ORIGINAL RESEARCH article

Front. Immunol., 12 December 2022

Sec. Vaccines and Molecular Therapeutics

Volume 13 - 2022 | https://doi.org/10.3389/fimmu.2022.1054005

Virus-like particles containing a prefusion-stabilized F protein induce a balanced immune response and confer protection against respiratory syncytial virus infection in mice

  • State Key Laboratory of Virology, College of Life Sciences, Wuhan University, Wuhan, China

Abstract

Respiratory syncytial virus (RSV) is a serious respiratory pathogen in infants and young children worldwide. Currently, no licensed RSV vaccines are available. In this study, we explored stable prefusion conformation virus-like particles (Pre-F VLPs) as RSV vaccine candidates. RSV fusion (F) protein mutants were constructed to form stabilized Pre-F or postfusion (Post-F) configurations. VLPs containing Pre-F or Post-F protein were generated using a recombinant baculovirus (rBV)-insect cell expression system. The assembly and immunological properties of Pre-F or Post-F VLPs were investigated. Pre-F and Post-F VLPs contained antigenic sites Ø and I of pre- and postfusion conformations, respectively. Compared with Post-F VLPs, immunization with Pre-F VLPs elicited upregulation of IFN-γ, IL-2 and IL-10 and downregulation of IL-4 and IL-5 cytokine production in mice. A high percentage of CD25+ Foxp3+ cells or a low percentage of IL-17A-producing cells among CD4+ T cells was observed in the lungs of mice vaccinated with Pre-F VLPs. Importantly, immunization with Pre-F VLPs induced a high level of RSV neutralizing antibody and a balanced immune response, which protected mice against RSV infection without evidence of immunopathology. Our results suggested that Pre-F VLPs generated from rBV-insect cells represent promising RSV vaccine candidates.

Introduction

Human respiratory syncytial virus (RSV) was ascertained as a leading cause of bronchiolitis in infants as early as 1956 (1, 2). RSV infection causes a substantial disease burden in infant, immunocompromised, and elderly populations (35). Natural RSV infection does not induce sustained immunity, and repeated infections occur throughout life (6, 7). Therefore, it is particularly urgent to develop effective treatments and vaccines for RSV infection. Despite extensive efforts, no licensed RSV vaccines are available. Vaccination with formalin-inactivated RSV (FI-RSV) in the 1960s led to vaccine-enhanced disease (VED) upon RSV challenge (810), thus impeding RSV vaccine development. Intensive investigation showed that VED exhibited a strong relationship with the exaggerated Th2-type immune response and the poorly neutralizing antibodies upon RSV infection (1114). Therefore, induction of a Th1-biased, balanced immune response and high neutralizing antibody production are critical for an effective RSV vaccine (15).

The RSV fusion (F) and attachment (G) glycoproteins presented on the virions are the major targets for RSV vaccine candidates (1619). The F glycoprotein, which induces high neutralizing antibody titres and specific cellular immunity, provides immune protection and cross-protection against different RSV strains (20, 21). Crystal structures of both prefusion (Pre-F) and postfusion (Post-F) forms provided structural insights into the antigenicity of RSV F protein (22, 23), demonstrating that vaccines based on the Pre-F configuration represent promising next-generation vaccine candidates (2426). A Pre-F form of the F protein contains an antigenic site Ø, which is not present in its Post-F conformation (27). Specific monoclonal antibodies directed to site Ø exhibited good RSV neutralizing ability (22). The engineered Pre-F protein exhibited enhanced physical and antigenic stability relative to DS-Cav1 (28, 29). A stabilized Pre-F protein elicited significantly increased neutralizing antibody titres compared with the Post-F form in animals, suggesting that a stable Pre-F protein represents a promising strategy for RSV vaccine candidate (27, 3032).

Virus-like particles (VLPs) are effective, safe and promising vaccine platforms (33, 34). VLPs are genetically engineered complexes of multiple copies of protein antigens in a virus-like structure; VLPs lack viral genetic material and therefore cannot replicate (35, 36). Commercial VLP-based licensed vaccines are available against human papilloma and hepatitis B viruses (36). RSV glycoproteins presented as VLPs are highly immunogenic and confer protection against RSV infection (3740). In the present study, we produced and characterized VLPs containing the stable prefusion and postfusion forms of the RSV F protein using an rBV-insect cell expression system. Immune responses and protection against RSV challenge induced by these VLPs were investigated in BALB/c mice.

Materials and methods

Cells, viruses, and preparation of ultraviolet (UV)-inactivated virus and antibodies

HEp-2 and Vero cells were obtained from the China Center for Type Culture Collection (CCTCC; Wuhan, China) and grown in Dulbecco’s modified Eagle’s medium (DMEM) supplemented with 10% foetal bovine serum (FBS, Gibco), 100 IU of penicillin, and 100 mg/ml streptomycin at 37°C and 5% CO2. The respiratory syncytial virus (RSV) A2 strain was maintained in our laboratory. Spodoptera frugiperda 9 (Sf9) cells were obtained from the American Type Culture Collection (ATCC, Rockville, MD, USA) and cultured at 27°C in SF-900 II serum-free medium (SFM) (Invitrogen, USA), 100 IU penicillin and 100 mg/ml streptomycin. RSV was propagated in HEp-2 cells, and virus titres were quantified in Vero cells. RSV purification and inactivation by UV light was performed as previously described (18, 39). Briefly, RSV-infected HEp-2 cells were sonicated, clarified by centrifugation (1,200 × g for 30 min at 4°C) and concentrated by ultracentrifugation (120,000 ×g at 4°C for 6 h). The resultant precipitate was resuspended in phosphate-buffered saline (PBS) for RSV titration. For RSV purification, the resultant precipitate was resuspended in 10% sucrose in PBS; layered on top of a discontinuous sucrose gradient composed of 2 ml of 60%, 45%, and 30% sucrose (in PBS); and then centrifuged at 160,000 × g in a SW28 rotor for 2 h. The visible virus band between the 30% and 45% sucrose layers was collected for subsequent assays. For virus inactivation, 0.5 ml of a purified RSV suspension (106 PFU/ml) in a 35-mm petri dish was irradiated with ultraviolet (UV) light for 40 min, and the efficacy of UV inactivation was examined by determining the infectivity of inactivated RSV in Vero cells using a plaque assay. Mouse anti-F monoclonal antibody (mAb) clone 131-2A (Millipore, Temecula, USA), human anti-F mAb clone D25 (Cambridge Biologics, Boston, USA), goat anti-mouse IgG coupled to horseradish peroxidase (HRP) (Abclonal, Wuhan, China), and goat anti-human IgG coupled to HRP (Abclonal) were used in VLP binding assays.

Construction of plasmids and recombinant baculoviruses

The Pre-F and Post-F forms of RSV F protein (GenBank: ACO83301.1) were prepared as previously described (29, 41, 42). To obtain the stable prefusion F conformation protein, the site mutations N67I, S215P, and D486N were introduced into the F fragment. Then, the sequence encoding the T4 fibritin trimerization domain (foldon, SAIGGYIPEAPRDGQAYVRKDGEWVLLSTFL) was inserted into the position at amino acids 513 to 514 of the F sequence. Subsequently, the P27 (amino acids 110-136) of the F protein was substituted with the linker (GSGSGRS) to generate a prefusion-stabilized F construct with the transmembrane (TM) and cytoplasmic domains (CT) in the F514-574 location (Figure 1A). Similarly, the stable postfusion F form was constructed by deleting the sequence encoding amino acids 137 to 146 of the F protein. The sequence encoding the Pre-F, Post-F conformation, or IAV M1 gene (GenBank: ACP44152.1) was codon optimized for insect codon usage and synthesized by Sangon Biotech (Shanghai, China).

Figure 1

The Pre-F fragment was PCR-amplified using primers Pre-F/F and Pre-F/R with the EcoR I and Xbal I enzyme sites. The amplified product was digested with EcoR I and Xbal I and cloned into the EcoR I/Xbal I-digested pFBDM vector under the control of the promoter polyhedrin (pH) to generate the plasmid pFBDM-Pre-F. Similarly, the Post-F fragment or IAV M1 gene was amplified using primers Post-F-F/R or M1-F/R with the EcoR I and Xbal I enzyme sites and cloned into the pFBDM to generate the plasmid pFBDM-Post-F or pFBDM-M1, respectively. All specific primers used are listed in Table 1.

Table 1

PrimerNucleotide sequence (5′ - 3′)Enzyme
PreF-FCGGAATTC GCCACCATGGAACTGCTGAEcoR I
PreF-RGCTCTAGATTAGTTTGAGAAAGCGATGTTGTTGATTCCXbal I
PostF-FCGGAATTC GCCACCATGGAGTTGCTAEcoR I
PostF-RGCTCTAGATTAGTTACTAAATGCAATATTATTTATACCACXbal I
M1-FCGGAATTC GCCACCATGAGCCTGCTGACCGAGGTGGAGACCTACEcoR I
M1-RGCTCTAGATCACTTGAAACGCTGCATCTGCACXbal I
RSV N-FGGTGGAGAAGCAGGATTCTACCATATATTGFor qRT−PCR
RSV N-RCTGTATTCTCCCATTATGCCTAGGCC

Oligonucleotides in specific primers for the construction of recombinant plasmids.

Underlined sequences represent restriction enzyme sites. Bolded regions indicate Kozak coding sequences.

The identities of the plasmid constructs were verified by sequencing and subsequently used to generate recombinant baculovirus rBV-RSV-Pre-F, rBV-RSV-Post-F, or rBV-IAV-M1, as previously described (17, 43). In brief, the plasmids pFBDM-Pre-F, pFBDM-Post-F, and pFBDM-M1 were transformed into competent E. coli DH10 MultiBac cells to generate recombinant bacmids. The resultant bacmid DNA was separately transfected into Sf9 insect cells to obtain the corresponding recombinant baculovirus designated rBV-RSV-Pre-F, rBV-RSV-Post-F, or rBV-IAV-M1.

Production and purification of chimeric VLPs

The RSV Pre-F VLPs and Post-F VLPs were produced by Sf9 cells coinfected with rBV-RSV-Pre-F and rBV-IAV-M1 or rBV-RSV-Post-F and rBV-IAV-M1 (MOI=1 for each rBV). rBV-infected Sf9 cells were cultured in SF-900 II SFM at 27°C for 3 days. Then, the cultured Sf9 cells were collected by centrifugation and lysed and frozen once at -80°C, and the cell lysates were clarified at 5000 rpm for 30 min. The VLP-containing supernatant was centrifuged at 60000×g and 4°C for 4 h, and the pellets were collected and resuspended in phosphate buffer (0.15 M NaCl, 0.05 M phosphate, pH 7.2). The protein samples were purified using HiPrep Sephacryl S-500 HR (GE Healthcare, Freiburg, Germany) in phosphate buffer at a flow rate of 0.5 ml/min as recommended by the manufacturer. Purified VLPs were quantified using the Bradford protein assay kit (Sangon Co., Ltd.) according to the manufacturer’s instructions.

SDS−PAGE, Western blot analysis and electron microscopy observation

The expressed proteins were characterized by SDS−PAGE, western blotting and electron microscope observation as previously described (44). In brief, the prepared samples were separated on 12% polyacrylamide gels and stained with Coomassie blue R250 or transferred onto PVDF membranes for western blot analysis using a mouse anti-F mAb clone 131-2A (Millipore) or a mouse anti-M1 mAb clone 36H4 (Immune Tech, New York, USA). The purified RSV Pre-F or Post-F VLPs adsorbed onto copper grids were negatively stained with 2% phosphotungstic acid and observed with a transmission electron microscope (JEM-2100, JEOL, Tokyo, Japan).

Immunization and challenge of mice

Specific-pathogen-free (SPF) female BALB/c mice (Wuhan University Center for Animal Experiments) aged 6-8 weeks old were intramuscularly (i.m.) immunized thrice at 2-week intervals with 10 μg VLPs in 100 μl (45, 46). For the UV-RSV control, mice were immunized i.m. with 1×105 PFU of purified UV-RSV in 100 μl (18). For the PBS control, mice were inoculated i.m. with 100 μl PBS. Blood was collected by tail vein puncture during preimmunization and at 2 weeks after the final immunization for antibody detection, and splenocytes were isolated for cytokine detection.

For histological analysis, mice were intranasally (i.n.) challenged with 3×106 PFU of RSV A2 in 100 μl at 2 weeks after the final immunization. The whole lungs of three mice were harvested on Day 4 following RSV challenge, immersed in 4% paraformaldehyde, embedded in paraffin and sectioned. The tissue sections were stained with haematoxylin and eosin (H&E) for routine evaluation and with periodic acid-Schiff (PAS) staining of amylase-treated tissue for observation of mucus secretion. The lung inflammation scores were defined as previously described (16, 44), where 0 indicates no inflammation, 1 indicates minimal inflammation, 2 indicates mild inflammation, 3 indicates moderate inflammation, and 4 indicates marked inflammation. Mucus hypersecretion scores in airways were defined as follows: 1-no mucus detectable, 2-rare mucus, 3-moderate mucus accumulation, 4-severe mucus production (47).

ELISA

Virus-specific IgG, IgG2a, and IgG1 antibodies in mouse sera were determined by enzyme-linked immunosorbent assay (ELISA) using RSV as the coating antigen (18, 48). Briefly, each well of a 96-well plate was coated with 100 μl of purified inactivated RSV (1×105 PFU/well). Serial dilutions of mouse sera in PBS/Tween-20 (PBS-T) containing 1% BSA were added to the wells and incubated at 37°C for 1 h. An HRP-conjugated goat anti-mouse IgG, IgG2a, or IgG1 mAb (Abclonal) was used as the secondary antibody.

Cytokine concentrations in the splenocytes or lung homogenates were quantified by ELISA as previously described (17). Regarding splenocyte cytokines, splenocyte suspensions were prepared from the spleens of experimental mice using Mouse 1×Lymphocyte Separation Medium (Dakewe Biotech, Beijing, China) according to the manufacturer’s protocol. Splenocytes (1×106) were cultured in a 24-well culture plate (Corning, NY, USA) in the presence or absence of 105 PFU of purified UV-RSV. The culture plate was maintained in a 5% CO2 incubator at 37°C for 72 h, and the supernatants were then collected and stored at -80°C for subsequent assays. For lung cytokine detection, lung tissues were collected on Day 4 postchallenge (p.c.) and homogenized. After centrifugation, the supernatants were collected and stored at -80°C for the subsequent assay. Th1 (IFN-γ, IL-2), Th2 (IL-4, IL-5), IL-10 and IL-17A cytokines present in the supernatants were quantitatively measured using commercially available ELISA kits (Bio Legend, Camarillo, CA, USA).

Antibody binding to purified VLPs was performed as previously described (49). Briefly, equivalent amounts of Pre-F or Post-F VLPs were added directly to the microtiter wells (1 μg of total VLP protein in 100 μl) and incubated at 37°C for 16 h. After washing thrice with PBS, different concentrations of selected antibody (anti-F131-2A or anti-F D25) were added to each well and then incubated for 2 h at room temperature (RT). After three washes in PBS, the secondary antibody (goat anti-mouse IgG-HRP or goat anti-human IgG-HRP) diluted with PBS containing 1% BSA was added to each well (100 μl/well) and then incubated at RT for 1.5 h. TMB (3,3’,5,5’-tetramethylbenzidine; Sigma) substrate in a 100 μl volume was added to each well. After 15 to 20 min of incubation at RT, the reaction was stopped by adding 100 μl of 2 M H2SO4 to each well, and the optical density at 450 nm was measured using an ELISA reader (Multidkan MK3; Thermo Fisher Scientific).

RSV immunoplaque and neutralization antibody assays

RSV neutralizing antibody titres were determined by a plaque reduction assay as previously described (18, 39). Briefly, mouse sera were inactivated at 56°C for 30 min and then serially diluted 2-fold in DMEM. Purified RSV was diluted to approximately 100 PFU in 100 μl and added to the diluted sera in 100-μl aliquots. The virus-serum mixture or a virus-DMEM control was incubated at 37°C for 1 h. Then, the mixture was added to prewashed Vero cells in 24-well plates. After 2 h of incubation, the mixture was removed, and 1 ml of methylcellulose overlay (1 volume of 2 ×DMEM containing 4% FBS, 2% penicillin streptomycin, and 1 volume of 2% methylcellulose) was added to each well. The plates were incubated at 37°C for 3 to 5 days, and the plaques were stained as previously described (39). The neutralization titre was defined as the log2 of the reciprocal of the highest dilution of serum that reduced the virus titre by 50%.

Quantitative real-time (qRT)-PCR

RSV load in the lung was quantified by qRT−PCR (18). Total RNA of lung tissues was extracted using RNA Pure reagent (Aidlab, Beijing, China) and reverse transcribed into cDNA using a reverse transcription kit (Toyoba, Osaka, Japan) according to the manufacturer’s instructions. RSV N gene copies were quantified using 2×SYBR green master mix (Novoprotein, Shanghai, China) in a 7500 Real-Time PCR System (Applied Biosystems, USA). The qRT−PCR primer sequences are listed in Table 1.

Flow cytometry

Cytokine staining was performed as previously described (13, 18, 50). Lung cells were surface-stained with mAbs specific to CD4-FITC (Clone RM4-5) and CD25-APC (Clone PC61) (BioLegend, San Diego, CA). After fixation and permeabilization, the cells were intracellularly stained with PE-labelled anti-mouse Foxp3 (Clone MF-14) or IL17A mAb (Clone TC11-18H10.1) (BioLegend). Then, the stained cells were analyzed by flow cytometry (Beckman Coulter CytoFlex, USA). Data were analysed using CytoFlex software and are presented as the percentage of CD25+ Foxp3+ cells or IL17A-producing cells among CD4+ T cells. All gating strategies are specified in the Supplementary Figure S1.

Statistical analysis

Comparisons of various groups were accomplished by Student’s t tests or analysis of variance (ANOVA) followed by the Tukey test or nonparametric Kruskal−Wallis test. A P value of less than 0.05 was considered statistically significant.

Results

Preparation and characterization of chimeric VLPs

Recombinant baculovirus was constructed as described in the Materials and Methods section (Figure 1A). Pre-F or Post-F VLPs were produced by Sf9 cells infected simultaneously with rBV-RSV-Pre-F and rBV-IAV-M1 or rBV-RSV-Post-F and rBV-IAV-M1, respectively. After 72 h of culture, the resultant supernatants of infected Sf9 cells were harvested for analysis of F and M1 expression by western blotting. The data showed that the engineered Pre-F, Post-F or IAV M1 protein could be expressed efficiently from infected Sf9 cells and that the expected molecular weights of RSV F (~63 kDa) and IAV M1 (~28 kDa) proteins were successfully detected (Figure 1B). SDS−PAGE analysis showed that the prepared VLPs contained highly pure F and M1 proteins (Figure 2A). Spherical self-assembling VLPs ~50-100 nm in diameter were observed under an electron microscope (Figure 2B). These data demonstrated that VLPs were successfully generated from rBV-infected Sf9 cells.

Figure 2

Previous studies and clinical observations in human sera demonstrated that RSV neutralizing antibodies are specific to the prefusion structure (22, 24, 26). To characterize the RSV Pre-F or Post-F form in the VLPs, the characteristic antigenic sites Ø and I based on the Pre-F and Post-F conformations were detected using the specific mAbs D25 and 131-2A, respectively. The data showed that mAb D25 bound effectively to VLPs containing Pre-F conformation with antigenic site Ø (Figure 2C, left). In contrast, mAb 131-2A bound strongly to VLPs containing the Post-F conformation with antigenic site I (Figure 2C, right). The results identified that the VLPs generated from rBV-Sf9 cells contained specifically antigenic sites Ø and I of the Pre-F and Post-F conformations, respectively.

Antibody and cytokine responses in mice induced by Pre-F and Post-F VLPs

RSV-specific IgG, IgG2a, and IgG1 concentrations in the sera of immunized mice were detected by ELISA. Compared with the Post-F VLPs, the Pre-F VLPs induced significantly increased RSV-specific IgG and IgG2a antibody levels (P < 0.05), but a similar IgG1 antibody level was observed (P > 0.05) (Figure 3A). Vaccination with the Pre-F VLPs and Post-F VLPs elicited Th1-dominant responses with median IgG2a/IgG1 ratios of 1.22 and 1.13, respectively; in contrast, immunization with UV-RSV resulted in a Th2-biased response with an IgG2a/IgG1 ratio of 0.94 (Figure 3B). Vaccination with Pre-F VLPs induced a higher ratio of IgG2a antibodies than vaccination with UV-RSV or Post-F VLPs. Sera of vaccinated mice exhibited stronger binding ability with the corresponding VLPs (Supplementary Figure S2). Analysis of RSV neutralizing antibody (NAb) in the sera of vaccinated mice showed that although both Pre-F VLPs and Post-F VLPs induced RSV NAb production, Pre-F VLPs elicited significantly increased RSV NAb levels compared with Post-F VLPs (P < 0.01) (Figure 3C).

Figure 3

To investigate cellular immune responses, we examined Th1-type (IFN-γ and IL-2) and Th2-type (IL-4 and IL-5) cytokines in the splenocyte supernatants of vaccinated mice. In the PBS-treated group, both Th1-type (IFN-γ and IL-2) and Th2-type (IL-4 and IL-5) cytokines displayed very low concentrations. Compared with the VLP-vaccinated groups, significantly increased levels of Th1-type and Th2-type cytokines were induced by UV-RSV. However, in the VLP-vaccinated mice, the levels of the cytokines IFN-γ and IL-2 were only reduced approximately 1.4-fold, and the levels of the cytokines IL-4 and IL-5 were reduced ~2-fold and ~ 4-fold, respectively (Figure 4). Importantly, compared with Post-F VLPs, vaccination with Pre-F VLPs induced significantly increased Th1 type and decreased Th2-type cytokine production (Figure 4). Without RSV stimulation, both Th1-type and Th2-type cytokines were almost undetectable (Figure 4). Our data demonstrated that Pre-F VLPs elicited a mixed Th1/Th2 response with Th1-biased cellular immunity to RSV.

Figure 4

CD4+ T-cell subsets and cytokine profiles in the lungs of vaccinated mice following RSV infection.

Distinct CD4+ T-cell subsets and Th2-type cytokines play crucial roles in RSV vaccine-enhanced immunopathology (13, 14, 47, 51). We further investigated CD4+CD25+Foxp3+ Treg and IL-17A-producing CD4+ T-cell subsets and the representative cytokines in the lungs of vaccinated mice following RSV challenge. The data showed that the percentage of CD4+CD25+Foxp3+ Treg cells in VLP-vaccinated mice was significantly increased compared to that in UV-RSV-immunized mice (P <0.001) (Figure 5A). In contrast, significantly decreased IL-17A+-producing CD4+ T cells were observed in VLP-vaccinated mice compared to UV-RSV-immunized mice (P < 0.01) (Figure 5B). In particular, a significantly increased percentage of CD4+CD25+Foxp3+ Treg cells (P < 0.01) (Figure 5A) and a significantly decreased amount of IL-17A+-producing CD4+ T cells (P < 0.05) (Figure 5B) were observed in mice vaccinated with Pre-F VLPs compared to mice vaccinated with Post-F VLPs. Similar concentrations of the pulmonary cytokines IFN-γ, IL-2, IL-5 and IL-17A were observed in mice vaccinated with Pre-F compared with Post-F VLPs Figure 5C. Importantly, significantly decreased concentrations of the Th2-type cytokines IL-4 (P < 0.05) and IL-5 (P < 0.001) and significantly increased production of the Treg cell-related cytokine IL-10 (P < 0.01) were observed in VLP-vaccinated mice compared to UV-RSV-immunized mice Figure 5C. Interestingly, compared to Post-F VLPs, vaccination of Pre-F VLPs elicited significantly decreased IL-4 (P < 0.01) and increased IL-10 secretion (P < 0.05) (Figure 5C). Our results indicated that Pre-F VLPs elicited balanced Treg/Th17 responses in vaccinated mice upon subsequent RSV infection.

Figure 5

Pulmonary viral load and pathology in mice vaccinated with VLPs following RSV infection

To investigate the immune protection induced by the VLPs, the RSV load in the lungs of vaccinated mice was quantified on Day 4 p.c. by qRT−PCR. As a control, the high RSV N gene copy numbers (~ 106 copies/100 ng total RNA) were detected in the lungs of PBS-treated mice, whereas very low RSV N gene copy numbers (~ 103 copies) (approximate background value of test) were observed in the lungs of mice vaccinated with VLPs (Figure 6A), demonstrating that vaccination with Pre-F VLPs or Post-F VLPs effectively inhibited RSV replication in the lungs of mice.

Figure 6

We further investigated pathological injury in the lungs of vaccinated mice after RSV infection. The data showed that mice immunized with UV-RSV exhibited severe lung pathology, including extensive lymphocyte infiltration around the blood vessels and alveolar hemorrhage. In contrast, mice vaccinated with VLPs displayed signs of mild inflammation in the lungs. Importantly, mice vaccinated with Pre-F VLPs presented similar histological features to naive mice in the lungs (Figure 6B). After RSV infection, the average inflammation severity scores of vaccinated mice were in the following order: UV-RSV > PBS > Post-F VLPs > Pre-F VLPs (Table 2). Data from PAS staining showed that overt inflammation and mucus hypersecretion (black arrows) were observed in the lungs of UV-RSV-immunized mice and mild mucus accumulation was observed in the lungs of Post-F VLP-immunized mice (Figure 6C). However, no mucus secretion was observed in the lungs of mice vaccinated with Pre-F VLPs, which was similar to the characteristics of naive mice. These results revealed that vaccination with Pre-F VLPs induced effective protection against RSV infection without enhanced pulmonary immunopathology in mice.

Table 2

Histopathological scorea
InoculumAlveolartissuebPeribronchial aggregationcPerivascular aggregationdMucuse
Naive0001
PBS2 ± 0.162.2 ± 0.162.27 ± 0.191.33 ± 0.09
UV-RSV3.67 ± 0.093.67 ± 0.093.53 ± 0.092.6 ± 0.16
Pre-F VLPs0.67 ± 0.090.73 ± 0.090.8 ± 0.161.13 ± 0.09
Post-F VLPs1.33 ± 0.091.53 ± 0.251.53 ± 0.091.4 ± 0.16

Histopathological scores of lungs from immunized mice on Day 4 following RSV challenge.

a

The lung inflammation severity scores were defined on a scale from 0 to 4 according to the H&E-stained sections as follows: 0-inflammation was not present, 1- minimal inflammation, 2-mild inflammation, 3-moderate inflammation, and 4-marked inflammation. Scores of mucus production scale according to the PAS-stained sections as follows: 1-no mucus detectable, 2-rare mucus, 3-moderate mucus accumulation, and 4-severe mucus accumulation. Data represent the mean values ± SDs (n = 3).

b

Alveolar tissue: Pre-F VLPs vs. Post-F VLPs (p < 0.01).

c

Peribronchial aggregation: Pre-F VLPs vs. Post-F VLPs (p < 0.05).

d

Perivascular aggregation: Pre-F VLPs vs. Post-F VLPs (p < 0.05).

e

Mucus: Pre-F VLPs vs. Post-F VLPs (p > 0.05).

Discussion

A licensed vaccine for RSV is not currently available despite the fact that RSV is the major cause of lower respiratory tract infections in children. Vaccine-enhanced immunopathology has significantly hampered the development of an RSV vaccine. Previous studies have shown that poorly neutralizing antibodies, a Th2-biased immune response and distinct CD4+ T-cell subsets correlate with VED upon RSV infection (12, 13, 47, 52) and that high neutralizing antibody levels correlate with the prevention of disease severity and a lower risk of infection (6, 53, 54). Therefore, induction of a high-affinity neutralizing antibody and a balanced immune response should be preferentially considered for the design of a safe and effective RSV vaccine (18, 55).

Experimental studies and clinical observations in human sera demonstrated that RSV neutralizing antibodies are specific to the prefusion structure (22, 24, 26). Structure-based design of vaccines showed that a highly stable prefusion F conformation would be a promising subunit vaccine candidate against RSV (27, 29). Following immunization of mice, VLPs containing the stabilized Pre-F configuration from Newcastle disease virus (NDV) induced significantly higher neutralizing antibody titres than the Post-F VLPs or wild-type F VLPs after a single immunization (49). As a well-known tool for the production of subunit vaccines, the rBV-Sf9 insect cell expression system has been widely employed (5658). VLPs containing the RSV F protein generated by rBV-Sf9 cells confer effective protection against RSV infection (37, 38). In the present study, we successfully produced influenza M1-based VLPs containing RSV Pre-F or Post-F configuration using the rBV-Sf9 cell expression system. We further characterized the assembly and immunological properties of these VLPs. Our results confirmed that the Pre-F and Post-F VLPs generated from rBV-Sf9 cells displayed specific antigenic sites Ø and I, respectively. The antigenic site Ø was the crucial target site recognized by RSV-neutralizing antibodies, and the postfusion form of the F protein led to the lack of specific epitopes Ø (22, 26, 27). Antigenic site I was more pronounced on Post-F, and site I-directed antibodies are typically nonneutralizing (59). Our results demonstrated that Pre-F VLPs elicited significantly increased RSV-specific neutralizing antibody titres compared to PostF VLPs or UV-RSV. The high level of Pre-F specific antibodies in human sera play an important role in alleviating antibody-dependent disease enhancement (6062).

In our study, immunization with both Pre-F and Post-F VLPs predominantly induced IgG2a isotype antibodies and Th1-associated cytokines (IFN-γ and IL-2) and significantly decreased Th2-biased cytokine responses (IL-4 and IL-5) compared with UV-RSV. For cytokine secretion in the lungs of mice vaccinated with VLPs, significantly decreased IL-4, IL-5, and IL-17A and increased IL-10 cytokines were observed compared to UV-RSV. Importantly, compared with Post-F VLPs, Pre-F VLPs elicited a significantly increased IgG2a/IgG1 ratio and high RSV neutralizing antibody levels and significantly decreased IL-5 secretion. However, both Pre-F VLPs and Post-F VLPs induced similar IFN-γ and IL-4 cytokine levels (Figure 4). We further tested the Treg and Th17 subsets in the lungs of vaccinated mice. Compared to UV-RSV, vaccination with RSV F VLPs upregulated the percentage of Treg (CD4+CD25+FoxP3+) cells and downregulated the percentage of Th17 (CD4+IL-17A+) cells. Significantly increased Treg cells and decreased Th17 cells were observed in the lungs of mice vaccinated with Pre-F VLPs compared with Post-F VLPs. During RSV infection, Treg cells functionally regulate the immunological environment to avoid excessive inflammatory T-cell responses and aid in limiting inefficient Th2-type immune responses (55). Therefore, Treg cells play a pivotal role in alleviating vaccine-enhanced immunopathology in RSV infection (55, 63). In contrast, Th17 cells are functionally considered to exacerbate inflammatory diseases, including chronic pulmonary obstruction, cystic fibrosis, and asthma (64), and are involved in increasing mucus secretion and reducing viral clearance (65). A current study showed that vaccination with commercial PreF protein formulated with a Th1/Th2-balanced adjuvant induced suppression of RSV replication and inhibited airway eosinophilia and mucus accumulation in mice (66). Additionally, poor avidity and affinity maturation caused nonprotective antibody development and Th2-associated immunopathology (52). As expected, our results demonstrated that a high neutralizing antibody level and a Th1/Th2-balanced immune response were induced by Pre-F VLPs, resulting in alleviation of pulmonary pathology and airway mucus secretion in vaccinated mice.

VLPs containing RSV F and/or G proteins have been intensively investigated using different vaccine platforms (18, 37, 39, 40, 44, 67). For NDV-RSV VLPs, the potential contamination of mammalian DNA and other deleterious factors from sera and/or cells require removal from VLPs (49, 68). The rBV-produced VLPs from serum-free insect cell cultures are beneficial to VLP vaccine technology. RSV VLP production utilizing the rBV-insect cell expression system is FDA approved for human use, and the high levels of VLPs generated from suspension cultures of insect cells will facilitate large-scale vaccine production (57, 58, 69). Therefore, the work presented in this study provides a novel, promising strategy for the development of RSV vaccine candidates.

Statements

Data availability statement

The original contributions presented in the study are included in the article/supplementary materials, further inquiries can be directed to the corresponding author/s.

Ethics statement

The animal study was reviewed and approved by the Institutional Animal Care and Use Committee of Wuhan University.

Author contributions

ZP, JL, and LL designed and conceived the study. JL, HQ, WL, and RL conducted the experiments. ZP, JL, and LL analyzed the data and wrote the manuscript. All authors contributed to the article and approved the submitted version.

Funding

The study was supported by the National Key R&D Program of China (2017YFA0505801) and the Natural Science Foundation of Hubei Province Innovation Group (2017CFA022).

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Publisher’s note

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article, or claim that may be made by its manufacturer, is not guaranteed or endorsed by the publisher.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fimmu.2022.1054005/full#supplementary-material

References

  • 1

    BlountREJr.MorrisJASavageRE. Recovery of cytopathogenic agent from chimpanzees with coryza. Proc Soc Exp Biol Med (1956) 92(3):544–9. doi: 10.3181/00379727-92-22538

  • 2

    ChanockRFinbergL. Recovery from infants with respiratory illness of a virus related to chimpanzee coryza agent (Cca). ii. epidemiologic aspects of infection in infants and young children. Am J Hyg (1957) 66(3):291300. doi: 10.1093/oxfordjournals.aje.a119902

  • 3

    Boyoglu-BarnumSChirkovaTAndersonLJ. Biology of infection and disease pathogenesis to guide rsv vaccine development. Front Immunol (2019) 10:1675. doi: 10.3389/fimmu.2019.01675

  • 4

    LiYWangXBlauDMCaballeroMTFeikinDRGillCJet al. Global, regional, and national disease burden estimates of acute lower respiratory infections due to respiratory syncytial virus in children younger than 5 years in 2019: A systematic analysis. Lancet (2022) 399(10340):2047–64. doi: 10.1016/S0140-6736(22)00478-0

  • 5

    ChatterjeeAMavundaKKrilovLR. Current state of respiratory syncytial virus disease and management. Infect Dis Ther (2021) 10(Suppl 1):516. doi: 10.1007/s40121-020-00387-2

  • 6

    GlezenWPTaberLHFrankALKaselJA. Risk of primary infection and reinfection with respiratory syncytial virus. Am J Dis Child (1986) 140(6):543–6. doi: 10.1001/archpedi.1986.02140200053026

  • 7

    HendersonFWCollierAMClydeWAJr.DennyFW. Respiratory-Syncytial-Virus infections, reinfections and immunity. a prospective, longitudinal study in young children. N Engl J Med (1979) 300(10):530–4. doi: 10.1056/NEJM197903083001004

  • 8

    FulginitiVAEllerJJSieberOFJoynerJWMinamitaniMMeiklejohnG. Respiratory virus immunization. i. a field trial of two inactivated respiratory virus vaccines; an aqueous trivalent parainfluenza virus vaccine and an alum-precipitated respiratory syncytial virus vaccine. Am J Epidemiol (1969) 89(4):435–48. doi: 10.1093/oxfordjournals.aje.a120956

  • 9

    KapikianAZMitchellRHChanockRMShvedoffRAStewartCE. An epidemiologic study of altered clinical reactivity to respiratory syncytial (Rs) virus infection in children previously vaccinated with an inactivated rs virus vaccine. Am J Epidemiol (1969) 89(4):405–21. doi: 10.1093/oxfordjournals.aje.a120954

  • 10

    KimHWCancholaJGBrandtCDPylesGChanockRMJensenKet al. Respiratory syncytial virus disease in infants despite prior administration of antigenic inactivated vaccine. Am J Epidemiol (1969) 89(4):422–34. doi: 10.1093/oxfordjournals.aje.a120955

  • 11

    RuckwardtTJMorabitoKMGrahamBS. Immunological lessons from respiratory syncytial virus vaccine development. Immunity (2019) 51(3):429–42. doi: 10.1016/j.immuni.2019.08.007

  • 12

    WarisMETsouCErdmanDDZakiSRAndersonLJ. Respiratory synctial virus infection in Balb/C mice previously immunized with formalin-inactivated virus induces enhanced pulmonary inflammatory response with a predominant Th2-like cytokine pattern. J Virol (1996) 70(5):2852–60. doi: 10.1128/jvi.70.5.2852-2860.1996

  • 13

    ZhaoYMaCYangJZouXPanZ. Dynamic host immune and transcriptomic responses to respiratory syncytial virus infection in a vaccination-challenge mouse model. Virol Sin (2021) 36(6):1327–40. doi: 10.1007/s12250-021-00418-3

  • 14

    ConnorsMGieseNAKulkarniABFirestoneCYMorseHC3rdMurphyBR. Enhanced pulmonary histopathology induced by respiratory syncytial virus (Rsv) challenge of formalin-inactivated rsv-immunized Balb/C mice is abrogated by depletion of interleukin-4 (Il-4) and il-10. J Virol (1994) 68(8):5321–5. doi: 10.1128/JVI.68.8.5321-5325.1994

  • 15

    GrahamBS. Biological challenges and technological opportunities for respiratory syncytial virus vaccine development. Immunol Rev (2011) 239(1):149–66. doi: 10.1111/j.1600-065X.2010.00972.x

  • 16

    MokHLeeSUtleyTJShepherdBEPolosukhinVVCollierMLet al. Venezuelan Equine encephalitis virus replicon particles encoding respiratory syncytial virus surface glycoproteins induce protective mucosal responses in mice and cotton rats. J Virol (2007) 81(24):13710–22. doi: 10.1128/JVI.01351-07

  • 17

    ZhangYQiaoLHuXZhaoKZhangYChaiFet al. Baculovirus vectors expressing f proteins in combination with virus-induced signaling adaptor (Visa) molecules confer protection against respiratory syncytial virus infection. Vaccine (2016) 34(2):252–60. doi: 10.1016/j.vaccine.2015.11.027

  • 18

    YangJMaCZhaoYFanAZouXPanZ. Hepatitis b virus core particles containing a conserved region of the G protein combined with interleukin-35 protected mice against respiratory syncytial virus infection without vaccine-enhanced immunopathology. J Virol (2020) 94(13):e00007–20. doi: 10.1128/JVI.00007-20

  • 19

    ZhanXHurwitzJLKrishnamurthySTakimotoTBoydKScroggsRAet al. Respiratory syncytial virus (Rsv) fusion protein expressed by recombinant Sendai virus elicits b-cell and T-cell responses in cotton rats and confers protection against rsv subtypes a and b. Vaccine (2007) 25(52):8782–93. doi: 10.1016/j.vaccine.2007.10.038

  • 20

    KohlmannRSchwanneckeSTipplerBTernetteNTemchuraVVTenbuschMet al. Protective efficacy and immunogenicity of an adenoviral vector vaccine encoding the codon-optimized f protein of respiratory syncytial virus. J Virol (2009) 83(23):12601–10. doi: 10.1128/JVI.01036-09

  • 21

    OlmstedRAElangoNPrinceGAMurphyBRJohnsonPRMossBet al. Expression of the f glycoprotein of respiratory syncytial virus by a recombinant vaccinia virus: Comparison of the individual contributions of the f and G glycoproteins to host immunity. Proc Natl Acad Sci USA (1986) 83(19):7462–6. doi: 10.1073/pnas.83.19.7462

  • 22

    McLellanJSChenMLeungSGraepel KevinWDuXYangYet al. Structure of rsv fusion glycoprotein trimer bound to a prefusion-specific neutralizing antibody. Science (2013) 340(6136):1113–7. doi: 10.1126/science.1234914

  • 23

    Swanson KurtASettembre EthanCShaw ChristineADey AntuKRappuoliRMandl ChristianWet al. Structural basis for immunization with postfusion respiratory syncytial virus fusion f glycoprotein (Rsv f) to elicit high neutralizing antibody titers. Proc Natl Acad Sci (2011) 108(23):9619–24. doi: 10.1073/pnas.1106536108

  • 24

    CortiDBianchiSVanzettaFMinolaAPerezLAgaticGet al. Cross-neutralization of four paramyxoviruses by a human monoclonal antibody. Nature (2013) 501(7467):439–43. doi: 10.1038/nature12442

  • 25

    WenXMousaJJBatesJTLambRACroweJEJr.JardetzkyTS. Structural basis for antibody cross-neutralization of respiratory syncytial virus and human metapneumovirus. Nat Microbiol (2017) 2:16272. doi: 10.1038/nmicrobiol.2016.272

  • 26

    MagroMMasVChappellKVázquezMCanoOLuqueDet al. Neutralizing antibodies against the preactive form of respiratory syncytial virus fusion protein offer unique possibilities for clinical intervention. Proc Natl Acad Sci (2012) 109(8):3089–94. doi: 10.1073/pnas.1115941109

  • 27

    McLellanJSChenMJoyceMGSastryMStewart-JonesGBEYangYet al. Structure-based design of a fusion glycoprotein vaccine for respiratory syncytial virus. Science (2013) 342(6158):592–8. doi: 10.1126/science.1243283

  • 28

    JoyceMGZhangBOuLChenMChuangG-YDruzAet al. Iterative structure-based improvement of a fusion-glycoprotein vaccine against rsv. Nat Struct Mol Biol (2016) 23(9):811–20. doi: 10.1038/nsmb.3267

  • 29

    KrarupATruanDFurmanova-HollensteinPBogaertLBouchierPBisschopIJMet al. A highly stable prefusion rsv f vaccine derived from structural analysis of the fusion mechanism. Nat Commun (2015) 6:8143. doi: 10.1038/ncomms9143

  • 30

    Crank MichelleCRuckwardt TracyJChenMMorabito KaitlynMPhungECostner PamelaJet al. A proof of concept for structure-based vaccine design targeting rsv in humans. Science (2019) 365(6452):505–9. doi: 10.1126/science.aav9033

  • 31

    MarcandalliJFialaBOlsSPerottiMde van der SchuerenWSnijderJet al. Induction of potent neutralizing antibody responses by a designed protein nanoparticle vaccine for respiratory syncytial virus. Cell (2019) 176(6):142031.e17. doi: 10.1016/j.cell.2019.01.046

  • 32

    SteffAMMonroeJFriedrichKChandramouliSNguyenTLTianSet al. Pre-fusion rsv f strongly boosts pre-fusion specific neutralizing responses in cattle pre-exposed to bovine rsv. Nat Commun (2017) 8(1):1085. doi: 10.1038/s41467-017-01092-4

  • 33

    JenningsGTBachmannMF. The coming of age of virus-like particle vaccines. Biol Chem (2008) 389(5):521–36. doi: 10.1515/bc.2008.064

  • 34

    MenaJAKamenAA. Insect cell technology is a versatile and robust vaccine manufacturing platform. Expert Rev Vaccines (2011) 10(7):1063–81. doi: 10.1586/erv.11.24

  • 35

    MohsenMOBachmannMF. Virus-like particle vaccinology, from bench to bedside. Cell Mol Immunol (2022) 19(9):9931011. doi: 10.1038/s41423-022-00897-8

  • 36

    RoldaoAMelladoMCCastilhoLRCarrondoMJAlvesPM. Virus-like particles in vaccine development. Expert Rev Vaccines (2010) 9(10):1149–76. doi: 10.1586/erv.10.115

  • 37

    QuanFSKimYLeeSYiHKangSMBozjaJet al. Viruslike particle vaccine induces protection against respiratory syncytial virus infection in mice. J Infect Dis (2011) 204(7):987–95. doi: 10.1093/infdis/jir474

  • 38

    KimKHLeeYTHwangHSKwonYMKimMCKoEJet al. Virus-like particle vaccine containing the f protein of respiratory syncytial virus confers protection without pulmonary disease by modulating specific subsets of dendritic cells and effector T cells. J Virol (2015) 89(22):11692–705. doi: 10.1128/jvi.02018-15

  • 39

    MurawskiMRMcGinnesLWFinbergRWKurt-JonesEAMassareMJSmithGet al. Newcastle Disease virus-like particles containing respiratory syncytial virus G protein induced protection in Balb/C mice, with no evidence of immunopathology. J Virol (2010) 84(2):1110–23. doi: 10.1128/JVI.01709-09

  • 40

    McGinnesLWGravelKAFinbergRWKurt-JonesEAMassareMJSmithGet al. Assembly and immunological properties of Newcastle disease virus-like particles containing the respiratory syncytial virus f and G proteins. J Virol (2011) 85(1):366–77. doi: 10.1128/jvi.01861-10

  • 41

    BlancoJCGPletnevaLMMcGinnes-CullenLOtoaROPatelMCFernandoLRet al. Efficacy of a respiratory syncytial virus vaccine candidate in a maternal immunization model. Nat Commun (2018) 9(1):1904. doi: 10.1038/s41467-018-04216-6

  • 42

    CullenLMSchmidtMRMorrisonTG. The importance of rsv f protein conformation in vlps in stimulation of neutralizing antibody titers in mice previously infected with rsv. Hum Vaccin Immunother (2017) 13(12):2814–23. doi: 10.1080/21645515.2017.1329069

  • 43

    YoshidaSKondohDAraiEMatsuokaHSekiCTanakaTet al. Baculovirus virions displaying plasmodium berghei circumsporozoite protein protect mice against malaria sporozoite infection. Virology (2003) 316(1):161–70. doi: 10.1016/j.virol.2003.08.003

  • 44

    QiaoLZhangYChaiFTanYHuoCPanZ. Chimeric virus-like particles containing a conserved region of the G protein in combination with a single peptide of the M2 protein confer protection against respiratory syncytial virus infection. Antiviral Res (2016) 131:131–40. doi: 10.1016/j.antiviral.2016.05.001

  • 45

    CullenLMSchmidtMRTorresGMCapoferriAAMorrisonTG. Comparison of immune responses to different versions of vlp associated stabilized rsv pre-fusion f protein. Vaccines (Basel) (2019) 7(1):21. doi: 10.3390/vaccines7010021

  • 46

    ZhangLDurrEGalliJDCosmiSCejasPJLuoBet al. Design and characterization of a fusion glycoprotein vaccine for respiratory syncytial virus with improved stability. Vaccine (2018) 36(52):8119–30. doi: 10.1016/j.vaccine.2018.10.032

  • 47

    KnudsonCJHartwigSMMeyerholzDKVargaSM. Rsv vaccine-enhanced disease is orchestrated by the combined actions of distinct Cd4 T cell subsets. PloS Pathog (2015) 11(3):e1004757. doi: 10.1371/journal.ppat.1004757

  • 48

    ChungYCHoMSWuJCChenWJHuangJHChouSTet al. Immunization with virus-like particles of enterovirus 71 elicits potent immune responses and protects mice against lethal challenge. Vaccine (2008) 26(15):1855–62. doi: 10.1016/j.vaccine.2008.01.058

  • 49

    McGinnesCLSchmidtMRKenwardSAWoodlandRTMorrisonTG. Murine immune responses to virus-like particle-associated pre- and postfusion forms of the respiratory syncytial virus f protein. J Virol (2015) 89(13):6835–47. doi: 10.1128/JVI.00384-15

  • 50

    WangJKongLLuoQLiBWuJLiuBet al. Dual effects of respiratory syncytial virus infections on airway inflammation by regulation of Th17/Treg responses in ovalbumin-challenged mice. Inflammation (2014) 37(6):19842005. doi: 10.1007/s10753-014-9931-0

  • 51

    ConnorsMKulkarniABFirestoneCYHolmesKLMorseHC3rdSotnikovAVet al. Pulmonary histopathology induced by respiratory syncytial virus (Rsv) challenge of formalin-inactivated rsv-immunized Balb/C mice is abrogated by depletion of Cd4+ T cells. J Virol (1992) 66(12):7444–51. doi: 10.1128/JVI.66.12.7444-7451.1992

  • 52

    DelgadoMFCovielloSMonsalvoACMelendiGAHernandezJZBatalleJPet al. Lack of antibody affinity maturation due to poor toll-like receptor stimulation leads to enhanced respiratory syncytial virus disease. Nat Med (2009) 15(1):3441. doi: 10.1038/nm.1894

  • 53

    GlezenWPParedesAAllisonJETaberLHFrankAL. Risk of respiratory syncytial virus infection for infants from low-income families in relationship to age, sex, ethnic group, and maternal antibody level. J Pediatr (1981) 98(5):708–15. doi: 10.1016/s0022-3476(81)80829-3

  • 54

    PiedraPAJewellAMCronSGAtmarRLPaul GlezenW. Correlates of immunity to respiratory syncytial virus (Rsv) associated-hospitalization: Establishment of minimum protective threshold levels of serum neutralizing antibodies. Vaccine (2003) 21(24):3479–82. doi: 10.1016/S0264-410X(03)00355-4

  • 55

    DurantLRMakrisSVoorburgCMLoebbermannJJohanssonCOpenshawPJ. Regulatory T cells prevent Th2 immune responses and pulmonary eosinophilia during respiratory syncytial virus infection in mice. J Virol (2013) 87(20):10946–54. doi: 10.1128/JVI.01295-13

  • 56

    SariDGuptaKThimiri Govinda RajDBAubertADrncováPGarzoniFet al. The multibac Baculovirus/Insect cell expression vector system for producing complex protein biologics. Adv Exp Med Biol (2016) 896:199215. doi: 10.1007/978-3-319-27216-0_13

  • 57

    TrombettaCMMarchiSMontomoliE. The baculovirus expression vector system: A modern technology for the future of influenza vaccine manufacturing. Expert Rev Vaccines (2022) 21(9):1233–42. doi: 10.1080/14760584.2022.2085565

  • 58

    CoxMMJ. Innovations in the insect cell expression system for industrial recombinant vaccine antigen production. Vaccines (Basel) (2021) 9(12):1504. doi: 10.3390/vaccines9121504

  • 59

    GoodwinEGilmanMSAWrappDChenMNgwutaJOMoinSMet al. Infants infected with respiratory syncytial virus generate potent neutralizing antibodies that lack somatic hypermutation. Immunity (2018) 48(2):33949.e5. doi: 10.1016/j.immuni.2018.01.005

  • 60

    GorlaniAForthalDN. Antibody-dependent enhancement and the risk of hiv infection. Curr HIV Res (2013) 11(5):421–6. doi: 10.2174/1570162x113116660062

  • 61

    CapellaCChaiwatpongsakornSGorrellERischZAYeFMertzSEet al. Prefusion f, postfusion f, G antibodies, and disease severity in infants and young children with acute respiratory syncytial virus infection. J Infect Dis (2017) 216(11):1398–406. doi: 10.1093/infdis/jix489

  • 62

    NgwutaJOChenMModjarradKJoyceMGKanekiyoMKumarAet al. Prefusion f-specific antibodies determine the magnitude of rsv neutralizing activity in human sera. Sci Transl Med (2015) 7(309):309ra162. doi: 10.1126/scitranslmed.aac4241

  • 63

    Ruckwardt TracyJBonaparte KathrynLNason MarthaCGraham BarneyS. Regulatory T cells promote early influx of Cd8+ T cells in the lungs of respiratory syncytial virus-infected mice and diminish immunodominance disparities. J Virol (2009) 83(7):3019–28. doi: 10.1128/JVI.00036-09

  • 64

    IwanagaNKollsJK. Updates on T helper type 17 immunity in respiratory disease. Immunology (2019) 156(1):38. doi: 10.1111/imm.13006

  • 65

    MukherjeeSLindellDMBerlinAAMorrisSBShanleyTPHershensonMBet al. Il-17–induced pulmonary pathogenesis during respiratory viral infection and exacerbation of allergic disease. Am J Pathol (2011) 179(1):248–58. doi: 10.1016/j.ajpath.2011.03.003

  • 66

    EichingerKMKosanovichJLGidwaniSVZombackALippMAPerkinsTNet al. Prefusion rsv f immunization elicits Th2-mediated lung pathology in mice when formulated with a Th2 (but not a Th1/Th2-balanced) adjuvant despite complete viral protection. Front Immunol (2020) 11:1673. doi: 10.3389/fimmu.2020.01673

  • 67

    LeiLQinHLuoJTanYYangJPanZ. Construction and immunological evaluation of hepatitis b virus core virus-like particles containing multiple antigenic peptides of respiratory syncytial virus. Virus Res (2021) 298:198410. doi: 10.1016/j.virusres.2021.198410

  • 68

    SchmidtMRMcGinnesLWKenwardSAWillemsKNWoodlandRTMorrisonTG. Long-term and memory immune responses in mice against Newcastle disease virus-like particles containing respiratory syncytial virus glycoprotein ectodomains. J Virol (2012) 86(21):11654–62. doi: 10.1128/JVI.01510-12

  • 69

    VicenteTRoldãoAPeixotoCCarrondoMJAlvesPM. Large-Scale production and purification of vlp-based vaccines. J Invertebr Pathol (2011) 107 Suppl:S42–8. doi: 10.1016/j.jip.2011.05.004

Summary

Keywords

respiratory syncytial virus, virus-like particles, vaccine, prefusion F protein, postfusion F protein, baculovirus insect cell expression system

Citation

Luo J, Qin H, Lei L, Lou W, Li R and Pan Z (2022) Virus-like particles containing a prefusion-stabilized F protein induce a balanced immune response and confer protection against respiratory syncytial virus infection in mice. Front. Immunol. 13:1054005. doi: 10.3389/fimmu.2022.1054005

Received

26 September 2022

Accepted

21 November 2022

Published

12 December 2022

Volume

13 - 2022

Edited by

Anke Huckriede, University Medical Center Groningen, Netherlands

Reviewed by

Harshad Patil, Bharati Vidyapeeth Deemed University, India; Puck B. Van Kasteren, National Institute for Public Health and the Environment, Netherlands

Updates

Copyright

*Correspondence: Zishu Pan,

†Present address: Lei Lei, Department of Microbiology and Immunology, The University of Iowa, Iowa City, IA, United States

‡ORCID: Zishu Pan, orcid.org/0000-0002-5326-3264

This article was submitted to Vaccines and Molecular Therapeutics, a section of the journal Frontiers in Immunology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics