardhan, 1999). When the bonds that maintain the native structure of a protein are broken, most of the time it loses its functionality due to structural destabilization. One of the processes of protein denaturation most studied is by heat, which occurs in a relatively narrow temperature range. That is why there are multiple proposals to increase their structural resistance at high temperatures (Gao et al., 2016; Kumar et al., 2016; Kean et al., 2017). An example is the hydrophobic packaging where the amino acid residues are oriented toward the protein core, being the main stability factors (Reed et al., 2013; Luna-Martínez et al., 2016); It should be mentioned that studies on directed mutations carried out for the filling of hydrophobic cavities have resulted in an improvement of stability by hydrophobic packaging (Christensen and Kepp, 2013a; Oda and Kinoshita, 2015). Likewise, electrostatic interactions that occur between amino acids of opposite charge, also have great importance to maintain the stability of the conformation of the protein (Sohini and Srikanta, 2009; Christensen and Kepp, 2013a).

In studies on protein flexibility, it has been found that mutations through which conformational degrees of freedom are reduced confer structural resistance to proteins (Zhou et al., 2008; Gribenko et al., 2009). A type of covalent bond that allows the reduction of flexibility is formed by the union of two cysteines, called disulfide bridge and is considered as a primary factor for stability (Radestock and Gohlke, 2011). However, the success in stabilization by disulfide bridges in protein engineering is dependent on the conformational change caused by the themselves folding and the effects of substituting the native residues with cysteines (Pappenberger et al., 1997). Other tactics to reduce flexibility is the substitution of free chain amino acids for prolines and the shortening in the length of loops, which can increase the stability of proteins by compaction. Although today part of the knowledge about flexibility, mobility and protein dynamics are derived from experimental data, it is true that currently there is no experimental technique to monitor conformational changes at the molecular level and atomic resolution as a function of time. For this reason, the molecular, conformational, flexibility and mobility details are often studied by computational simulation techniques providing a possibility to obtain dynamic information on the functionality of proteins (Anbar et al., 2012; Yakimov et al., 2016).

On the other hand, the laccase enzymes (EC.1.10.3.2) that belong to the family of multicopper-oxidases, can oxidize numerous compounds with an oxide-reduction potential that varies between 500 and 800 mV, such as the ρ- diphenol, aminophenols, polyphenols, polyamines and aryl diamines (Xu, 2005). They are N-glycosylated proteins (10–45% of their molecular mass), in general, they are in monomeric form with molecular weight of 20–80 kDa, their pI is between 2.6 and 4.5, being biologically active at pH 2.0–8.5 (Wesenberg et al., 2003; Díaz et al., 2013). These enzymes have been described in bacteria, fungi, plants and insects and more than 100 different proteins have been identified (Shuresh-Kumar et al., 2003). Its physiological function in plants is in the lignification process and in fungi in morphogenesis processes (formation of spores, pigments of fruiting bodies), pathogenesis, virulence and degradation of lignin, but it has also been reported that in some insects act in the formation of cuticle in the process of sclerotization (Kramer et al., 2001) and in bacteria have the function of monomer cross-linking, polymer degradation and the breakdown of aromatic rings (Sharma et al., 2007). The laccases have a great biotechnological potential, for example in the whitening of paper pulp, in the stabilization of wines and beers, in the food industry, in the cosmetic and pharmaceutical industries and in various bioremediation processes including discoloration of textile dyes and degradation of xenobiotic compounds (Mayer and Staples, 2002).

The laccase enzyme Lacc 6 produced by Pleurotus ostreatus has shown a high level of expression under different development conditions and has been partially characterized, determining its molecular weight, pI, optimum pH of activity, Km on different substrates, etc. (Baldrian, 2006; Díaz et al., 2013), because of the above, it was considered to be modified through protein engineering obtaining in silico mutants with greater thermodynamic stability, for its possible application in the degradation of polluting compounds of phenolic origin and recalcitrants that are in extreme temperature conditions.

In this research, a structure of the Lacc 6 enzyme of Pleurotus ostreatus was constructed in silico, using a laccase of Trametes versicolor as a template. From this structure, 16 mutants with possible resistance at high temperature due to ionic interactions, salt bridges and disulfide bonds were also obtained in silico.

Materials and Methods

Modeling of Lacc 6 of Pleurotus ostreatus

The initial alignment was made using ClustalO1 and the secondary structure prediction with Predictprotein program2. The template structure to Lacc 6 model with the highest degree of homology, was search (non-redundant) in BLAST server (Basic Local Alignment Search Tool) through PDB3 (Boratyn et al., 2012). The structural model of the native Lacc 6 laccase from Pleurotus ostreatus was carried out using the Modeller computer package4 (Webb and Sali, 2016).

Preparation of Mutant Proteins of Lacc 6

The thermostable Lacc 6 quimeric protein was determinated by two ways: 1) making an exhaustive literature search to find all laccases with t1/2 over 55°C (Hildén et al., 2009) to structure multiple models of them whith Modweb-ModBase server5 to find the invariant structural motif-interaccions, and 2) finding the most favorable and thermodynamic residue shift in Lacc 6 by PopMusic server6 (Dehouck et al., 2011), each of any shitf were constructed using UCSF CHIMERA7 with SWAPAA algorithm that performs a side chain replacement by rotamers search selecting the lowest score and shocks between the new side chain and chains of its neighborhood (Fersht et al., 1986).

Minimization of Thermodynamic Energy of Lacc 6 Mutants

Once the mutants were built, they were minimized by the steepest descent protocol up to 0.01 kcal/mol, with the NAMD 2.12 package (Scalable Molecular Dynamics) (Phillips et al., 2005), using the CHARMM36 (Chemistry at Harvard Macromolecular Mechanics) force field (Huang et al., 2017), it was performed with explicit solvent at a physiological sodium chloride (NaCl) ion concentration of 0.15 M, the parameters for the copper atoms were taken from Ungar et al. (1997).

Normal Mode Analysis

After the minimization, the structures with the lowest energy, these assumed as the most stable energetically (thermostable mutants) (Burkoff et al., 2012), to later be studied through by the Normal Modes theory with the elNémo server, available at http://www.sciences.univ-nantes.fr/elnemo/ (Suhre and Sanejouand, 2004). The thermostable mutants were always contrasted with Lacc 6 throughout all the work, and all images were constructed using Visual Molecular Dynamics (VMD) Sofware (Humphrey et al., 1996).

Results

The Lacc 6 sequence of Pleurotus ostreatus shown below (UniProtKB: A0A067NQH1_PLEOS), which is constituted by 533 amino acids, where the first 21 residues correspond to the signal peptide.

The secondary structure prediction of Lacc 6 was performed in Predictprotein program8 (Yachdav et al., 2014). The initial alignment was performed using 142 laccase sequences from Trametes using the ClustalO program8 (Sievers et al., 2011) and the best homologous structure obtained with the BLAST server was the laccase of Trametes versicolor 1GYC (Protein Data Bank, PBD), it is worth mentioning that the alignment was consistent with the template structure and the active sites were perfectly aligned between them. Consequently, 1GYC structure was used as a template to make the model of Lacc 6, the homology between its sequence and 1GYC was close to 62% (UniProt Consortium 2012; Coluzza, 2017). The model of Lacc 6 (Figure 1) was built through Modeller computer package with a DOPE score of −1.88. On the other hand, the Lacc 6 model and the prediction of its secondary structure were highly related. The motifs of the Lacc 6 model were characterized by the PDBsum program, by which it was determined that the scaffolding of Lacc 6 consists of: 7 β-sheets, 9 β-hairpin, 8 β-bulge, 28 β-sheets, 10 α-helices (2 of them with helix-helix interactions), 44 β-turns, 8 γ-turns, and 2 disulfide bridges. Once the model was constructed and verified, it was proceeded to be minimized with the purpose of eliminating the steric shocks.

FIGURE 1

To generate a thermostable mutant of Lacc 6 according to structural evolution, an exhaustive search of literature on laccases with thermal resistance was carried out (Pezeshgi-Modarres et al., 2016; Coluzza, 2017), of which almost all those found were modeled and reported in Table 1.

1020304050
MAVAFVALVSLALALVRVEASIGPRGTLNIANKVIQPDGFSRSTVLAGGS
60708090100
YPGPLIKGKTGDRFQINVVNKLADTSMPVDTSIHWHGLFVKGHNWADGPA
110120130140150
MVTQCPIVPGHSFLYDFEVPDQAGTFWYHSHLGTQYCDGLRGPLVVYSKN
160170180190200
DPHKRLYDVDDESTVLTVGDWYHAPSLSLTGVPHPDSTLFNGLGRSLNGP
210220230240250
ASPLYVMNVVKGKRYRIRLINTSCDSNYQFSIDGHTFTVIEADGENTQPL
260270280290300
QVDQVQIFAGQRYSLVLNANQAVGNYWIRANPNSGDPGFENQMNSAILRY
310320330340350
KGARSIDPTTPEQNATNPLREYNLRPLIKKPAPGKPFPGGADHNINLNFA
360370380390400
FDPATALFTANNHTFVPPTVPVLLQILSGTRDAHDLAPAGSIYDIKLGDV
410420430440450
VEITMPALVFAGPHPLHLHGHTFAVVRSAGSSTYNYENPVRRDVVSIGDD
460470480490500
PTDNVTIRFVADNAGPWFLHCHIDWHLDLGFAVVFAEGVNQTAAANPVPE
510520530
AWNNLCPIYNSSNPSKLLMGTNAIGRLPAPLKA

Table 1

Organismtopt(°C)t1/2(°C)t1/2(°h)UniPropt-EntryPDB ID or Template% HomologyReference
Albatrella dispansus70nrnrWang and Ng, 2004
Basidiomycete PM1 (CECT 2971)80nrnrQ125715ANHColl et al., 1993
Coprinus cinereus60–70600.5Q9Y7801HFUSchneider et al., 1999
Coriolopsis gallica (A-241)7060nrQ9P8G41GYC 3KW7 5NQ865
65
65
Calvo et al., 1998
Daedalea quercina (CCBAS528)70650.5Q6VPS61GYC 2XYB 5NQ874
67
68
Dedeyan et al., 2000
Marasmius quercophilus75–804048AF1627855ANH 2HRG 5A7E99
97
96
Baldrian, 2006
Physisporinus rivulosusnr701.0I1W1V73KW7 5NQ7 2XYB73
70
70
Hildén et al., 2007
Steccherinum ochraceum70701.7I1SB145ANHChernykh et al., 2008
Trametes gallica70nrnrC5IXN83KW7 5A7E 4A2D73
71
71
Dong and Zhang, 2004
Trametes versicolor80nrnrQ5IR801GYC 3X1B 5LDU99
77
80
Koschorreck et al., 2008
Tricholoma giganteum70nrnrWang and Ng, 2004
Peniophora sp. UD470nrnrA0A2I6HE302QT6 4JHU 4A2D63
63
62
Jordaan and Leukes, 2003
Melanocarpus albomyces60–70605.0Q70KY32Q9OKiiskinen et al., 2004
Myceliophthora thermophilanr700.3G2QG311GW0 3PPS 3SQR75
68
37
Berka et al., 1997

Catalytic properties at high temperatures of laccase enzymes and accessions data.

topt(°C): Optime temperature, t1/2(°C): Media temperature, t1/2(h): Media time, nr: Not reported.

Once discovered the thermostable laccases and built their models, this type of proteins was studied with the purpose to find their structural motifs invariants such as salt bridges, ionic interactions and disulfide bonds (Fersht et al., 1986). The structural invariant interactions between Lacc 6 and models or structures of thermostable laccases can be see in Table 2. Location of each mutation was obtained by Lacc 6 model overlap whit any thermostable laccases. Were determined structurally the networks of conserved electrostatic interactions of thermal laccases (Table 2, Columns 2 and 3).

Table 2

AlignmentDisulfide bridgesIonic interactionsDisturbance of active site
MutantS431DD233C-T310CG234RF468P
I217FH184C-S284CS264EF481M
V79DK396C-D399CT147EG420L
N275KN94C-G465CG234K/Q271E/N270D (3-SB)L132T
N275RD233C-T310C/H184C-S284CG234E/Q271K/N270RL416I
V372DD233C-T310C/H184C-S284C/ K396C-D399C (4-DB)G234D/Q271K/N270RL469F
Q65RD233C-T310C/H184C-S284C/K396C-D399C/N94C-G465CG234R/Q271E/N270D (3-SB)W85V
S130D
W85F

Mutants with potential to confer thermal stability or disturbance the active site of the enzyme Lacc 6.

Second column shows the mutations obtained by multiple alignment, these residues are highly conserved over time; in columns three to five, the mutants were build through structure-overlapping between Lacc 6 and the all other models/structures to find the conservative structures motifs. Disulfide bridges and Ionics interaccions are deposited in three and four columns, respectively. In the last column are the mutants that can break the active site.

By another way, the PoPMuSic hot points (most favorable thermodynamic residue shift) with the ability to confer structural stability to Lacc 6 at high temperatures can be see in Table 3.

Table 3

Hot pointsShiftΔΔG (kcal/mol)
1203PRO → VAL−1.91
2203PRO → CYS−1.89
3487GLU → ILE−1.75
5487GLU → TYR−1.75
6170ASP → TYR−1.5
7170ASP → PHE−1.47
8399ASP → MET−1.37
9142GLY → PHE−1.35
10183PRO → TRP−1.2

Main mutations obtained by PoPMuSiC program.

The 10 mutants (shift residue) with the best and favorable energy in contrast to Lacc 6. The amino acid sequence number is found in second colum, in the next columna is the hot poin residue and their shift, the last column presnt the ΔΔG between Lacc 6 and mutant protein.

Table 3 contains the shift residue information, the evolutionary invariants with high capacity of confer thermoresistant in Lacc 6 enzyme sequences are reflected on this. The alignment (Figure 2) of the 16 structures, created by WebLogo program10, capture the conservation propensity of each mutate residue set in column 3, with this approach we can see that the best single mutant is P203V showing a ΔΔG = −1.91 kcal/mol below the Lacc 6.

FIGURE 2

Based on the Tables 2, 3, a mutant energy minimization was performed in each one, to define the most suitable shift that could confer structural resistance to Lacc 6 (Liwo et al., 2002; Nakagawa and Peyrard, 2006). The mutant energy ponderation on the Table 4 shows that 4-DB, 3-DB, and D233C-T310C (highlighted in gray), are the most favorable energy mutants with the ability to confer structural thermal-resistance. In this singular way, was appreciate that the best designed laccases by the evolution are those with a disulfide bridges networks such as the mutants mentioned above.

Table 4

MethodMutantΔE (kcal/mol)
PoPMuSiCD170F0.067
D170T0.063
D399M0.009
E487I0.040
E487Y0.091
G142F0.066
P183T0.094
P203C−0.063
P203V−0.025
AlignmentG431D0.013
I217F0.020
N275K0.068
N275R0.045
N372D−0.003
N79D−0.050
Q65R0.007
Ionic interactionG234D-N271K-N270R0.073
G234E-N271K-N270R0.059
G234k-N271E-N270D−0.010
G234R0.184
(3-SB) G234R-N271E-N270D−0.094
S264E0.038
T147E−0.044
Disulfide bridgesD233C-T310C/H184C-S284C−0.002
(3-DB) D233C-T310C/H184C-S284C/K396C-D399C−0.131
(4-DB) D233C-T310C/H184C-S284C/K396C-D399C/N94C-G465C−0.177
D233C-T310C−0.100
H184C-S284C−0.064
K396C-D399C−0.037
N94C-G465C0.007
Disturbance of active siteF468P−0.091
F481M−0.022
G420L0.136
L132T−0.084
L416I0.029
L469F−0.009
M85V0.014
S130D−0.017
W85F−0.042

Energy difference between the native enzyme and their mutants.

In the first column are represented the search method for the proposed mutants; second column, the proposed residue shift for the mutants design and the last column presents the mutant energy after the minimization, taking as a baseline the Lacc 6 energy.

Once the energy differences were quantified and analyzed, was continued with a Normal Modes study of the thermostable mutants (4-DB, 3-DB, D233C-T310C, 3-SB, F468P, L132T, and others). The intention of Normal Modes Study is know the collective and correlated movements of the lower energy mutant modes (Tama and Sanejouand, 2001). The modes emitted by the ElNemo program include six trivial zero order frequencies. This study focused on mode 7, corresponds to the protein internal movements identified in direction of maximum movement; 10 snapshots of any structure (referring to the minimized initial structure) were obtained to display and represent the mode dynamics. The difference in the mean squared value of the normalized displacement (R2) of each alpha carbon (Cα) is plotted as a function of the number of residues, where for all residues, significantly mobile regions are seen above and still below the line in the graph of Figure 3.

FIGURE 3

The movements of the Cα for normal mode 7 are plotted as a function of the number of residues. The residue with the least displacement appears with a minimum value of R2 below the line at the origin. The higher amplitude values are due to the zones near to the cavity and to the terminal helix, the latter usually being a meaningless section since it is usually an artifact of the software itself, it is usually eliminated before calculations (Altschul et al., 1990).

At a higher energy as shown in Table 4, but still moderate, with a change in the higher R2 for the 4-DB mutant, it exhibits vibrational movements and a flexibility more intense compared to Lacc 6, on the other hand, the 3-DB mutant also shows an even more moderate energy decrease than 4-DB, and also leads to a reduction in the change of R2, becoming a more rigid and less fluctuating structure as shown in Figure 4. The results show that for most of the mutants in which the change in the neighborhoods of the active site was made, it was disturbed as shown in Figure 5, where the L132T mutant is observed. These results indicate that most of the Lacc 6 regions and their mutants behave as a coupled structure that is mutually flexible or rigid, regardless of the energy calculated by the minimization. Inside the protein, displacement is close to 0. At the ends was observed a projection of displacement in the neighborhoods of the mutations; Left upper panel, D233C/T310C mutation; Right upper panel, K396C/D399C mutation and lower right panel, H184C/S284C mutation. On the mode 7, the native protein has greater variation compared to the mutant protein (Figure 6).

FIGURE 4

FIGURE 5

FIGURE 6

The three lower frequency movements, 7, 8, and 9, were selected as global representations of the movements (Table 5). Normal mode 7 was selected because values close to zero allow localized movements to be visualized, since normal low-frequency modes are expected to have collective characters, especially those related to the functional conformations of the protein (Tama and Sanejouand, 2001). In addition, as shown in Figure 7, the residues underwent significant displacement, although the structural deviation is small since the differences in RMSD (Root Mean Square Deviation) between the native protein and its mutants are about 1 Å, as can be seen in Table 5. Mode 7 shows a counter-rotation torsion between the structural domains, as can be seen in Figure 6, which would imply inclination and helical flexion, also one can observe that one of the domains rotate around an axis perpendicular to the plane of the membrane, while the others rotate around an inclined axis, this type of movements have not been described for this type of proteins.

Table 5

MutantModeRMSDFraction of displacement
4-DB71.0970.3211
81.1090.0883
91.1090.5263
3-DB71.0040.0134
81.0040.5754
91.0040.5323
D233C-T310C71.0160.2418
81.0160.1575
90.9980.3829
F468P71.0040.4454
81.0040.0866
90.9990.5285
3-SB71.0140.1945
81.0140.1693
91.0110.5415
L132T70.970.0456
80.970.3889
90.970.4427
N79D71.0440.0363
81.0440.4279
91.0340.4928
N372D71.020.0716
81.020.3694
91.020.5128
P203C70.9660.055
80.9660.3882
90.9660.5439
P203V71.0280.0161
81.0280.5793
91.0280.5364
T147E70.980.0597
80.980.347
90.980.5303
W85F71.030.0271
81.030.5306
91.030.5073
Lacc 670.0794
80.2892
90.3396

Root Mead Squarer Deviation (RMSD) values and displacement (fraction) for the mutant enzymes compared to Lacc 6.

Column number 1 are the models of lower energy; in column 2, are the normal mode 7–9; in the column 3 the RMSD vs. Lacc 6; and the last column shows the fraction of residues that are significantly affected by a given mode.

FIGURE 7

Flexibility and low energy motions were compared between the Lacc 6 and its mutants, ElNemo indicated that the low energy motions between the enzymes for their mutant and native form contain a nucleus in the protein that is immobile except for the L132T and F468P mutants (Figures 6B,D) for which the disturbance of the active site underwent significant alterations, in addition to some mobile external secondary structures.

Figures 47 make it possible to appreciate that the more flexible regions act as an interdomain hinge which allows coordinated movements of counter-rotational of each of these. ElNemo mode 7 shows the near domain to remote copper from the trinuclear copper site, it curves and straightens significantly according to the swinging of the contiguous domains, because the copper binding site implies a face of this domain (Figure 8 and Figure 1), these motions could be coupled to binding to the substrate or affect their affinity, especially in mutants designed to disturb the active site.

FIGURE 8

Discussion

In this study, a bioinformatic analysis of enzyme Lacc 6 of Pleurotus ostreatus and minimization of energy of mutants of this same enzyme, to improve its stability in non-optimal conditions of activity for its possible synthesis and application in the degradation of agroindustrial residues that have been underutilized.

Agroindustrial wastes are a source of environmental pollution, since its composition is rich in lignin, cellulose and hemicellulose that require enzymatic complexes for its decomposition. For example, in 2006, Mexico produced about 76 million tons of agroindustrial waste from 20 types of cultivation and there are no physical, chemical, or enzymatic transformation techniques for their use (Valdez-Vazquez et al., 2010). Laccases have been associated with various biological functions, depending on the organism and its developmental conditions, are secreted into multiple isoforms and its most well-known and studied function is the degradation of lignin (Téllez-Téllez et al., 2008; Díaz et al., 2013).

On the other hand, these types of enzymes have applications of great interest in the industry and within their characteristics must be produced at low cost, be stable to the working conditions in wide ranges of pH and temperature for the treatment of pollutants (Téllez-Téllez et al., 2008; Miele et al., 2010; Díaz et al., 2013). In this study a proposal is made of an improved laccase that shows a minimum activation energy that allows it to be stable and active under adverse reaction conditions.

Several studies have been carried out on the generation of Pleurotus ostreatus laccase enzyme mutants as an alternative to be applied in the biodegradation of xenobiotic and/or recalcitrant compounds as reported by Miele et al. (2010), who randomly performed the generation of 2300 mutants of the POXA1b (Lacc 6) isoenzyme of Pleurotus ostreatus to develop biocatalysts from this enzyme, but no proposal has been made to know how the possible mutations occurred on the active site of this enzyme and to obtain models that would show the effect on the trinuclear copper region by modifying amino acids adjacent to the histidines bound to these metals as is done in this research.

On the other hand, Prins et al. (2015), observed the effect of mutations near the Cu 1 copper site of Streptomyces coelicolor A3 (2), to evaluate their biochemical characteristics against the native enzyme, obtaining three mutations (M298F, V290N, and V290A), the V290N mutant showed approximately double the activity, four to five times greater was the activity of the mutant M298F, however, the thermostability was decreased. In contrast to this study, where the proposed mutations (3-DB, 3-SB, P203C) allowed us to see the effect on the secondary structure of the protein; the changes occurring in the active site region and the energy minimization suggests an increase in the thermostability of the protein and that could tolerate higher to optimal temperatures for prolonged times. Such mutants may be candidates for in vitro expression, as shown in multiple works (Christensen and Kepp, 2013a; Ghosh et al., 2016), in which in silico studies allow the generation and identification of molecular bases in an expeditious manner which are difficult to quantify experimentally, and in vitro studies are feasibly reproduced by in silico studies (Zou et al., 2016), showing that computational tools are a primary aid in the structural study of proteins. Given the results, the production of mutant enzymes is suggested through genetic engineering to be used in bioremediation processes.

In recent years, computational design has been successfully applied for the thermostabilization of enzymes with potential use in biotechnological processes, mimicking the evolution in the laboratory to develop more stable enzyme variants and, more recently, using rational strategies of computer-assisted enzymatic engineering. Festa et al. (2008) performed one of the first notable works in the computational stabilization of a laccase, presented a screening library of 1100 clones of the mutant 1M9B obtained from Pleurotus ostreatus, and showed a single mutation (L112F) giving rise to a more active enzyme but less stable with respect to the native enzyme (POXA1b or Lacc 6), same enzyme used in our research.

On the other hand, Christensen and Kepp (2013a,b), exhaustively studied the isoforms of the laccase of Tramentes versicolor by molecular dynamics and other computational techniques in which they predict and rationalize a laccase to provide stability to mutations of multiple sites in its structure, showing that it is possible to generate stable mutants through computational studies, although to carry it out it turned out to be expensive. Ferrario et al. (2015), tested a thermal treatment with simulations of molecular dynamics on a laccase enzyme, observed that the enzyme conserved its geometry even making conformational changes in the labile parts. In contrast to our research in which through the protocol used to increase the thermal stability of Lacc 6 based on a rational approach by means of multiple methods including phylogenetic analysis, comparison with homologous proteins (particularly thermophilic), optimization of charged interactions (saline bridges and hydrogen bonds), optimization of waste and loops that show unfavorable Ramachandran angles as well as high B factors and computational design based on the structure, suggest a fast and inexpensive computational alternative.

Conclusion

Normal modes indicate that the nucleus of the mutants is found without significant motions, however, the exposed sections and in particular the domain of the distant copper undergo movements counter-rotation and global compression. Likewise, it is predicted that lower energy mutants such as 3-DB, 3-SB, P203C minimize fluctuations by making the skeleton less flexible in the vicinity of them, decreasing the range of motions. In the same way it is found that the mutants L132T and D468P generate a conformational change in the vicinity of the active site. This work predicts the global movements of the enzyme laccase, while providing a new perspective of these enzymes. This allows us to discuss the character of the movement in multiple structures on the same basis and as expected the normal low frequency modes from the modeling of the elastic network provide a good description of the global movements of this enzyme, which allows us to understand the molecular basis of the structural stability of the Lacc 6 enzyme of Pleurotus ostreatus and its mutants. This suggests that it will have greater stability in its structure that will allow it to have oxidase activity at temperatures above the optimum.

Statements

Author contributions

RD performed the experimental design, directed the over-all study, and also drafted the manuscript. YM-F, GD-G and MA-R helped perform the analysis of results and revised the manuscript. LH-Z performed the protein modeling and revised the manuscript. All authors read and approved the final manuscript.

Funding

This study was funded by the Mexican Council of Science and Technology (CONACyT) for supporting this research (National sabbatical stay of Rubén Díaz Godínez) and the Polytechnic University of Pachuca.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

References

  • 1

    AltschulS. F.GishW.MillerW.MyersE. W.LipmanD. J. (1990). Basic local alignment search tool.J. Mol. Biol.215403410. 10.1016/S0022-2836(05)80360-2

  • 2

    AnbarM.GulO.LamedR.SezermanU. O.BayerE. A. (2012). Improved thermostability of Clostridium thermocellum endoglucanase Cel8A by using consensus-guided mutagenesis.Appl. Environ. Microbiol.7834583464. 10.1128/aem.07985-11

  • 3

    BaldrianP. (2006). Fungal laccases-occurrence and properties.FEMS. Microbiol. Rev.30215242. 10.1111/j.1574-4976.2005.00010.x

  • 4

    BerkaR. M.SchneiderP.GolightlyE. J.BrownS. H.MaddenM.BrownK. M.et al (1997). Characterization of the gene encoding an extracellular laccase of Myceliophthora thermophila and analysis of the recombinant enzyme expressed in Aspergillus oryzae.Appl. Environ. Microbiol.6331513157.

  • 5

    BoratynG. M.SchäfferA. A.AgarwalaR.AltschulS. F.LipmanD. J.MaddenT. L. (2012). Domain enhanced lookup time accelerated BLAST.Biol. Direct.7:12. 10.1186/1745-6150-7-12

  • 6

    BurkoffN. S.VárnaiC.WellsS. A.WildL. D. (2012). Exploring the energy landscapes of protein folding simulations with bayesian computation.Biophys. J.102878886. 10.1016/j.bpj.2011.12.053

  • 7

    CalvoA. M.Copa-PatiñoJ. L.AlonsoO.GonzálesA. E. (1998). Studies of the production and characterization of laccase activity in the basidiomycete Coriolopsis gallica, an efficient decolorizer of alkaline effluents.Arch. Microbiol.1713136. 10.1007/s002030050674

  • 8

    ChernykhA.MyasoedovaN.KolomitsevaM.FerraroniM.BrigantiF.ScozzafavaA.et al (2008). Laccase isoforms with unusual properties from the basidiomycete Steccherinum ochraceum 1833.J. Appl. Microbiol.10520652075. 10.1111/j.1365-2672.2008.03924.x

  • 9

    ChristensenN. J.KeppK. P. (2013a). Stability mechanisms of a thermophilic laccase probed by molecular dynamics.PLoS One8:e61985. 10.1371/journal.pone.0061985

  • 10

    ChristensenN. J.KeppK. P. (2013b). Stability mechanisms of laccase isoforms using a modified FoldX protocol applicable to widely different proteins.J. Chem. Theory Comput.932103223. 10.1021/ct4002152

  • 11

    CollP. M.Fernández-AbalosJ. M.VillanuevaJ. R.SantamaríaR.PérezP. (1993). Purification and characterization of a phenoloxidase (laccase) from the lignin-degrading basidiomycete PM1 (CECT 2971).Appl. Environ. Microbiol.5926072613.

  • 12

    ColuzzaI. (2017). Computational protein design: a review.J. Phys. Condens. Matter.29:143001. 10.1088/1361-648X/aa5c76

  • 13

    DasS.EisenA.LinY. H.ChanH. S. (2018). A lattice model of charge-pattern-dependent polyampholyte phase separation.J. Phys. Chem. B.12254185431. 10.1021/acs.jpcb.7b11723

  • 14

    DedeyanB.KlonowskaA.TaggerS.TronT.LacazioG.GilG.et al (2000). Biochemical and molecular characterization of a laccase from Marasmius quercophilus.Appl. Environ. Microb.66925929. 10.1128/AEM.66.3.925-929.2000

  • 15

    DehouckY.KwasigrochJ. M.GilisD.RoomanM. (2011). PoPMuSiC 2.1: a web server for the estimation of protein stability changes upon mutation and sequence optimality.BMC Bioinformatics12:151. 10.1186/1471-2105-12-151

  • 16

    DíazR.Téllez-TéllezM.SánchezC.Díaz-GodínezG.Soriano-SantosJ. (2013). Influence of initial pH of the growing medium on the activity, production and genes expression profiles of laccase of Pleurotus ostreatus in submerged fermentations.Electron. J. Biotechnol.16. 10.2225/vol16-issue4-fulltext-6

  • 17

    DjikaevY. S.RuckensteinE. (2008). Temperature effects on the nucleation mechanism of protein folding and on the barrierless thermal denaturation of a native protein.Phys. Chem. Chem. Phys.1062816300. 10.1039/b807399f

  • 18

    DongJ. L.ZhangY. Z. (2004). Purification and characterization of two laccase isoenzymes from a ligninolytic fungus Trametes gallica.Prep. Biochem. Biotechnol.34179194. 10.1081/PB-120030876

  • 19

    DubeyM. K.ZehraA.AamirM.MeenaM.AhirwalL.SinghS.et al (2017). Improvement strategies, cost effective production, and potential applications of fungal glucose oxidase (GOD): current updates.Front. Microbiol.8:1032. 10.3389/fmicb.2017.01032

  • 20

    FerrarioV.ChernykhA.FiorindoF.KolomytsevaM.SinigoiL.MyasoedovaN.et al (2015). Investigating the role of conformational effects on laccase stability and hyperactivation under stress conditions.Chembiochem.1623652372. 10.1002/cbic.201500339

  • 21

    FershtA. R.LeatherbarrowR. J.WellsT. N. C. (1986). Quantitative analysis of structure–activity relationships in engineered proteins by linear free-energy relationships.Nature322284286. 10.1038/322284a0

  • 22

    FestaG.AutoreF.FraternaliF.GiardinaP.SanniaG. (2008). Development of new laccases by directed evolution: functional and computational analyses.Proteins722534. 10.1002/prot.21889

  • 23

    GaoX.ZengJ.YiH.ZhangF.TangB.TangX. F. (2016). Four inserts within the catalytic domain confer extra stability and activity to hyperthermostable pyrolysin from Pyrococcus furiosus.Appl. Environ. Microbiol.83:e03228-16. 10.1128/aem.03228-16

  • 24

    GhoshM.SodhiS. S.SharmaN.MongreR. K.KimN.SinghA. K.et al (2016). An integrated in silico approach for functional and structural impact of non- synonymous SNPs in the MYH1 gene in Jeju Native Pigs.BMC Genetics17:35. 10.1186/s12863-016-0341-1

  • 25

    GovardhanC. (1999). Crosslinking of enzymes for improved stability and performance.Curr. Opin. Biotechnol.10331335. 10.1016/S0958-1669(99)80060-3

  • 26

    GribenkoA. V.PatelM. M.LiuJ.McCallumS. A.WangC.MakhatadzeG. I. (2009). Rational stabilization of enzymes by computational redesign of surface charge-charge interactions.Proc. Natl. Acad. Sci. U.S.A.10626012606. 10.1073/pnas.0808220106

  • 27

    HildénK.HakalaT. K.LundellT. (2009). Thermotolerant and thermostable laccases.Biotechnol. Lett.3111171128. 10.1007/s10529-009-9998-0

  • 28

    HildénK.HakalaT. K.MaijalaP.LundellT. K.HatakkaA. (2007). Novel thermotolerant laccases produced by the white-rot fungus Physisporinus rivulosus.Appl. Microbiol. Biotechnol.77301309. 10.1007/s00253-007-1155-x

  • 29

    HuangJ.RauscherS.NawrockiG.RanT.FeigM.de GrootB. L.et al (2017). CHARMM36m: an improved force field for folded and intrinsically disordered proteins.Nat. Methods147173. 10.1016/j.bpj.2016.11.971

  • 30

    HumphreyW.DalkeA.SchultenK. (1996). VMD: visual molecular dynamics.J. Mol. Graph.143338. 10.1016/0263-7855(96)00018-5

  • 31

    JordaanJ.LeukesW. D. (2003). Isolation of a thermostable laccase with DMAB and MBTH oxidative coupling activity from a mesophilic white rot fungi.Enzyme. Microb. Technol.33212219. 10.1016/S0141-0229(03)00116-9

  • 32

    KeanK. M.PorterJ. J.MehlR. A.KarplusP. A. (2017). Structural insights into a thermostable variant of human carbonic anhydrase II.Protein Sci.27573577. 10.1002/pro.3347

  • 33

    KiiskinenL. L.RättöM.KruusK. (2004). Screening for novel laccase-producing microbes.J. Appl. Microbiol.97640646. 10.1016/S0141-0229(03)00116-9

  • 34

    KoschorreckK.RichterS. M.SwierczekA.BeifussU.SchmidR. D.UrlacherV. B. (2008). Comparative characterization of four laccases from Trametes versicolor concerning phenolic C-C coupling and oxidation of PAHs.Arch. Biochem. Biophys.474213219. 10.1016/j.abb.2008.03.009

  • 35

    KramerK. J.KanostM. R.HopkinsT. L.JiangH.Cheng-ZhuY.XuR.et al (2001). Oxidative conjugation of chatecols with proteins in insect skeletal system.Tetrahedron57385392. 10.1016/S0040-4020(00)00949-2

  • 36

    KumarS.PrakashS.GuptaK.DongreA.BalaramP.BalaramH. (2016). Unexpected functional implication of a stable succinimide in the structural stability of Methanocaldococcus jannaschii glutaminase.Nat. Commun.7:12798. 10.1038/ncomms12798

  • 37

    LiwoA.ArlukowiczP.CzaplewskiC.OłdziejS.PillardyJ.ScheragaH. A. (2002). A method for optimizing potential-energy functions by a hierarchical design of the potential-energy landscape: application to the UNRES force field.Proc. Natl. Acad. Sci. U.S.A.9919371942. 10.1073/pnas.032675399

  • 38

    Luna-MartínezO. D.Vidal-LimónA.Villalba-VelázquezM. I.Sánchez-AlcaláR.Garduño-JuárezR.UverskyV. N.et al (2016). Simple approach for ranking structure determining residues.PeerJ4:e2136. 10.7717/peerj.2136

  • 39

    MayerA. M.StaplesR. C. (2002). Laccase: new functions for an old enzyme.Phytochemistry60551565. 10.1016/S0031-9422(02)00171-1

  • 40

    MieleA.GiardinaP.SanniaG.FaracoV. (2010). Random mutants of a Pleurotus ostreatus laccase as new biocatalysts for industrial effluents bioremediation.J. Appl. Microbiol.1089981006. 10.1111/j.1365-2672.2009.04505.x

  • 41

    NakagawaN.PeyrardM. (2006). The inherent structure landscape of a protein.Proc. Natl. Acad. Sci. U.S.A.10352795284. 10.1073/pnas.0600102103

  • 42

    NawazM. A.RehmanH. U.BibiZ.AmanA.Ul QaderS. A. (2015). Continuous degradation of maltose by enzyme entrapment technology using calcium alginate beads as a matrix.Biochem. Biophys. Rep.4250256. 10.1016/j.bbrep.2015.09.025

  • 43

    OdaK.KinoshitaM. (2015). Physicochemical origin of high correlation between thermal stability of a protein and its packing efficiency: a theoretical study for staphylococcal nuclease mutants.Biophys. Physicobiol.12112. 10.2142/biophysico.12.0_1

  • 44

    PappenbergerG.SchurigH.JaenickeR. (1997). Disruption of an ionic network leads to accelerated thermal denaturation of D-glyderaldehyde-3-phosphate dehydrogenase from the hyperthermolphilic bacterium Thermotoga maritima.J. Mol. Biol.274676683. 10.1006/jmbi.1997.1421

  • 45

    Pezeshgi-ModarresH. P.MofradabM. R.Sanati-NezhadA. (2016). Protein thermostability engineering.RSC. Adv.6115252115270. 10.1039/C6RA16992A

  • 46

    PhillipsJ. C.BraunR.WangW.GumbartJ.TajkhorshidE.VillaE.et al (2005). Scalable molecular dynamics with NAMD.J. Comput. Chem.2617811802. 10.1002/jcc.20289

  • 47

    PrinsA.KleinsmidtL.KhanN.KirbyB.KudangaT.VollmerJ.et al (2015). The effect of mutations near the T1 copper site on the biochemical characteristics of the small laccase from Streptomyces coelicolor A3(2).Enzyme. Microb. Tech.682332. 10.1016/j.enzmictec.2014.10.003

  • 48

    RadestockS.GohlkeH. (2011). Protein rigidity and thermophilic adaptation.Proteins7910891108. 10.1002/prot.22946

  • 49

    ReedC. J.LewisH.TrejoE.WinstonV.EviliaC. (2013). Protein Adaptations in Archaeal Extremophiles.Archaea2013:373275. 10.1155/2013/373275

  • 50

    SchneiderP.CaspersenM. B.MondorfK.HalkierT.SkovL. K.ØstergaardP. R.et al (1999). Characterization of a Coprinus cinereus laccase.Enzyme Microb. Technol.25502508. 10.1016/S0141-0229(99)00085-X

  • 51

    SharmaP.GoelR.CapalashN. (2007). Bacterial laccase.World J. Microb. Biot.23823832. 10.1007/s11274-006-9305-3

  • 52

    Shuresh-KumarS. V.PrashantS.DuraniS.PramodW. (2003). Combined sequence and structure analysis of the fungal laccase family.Biotechnol. Bioeng.83386394. 10.1002/bit.10681

  • 53

    SieversF.WilmA.DineenD.GibsonT. J.KarplusK.LiW.et al (2011). Fast, scalable generation of high-quality protein multiple sequence alignments using Clustal Omega.Mol. Syst. Biol.7:539. 10.1038/msb.2011.75

  • 54

    SohiniB.SrikantaS. (2009). Turning a mesophilic protein into a thermophilic one: a computational approach based on 3D structural features.J. Chem. Inf. Model.4917411750. 10.1021/ci900183m

  • 55

    SuhreK.SanejouandY. H. (2004). ElNemo: a normal mode web server for protein movement analysis and the generation of templates for molecular replacement.Nucleic. Acids. Res.32W610W614. 10.1093/nar/gkh368

  • 56

    TamaF.SanejouandY. H. (2001). Conformational change of proteins arising from normal mode calculations.Protein Eng.1416. 10.1093/protein/14.1.1

  • 57

    Téllez-TéllezM.FernándezF. J.Montiel-GonzálezA. M.SánchezC.Díaz-GodínezG. (2008). Growth and laccase production by Pleurotus ostreatus in submerged and solid-state fermentation.Appl. Microbiol. Biot.81675679. 10.1007/s00253-008-1628-6

  • 58

    UngarL. W.SchererN. F.VothG. A. (1997). Classical molecular dynamics simulation of the photoinduced electron transfer dynamics of plastocyanin.Biophys. J.72517. 10.1016/S0006-3495(97)78642-9

  • 59

    UniProt Consortium. (2012). Reorganizing the protein space at the Universal Protein Resource (UniProt).Nucleic. Acids. Res.40D71D75. 10.1093/nar/gkr981

  • 60

    Valdez-VazquezI.Acevedo-BenitezJ. A.Hernandez-SantiagoC. (2010). Distribution and potential of bioenergy resources from agricultural activities in Mexico.Renew. Sust. Energy Rev.1421472153. 10.1016/j.rser.2010.03.034

  • 61

    VenkataramaniS.TruntzerJ.ColemanD. (2013). Thermal stability of high concentration lysozyme across varying pH: a fourier Transform Infrared study.J. Pharm. Bioallied Sci.5148153. 10.4103/0975-7406.111821

  • 62

    WangH. X.NgT. B. (2004). A novel laccase with fair thermostability from the edible wild mushroom (Albatrella dispansus).Biochem. Biophys. Res. Commun.319381385. 10.1016/j.bbrc.2004.05.011

  • 63

    WebbB.SaliA. (2016). Comparative protein structure modeling using MODELLER.Curr. Protoc. Bioinformatics54:05:Unit–5.6. 10.1002/cpbi.3

  • 64

    WesenbergD.KyriakidesI.AgathosS. N. (2003). White-rot fungi and their enzymes for the treatment of industrial dye effluents.Biotechnol. Adv.22161187. 10.1016/j.biotechadv.2003.08.011

  • 65

    XuF. (2005). Applications of oxidoreductases: recent progress.Indust. Biotechnol.13850. 10.1089/ind.2005.1.38

  • 66

    YachdavG.KloppmannE.KajanL.HechtM.GoldbergT.HampT.et al (2014). PredictProtein–an open resource for online prediction of protein structural and functional features.Nucleic. Acids. Res.42W337W343. 10.1093/nar/gku366

  • 67

    YakimovA. P.AfanasevaA. S.KhodorkovskiyM. A.PetukhovM. G. (2016). Design of Stable α-Helical Peptides and Thermostable Proteins in Biotechnology and Biomedicine.Acta Nat.87081.

  • 68

    ZhouX. X.WangY. B.PanY. J.LiW. F. (2008). Differences in amino acids composition and coupling patterns between mesophilic and thermophilic proteins.Amino Acids342533. 10.1007/s00726-007-0589-x

  • 69

    ZouJ.SongB.SimmerlingC.RaleighD. (2016). Experimental and computational analysis of protein stabilization by Gly-to-d-Ala substitution: a convolution of native state and unfolded state effects.J. Am. Chem. Soc.1381568215689. 10.1021/jacs.6b09511

Summary

Keywords

laccase, Pleurotus ostreatus, Lacc 6, mutants, energy minimization

Citation

Díaz R, Díaz-Godínez G, Anducho-Reyes MA, Mercado-Flores Y and Herrera-Zúñiga LD (2018) In silico Design of Laccase Thermostable Mutants From Lacc 6 of Pleurotus Ostreatus. Front. Microbiol. 9:2743. doi: 10.3389/fmicb.2018.02743

Received

26 July 2018

Accepted

26 October 2018

Published

14 November 2018

Volume

9 - 2018

Edited by

Zofia Piotrowska-Seget, University of Silesia of Katowice, Poland

Reviewed by

Mirosława Słaba, University of Lodz, Poland; Guiying Li, Guangdong University of Technology, China; Zhen Gao, Nanjing Tech University, China

Updates

Copyright

*Correspondence: Rubén Díaz, Leonardo David Herrera-Zúñiga,

This article was submitted to Microbiotechnology, Ecotoxicology and Bioremediation, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics