ORIGINAL RESEARCH article

Front. Microbiol., 07 January 2019

Sec. Antimicrobials, Resistance and Chemotherapy

Volume 9 - 2018 | https://doi.org/10.3389/fmicb.2018.03195

Colistin Resistant A. baumannii: Genomic and Transcriptomic Traits Acquired Under Colistin Therapy

  • 1. Department of Biomedical and Biotechnological Sciences, University of Catania, Catania, Italy

  • 2. Department of Clinical and Experimental Medicine, University of Catania, Catania, Italy

Abstract

Even though colistin-based treatment represents the antimicrobial-regimen backbone for the management of multidrug-resistant Gram-negative infections, colistin resistance is still rare, at least as a full resistance, in Acinetobacter baumannii (Ab). We investigated the genomics and transcriptomics of two clinical Extensively Drug Resistance (XDR) colistin-susceptible/resistant (COL-S/R) Ab strain-pairs in which COL-resistance was developed after exposure to colistin therapy. The molecular characterization of the strains showed that all strains belonged to PFGE-A, ST-281, OXA-23 producers, Global Clone-II, and were resistant to imipenem, meropenem, ampicillin/sulbactam, ciprofloxacin, gentamicin, amikacin, trimethoprim/sulfamethoxazole, and susceptible to tigecycline, in agreement with NGS-acquired resistome. COL-R vs. COL-S Ab comparative genomics, mapping on Ab ATCC 17978 and Ab ACICU Reference Genomes, revealed a closely related genomic phylogeny, especially between strain-pair isolates, and distinctive common genomic non-synonymous SNPs (nsSNPs) in COL-R Ab strains. Furthermore, pmrB and pmrC nsSNPs were found. Notably we recovered, for the first time, lpxC and lpxD nsSNPs previously described only in “in-vitro” mutants and associated with colistin resistance in a clinical COL-R Ab. COL-R vs. COL-S Ab comparative transcriptomics evidenced a strain-dependent response to the colistin resistance onset highly variable among the single COL-R strains vs. their COL-S parents and merely seven common over-expressed transcripts, i.e. the PgaB lipoprotein for biofilm-matrix production, the diacylglycerol kinase for the lipid recycling in the membrane-derived oligosaccharide cycle, a membrane non-ribosomal peptide synthetase, the Lipid A phosphoethanol aminotransferase PmrC, and three hypothetical proteins. The transcript analysis of the “COL-R related genes” and the RNA-seq data confirmed pmrCAB over-expression responsible for a greater positive net cell-charge, and lpxACD under-expression in COL-R causing a decreased LPS production, as main mechanisms of colistin resistance. Our study reports the COL-R Ab genomic and transcriptomic signatures reflecting the interplay between several direct and indirect potential adaptations to antimicrobial pressure, including the occurrence of SNP accumulation hotspot loci in genes related to intrinsic or adaptive colistin resistance, surface adhesion proteins and porins, and over-expressed genes involved in different pathways, i.e. biofilm production, oxidative stress response, extensive drug and COL resistance.

Introduction

The multi-drug resistant nosocomial pathogen Acinetobacter baumannii (Ab) represents an increasing global health threat. Colistin remains the last resort among single-agent therapies often combined with other antimicrobial agents (Vila and Pachón, 2012), even though colistin associated or antimicrobial combined therapies were clinically used as alternative antimicrobial regimens (Durante-Mangoni et al., 2014). This drug is a member of the polymyxin family of cationic polypeptides with a broad spectrum of activity against Gram-negative bacteria (Zavascki et al., 2007). Polymyxin antibacterial activity involves an initial interaction with the polyanionic lipopolysaccharide (LPS) within the outer membrane. Divalent cations that usually cross-bridge adjacent LPS molecules necessary for membrane stabilization are subsequently displaced (Hancock and Chapple, 1999) allowing the self-promoted uptake of polycationic peptides across its surface.

Although polymyxin resistance rates in surveillance studies remain very low (Gales et al., 2011), the increasing use of colistin coupled with the clonal spread of colistin-resistant strains could lead to an amplified trend that is already observed, for example in South Korea (27.9% of COL-R) (Ko et al., 2007).

Two main mechanisms of colistin resistance were previously described in Ab (Adams et al., 2009; Moffatt et al., 2010). Adams et al. (2009) demonstrated that resistant mutants could be generated under colistin pressure. These mutants contained mutations in the pmrB gene, with one mutant containing an additional pmrA mutation. Moffatt et al. (2010) suggested that the basis for polymyxin resistance in Ab was due to mutations in the first three genes (lpxACD) in the lipid A biosynthesis pathway. The study also demonstrated that the occurrence of these mutations led to the complete loss of LPS production and a greater susceptibility to other antibiotics. However, two additional, yet relatively poorly understood, resistance phenotypes, named hetero- and adaptive-resistance, have been reported in Ab (Falagas et al., 2010; Cai et al., 2012). Colistin hetero-resistance was first described by Li et al. (2006) and related to the emergence of a subpopulation from an otherwise susceptible (MIC ≤ 2 mg/L) population, the molecular mechanism involved in this phenomenon remains to be elucidated, and its understanding is critical due to the clinical significance of colistin hetero-resistance. Adaptive colistin resistance in Ab refers to a rapid induction of resistance in the presence of antibiotic and a reversal in its absence, moreover the adaptive resistance molecular mechanism involved in its onset remains to be elucidated (Olaitan et al., 2014).

An intrinsic colistin tolerance mechanism was also described and associated with more than 30 genes mainly associated with osmotolerance (Hood et al., 2013).

The transcriptome role in bacterial physiology and antimicrobial resistance mechanisms is becoming increasingly clearer for Ab. Some publications described the transcriptome contribution in the colistin resistance mechanism. Henry et al. (2012), working on Ab ATCC 19606 and its LPS-deficient lpxA mutant strain 19606R, demonstrated that in response to total LPS loss Ab alters the expression of critical transport and biosynthesis systems associated with modulating the composition and structure of the bacterial surface. Park et al. (2015), studying one COL-S and two COL-R Ab strains, found that the differentially expressed genes (DEGs) were all associated with either LPS biosynthesis or electrostatic changes in the bacterial cell membrane; LPS modification represents one of the principal modes of acquisition of colistin resistance in some Ab strains. Cheah et al. (2016) found that the transcriptomes of stable and non-stable polymyxin-resistant samples were not substantially different and featured an altered expression of genes associated with outer membrane structure and biogenesis. Using transcriptomic data, Wright et al. (2017) showed differential gene expression patterns related to mutations in the pmrAB and adeRS two-component regulatory system genes, as well as significant differences in genes related to antibiotic resistance, iron acquisition, amino acid metabolism, and surface-associated proteins.

In this study, using high-throughput-technologies such as NGS, RNA-seq and real time qPCR, two isogenic pairs of XDR COL-S and COL-R Ab clinical strains were investigated for genomic and transcriptomic characterization to gain new insights into the distinctive signatures of colistin resistant Ab.

Our data delineated the genomic and transcriptomic features of COL-R Ab strains, evidencing traits related to their complexity comprising different aspects of the Ab biology.

Our investigations focused different signatures of colistin resistant Ab consisting of common non-synonymous (ns) genome SNPs (gSNPs), especially in glutamate 5-kinase related to the intrinsic colistin resistance, pmrBC and lpxC/D along with their differential expressions, and expression changes in several genes implicated directly (ACICU_02907 diacylglycerol kinase and pmrC) or indirectly (A1S_2651 membrane non ribosomal peptide synthetase and ACICU_01518 hypothetical protein) in colistin resistance. Accessory traits evidencing signatures and pathways related to potential adaptation of this microorganism were also found.

Materials and Methods

Bacterial Strains, Growth Conditions

Two isogenic pairs of unrelated Italian COL-S/R clinical Ab strains (1-S/R, 2-S/R) were previously recovered from the bronchial aspirates of two patients hospitalized in two different Intensive Care Units (ICU) of a Sicilian hospital (Cannizzaro, Italy) being treated with colistin. The two isogenic pairs were not isolated by the authors but provided by Cannizzaro Hospital. Therefore, an ethics approval was not required as per institutional and national guidelines and regulations.

Isolates were collected by standard methods and identified at the species level using the API 20NE system (bioMérieux, Durham, NC, USA). Identification was also genomically confirmed by de novo whole genome sequencing data using the Speciesfinder tool (http://www.genomicepidemiology.org/). COL-S Ab ATCC 19606 was used as a control.

Antimicrobial Susceptibility Tests

MIC assays for colistin (COL), imipenem (IMP), meropenem (MEM), ampicillin/sulbactam (SAM), ciprofloxacin (CIP), gentamicin (GEN), amikacin (AK), tigecycline (TGC), and trimethoprim/sulfamethoxazole (SXT) were performed using the standard broth microdilution method according to the European Committee on Antimicrobial Susceptibility Testing (EUCAST) and CLSI guidelines (Clinical and Laboratory Standards Institute. Performance standards for antimicrobial susceptibility testing; 20-third informational supplement. 2015; Document M100-S25).

TGC MIC determinations were performed using TGC purchased from Pfizer (Pfizer, Rome, Italy), whereas testing pertaining to COL, IMP, MEM, SAM, CIP, GEN, AK, and SXT was performed using powders purchased from Sigma (Sigma Chemical Co., St. Louis, MO, USA).

Susceptibility and resistance categories were assigned according to EUCAST breakpoints (http://www.eucast.org/clinical_breakpoints/). TGC breakpoints for Enterobacteriaceae (≤2/≥8 μg/mL for susceptible/resistant) established by the US Food and Drug Administration (FDA) were applied. Escherichia coli ATCC 25922 was used as the quality control strain.

Whole Genome Sequencing (WGS)

Whole Genome Sequencing (WGS) was performed using the Illumina Mi-Seq sequencing system.

DNA Extraction

Genomic DNA was extracted from the samples using the GenElute Bacterial Genomic DNA kit (Sigma-Aldrich, UK), following the protocol for Gram negative bacteria. The quality of the DNA was verified using a 2200 TapeStation Genomic Screen Tape device (Agilent, Santa Clara, CA, USA) and its concentration ascertained by Picogreen (Life Technologies). DNA was normalized to 0.2 ng/μl in a volume of 50 μL. For paired end reads (PE), libraries were prepared by PGP with the Nextera XT DNA Library Prep Kit (Illumina, San Diego, USA) following the manufacturer's protocol and their evaluation was made with the Agilent Tape Station 2200. The indexed libraries were quantified with the ABI9700 qPCR instrument using the KAPA Library Quantification Kit in triplicate, according to the manufacturer's protocol (Kapa Biosystems, Woburn, MA, USA). Five μL of the pooled library at a final concentration of 2 nM were used for sequencing using Illumina Miseq with a 150 Paired-end Read sequencing module. For mate pair reads (MP), libraries were prepared by PGP with the Illumina Nextera Mate Pair Sample Prep Kit (Illumina, San Diego, CA, USA) following the manufacturer's protocol and their evaluation was made with the Agilent Tape Station 2200. The indexed libraries were quantified with the ABI9700 qPCR instrument using the KAPA Library Quantification Kit in triplicate, according to the manufacturer's protocol (Kapa Biosystems, Woburn, MA, USA). Five μL of the pooled library at a final concentration of 2 nM were used for sequencing using Illumina Miseq with a 300 Paired-end Read sequencing module.

Sample Preparation (de novo Sequencing)

The 4 samples were processed using the Illumina Mi-Seq technology, with two different libraries: (i) a paired-end library with reads of 150 bp and average insert size of 400 bp; (ii) a mate-pair library with reads of 250 bp and average insert size of 8 kb. After sequence data generation, raw reads were processed using FastQC v0.11.2 to assess data quality. The sequencing reads were then trimmed using Trimmomatic v.0.33.2 to remove only sequencing adapters for paired-end reads, while Mate Pair reads were processed by requiring a minimum base quality of 20 (Phred scale) and a minimum read length of 100 nucleotides, in order to filter out sequences composed only of Ns and to improve the per base score of the mate pair reads. Only trimmed reads were included in the downstream analysis. In S-Table_1, the total number of paired end and mate pair reads are reported with the estimated coverage.

De novo Genome Assembly

Genome assembly was performed using the SPAdes v3.5 software. Reads were initially normalized with khmer 1.3, and then error-corrected using the SPAdes Bayesian Hammer utility. Finally, the assembly was performed using recommended parameters for such Illumina data. The SPAdes software produced a contigs file for each sample. Post-assembly controls and metrics were generated using the Quast v.2.3 software. S-Table_2 shows the assembly statistics.

De novo Gene Annotation

The assembled scaffolds were processed using Prokka v1.9 software to predict genes and annotate those sequences using a set of conserved prokaryotic genes. Figures S1S4 show the de novo Genome Assembly Report of the strains in study.

DNA-Sequencing Data Accession Number

The genomic sequence reads were deposited in the NCBI Genome database in the Sequence Read Archive (SRA) under study accession n° SRP133297.

Single Nucleotide Polymorphisms (SNPs)

For the SNP call, a genomic re-sequencing was performed from the paired-end library raw reads (acc. n° SRP133297). Illumina raw reads were trimmed using “Trimmomatic” requiring a minimum base quality of 20 (Phred scale) and a minimum read length of 36 nucleotides. Only trimmed reads were included in the downstream analysis. Each sample was aligned with the Ab ATCC 17978 reference genome (RefGen) sequence (CP000521.1), chosen because the most important mutations associated with resistance to colistin were annotated on this Ab genome (Arroyo et al., 2011; Traglia et al., 2014) and with Ab ACICU (CP000863.1), using “Bwa mem” ver 0.7.5a (Wright et al., 2017).

For detection of SNPs, and insertions and deletions (indels), each.bam file was sorted using Samtools v.0.1.19 and duplicated reads were marked using the Picard Mark Duplicates utility. Complex variants, SNPs and indels were detected using “Freebayes” v.0.9.14, which required a minimum mapping quality of 30 (Phred scale) and a minimum base quality of 20.

In S-Table_3, we report a coverage estimation for the reference genomes of the sample. Coverage is calculated using the formula: Cov = (N° mapped Reads × Reads Length/Reference Length), where the Read Length is the estimation of read size after the trimming step, and Reference Length is the appropriate reference genome size of the sample.

The majority of the sequenced reads were properly aligned with the corresponding reference genome. Even if 1-R seems to have less aligned reads compared to the other samples, the estimated coverage of 20X is sufficient for variation calling analysis. Variation calling output data (.vcf files) were provided as Supplementary Table Files (S-Table_4-1S on Ab ATCC 17978 for the 1-S Ab, S-Table_5-1R on Ab ATCC 17978 for 1-R Ab, S-Table_6-2S on Ab ATCC 17978 for the 2-S Ab, S-Table_7-2R on Ab ATCC 17978 for the 2-R Ab, and S-Table_8-1S on Ab ACICU for the 1-S Ab, S-Table_9-1R on Ab ACICU for 1-R Ab, S-Table_10-2S on Ab ACICU for the 2-S Ab, S-Table_11-2R on Ab ACICU for the 2-R Ab).

In order to select those SNPs that were only present in the COL-R strains, all SNPs were computationally re-filtered. All non-synonymous SNPs present in COL-R isolates were confirmed by Sanger sequencing.

Molecular and Genomic Epidemiology

Ab isolates were examined for their genetic relatedness using PFGE. This was facilitated following the extraction of genomic DNA and subsequent digestion with ApaI (Mezzatesta et al., 2012).

Whole Genome Sequencing raw data were analyzed with the ResFinder (v2.1) server (http://www.genomicepidemiology.org/), for the detection of the acquired antimicrobial resistance genes (Zankari et al., 2012) using a 98% threshold for nucleotide sequence identity and 60% for the minimum length coverage. MultiLocus Sequence Typing (MLST) was performed using the MLST (v1.8) server (http://www.genomicepidemiology.org/) with the Oxford University and Pasteur Institute (PI) scheme (Larsen et al., 2012).

Phylogenetic Trees

Phylogeny was inferred by the whole genome sequencing raw data analysis with the CSI phylogeny on-line tool accessible on the Center for genomic epidemiology website (Kaas et al., 2014) and by the REALPHY pipeline, from the Swiss Institute of Bioinformatics, for a reference sequence alignment based Phylogeny builder that can infer phylogenetic trees from whole genome sequence data (Bertels et al., 2014). Both analyses were performed with default setting parameters. The graphical output of the two analysis was a Phylogenetic tree (Figures 1, 2).

Figure 1

Figure 2

Core SNPs

The core SNPs detection shared among all strains was computationally carried out by Nullarbor (http://github.com/tseemann/nullarbor).

RNA-Seq

RNA-seq was performed using the Illumina Mi-seq sequencing system and two replicates were performed using two different libraries, a Single-End Library with 50 bp reads (Short-Insert Library) and a Paired-end Read Library with 150 bp reads (Tru-seq Library), as a strategy to optimize the collected RNA-seq data according to the following protocols.

Tru-Seq Library RNA Extraction

RNAs were extracted from the 4 samples grown until mid-log phase using the NucleoSpin RNA kit (Macherey-Nagel, Dueren, Germany) following the manufacturer's protocol with minor modifications. Bacterial cell pellets were lysed by the bead-beating procedure in the presence of 50 μL RA1 Buffer. Then 3.5 μL ß-mercaptoethanol were added and the lysate was filtered through NucleoSpin Filters (violet rings). RNA binding condition was adjusted by adding 350 μL of ethanol (70%) to the lysate and the RNA was then extracted following the protocol. The quality of the total RNA was verified using a 2200 TapeStation RNA Screen Tape device (Agilent, Santa Clara, CA, USA) and its concentration ascertained using an ND-1000 spectrophotometer (NanoDrop, Wilmington, DE, USA). Ribosomal RNA was removed using the Ribo-Zero rRNA Removal Kit (Bacteria) from 2 micrograms of total RNA, and the depleted RNA was used as input in the Illumina TruseqRNA stranded kit without PolyA-enrichment. The prepared libraries were evaluated with the High sensitivity D1000 screen Tape (Agilent Tape Station 2200). The indexed libraries were quantified with the ABI9700 qPCR instrument using the KAPA Library Quantification Kit in triplicate according to the manufacturer's protocol (Kapa Biosystems, Woburn, MA, USA). Five μL of the pooled library at a final concentration of 2 nM were used for sequencing using Illumina Miseq with a 150 Paired-end Read sequencing module.

Short-Insert Library RNA Extraction

RNAs were extracted from the 4 strains grown until mid-log growth phase and total RNA was extracted with Trizol reagent (Invitrogen) according to the manufacturer's protocol. After ribosomal depletion, sequencing libraries were prepared using the Illumina mRNA-seq sample preparation kit following the supplier's instructions except that total RNA was not fragmented and double-stranded cDNA was size-selected (100 to 400 bp) to also maximize the recovery of small-RNAs.

The prepared libraries were evaluated with the High sensitivity D1000 screen Tape (Agilent Tape Station 2200). The indexed libraries were quantified in triplicate with the ABI7900 qPCR instrument using the KAPA Library Quantification Kit, according to the manufacturer's protocol (Kapa Biosystems, Woburn, MA, USA). From the pooled library, 5 μL at a final concentration of 4 nM were used for Miseq sequencing with an A single end stranded library with reads of 50bp sequencing module.

Tru-Seq Library Preparation and Sequencing

The samples were processed using the Illumina MiSeq technology, using an A paired-end library with reads of 150 bp and average insert size of 350/400 bp. After sequence data generation, raw reads were processed using FastQC v0.11.2 to assess data quality. The sequenced reads were then trimmed using Trimmomatic v.0.33.2 to remove only sequencing adapters for Paired-end reads.

A minimum base quality of 15 over a 4-bases sliding-window was required. Only sequences with a length above 36 nucleotides were analyzed. Only trimmed reads were included in the downstream analysis.

Short-Insert Library Preparation and Sequencing

The samples were processed using the Illumina MiSeq technology with an A single end stranded library with reads of 50 bp. After sequence data generation, raw reads were processed using FastQC v0.11.2 to assess data quality. Reads were then trimmed using Trimmomatic v.0.33.2 to remove sequencing adapters for Single-end reads, requiring a minimum base quality of 15 (Phred scale) and a minimum read length of 15 nucleotides. Only trimmed reads were included in the downstream analysis.

Tru-Seq and Short-Insert Library Analysis

Tru-seq and Short-insert RNA-seq reads were aligned on Ab ATCC 17978 (CP000521.1) and on Ab ACICU (CP000863.1) RefGen, as well as transcripts assembled and quantified using Rockhopper v.2.03 (McClure et al., 2013; Tjaden, 2015) specifically designed for the bacterial gene structures and transcriptomes. Analyses were run on default parameter settings with verbose output to obtain expression data. Rockhopper normalizes read counts for each sample using the upper quartile gene expression level. Starting from the p-values calculated according to the Anders and Huber approach, DEGs were assigned by computing q-values ≤ 0.01 based on the Benjamini–Hochberg correction with a false discovery rate of <1%. In addition, Rockhopper is a versatile tool using biological replicates when available, and surrogate replicates when biological replicates for two different conditions are unavailable, considering the two conditions under investigation surrogate replicates for each other (McClure et al., 2013).

Finally, filtering analyses were computationally carried out for sorting, first, the differentially expressed genes in the COL-R strains vs. their COL-S parental strains and, then, the selection of only those present contemporarily in both COL-R strains showing the same expression (up- or down-regulation).

Determination of RNA Functional Categories

Functional categories of the genes with differential expression in COL-R vs. COL-S parents were investigated by bioinformatics including BLAST, PANTHER (Protein ANalysis THrough Evolutionary Relationships) Classification System, Gene Ontology (GO) Consortium, ExPASy, STRING and Kyoto Encyclopedia of Genes and Genomes (KEGG).

Determination of the Affected Pathways

Online tool DAVID (http://david.abcc.ncifcrf.gov/) (Huang et al., 2009a,b) was selected to identify the affected pathways among the DEGs. The gene lists were uploaded as Official Gene Symbols of the reference genome Ab ATCC 17978 or Ab ACICU, and automatically selecting the list type (Gene list) of A. baumannii. Functional Annotation Chart was visualized using the p-value threshold of 0.01 and a minimum count number of 4 genes. The information on the affected pathways was obtained from KEGG within the analysis in DAVID, using the mentioned thresholds. The affected biological processes were obtained from Gene Ontology Consortium within the analysis in DAVID.

RNA-Sequencing Data Accession Number

RNA-seq data of the two libraries were deposited in the NCBI Gene Expression Omnibus (GEO) database under the accession number GSE109951.

I-Tasser ab initio Structure Modeling

For the I-Tasser (Iterative Threading asseMBLY Refinement) analysis (Roy et al., 2010) the MKLKTVTIDGKVYAEVDGDKPIYIHDDGKEMPHDAPHS- VATIARLNNEAKTHREAKEAAKALKAFEGIEDPAAAKKALQTIQNLDDKKLVDAGEVEKVKAEAIKAVEEKYAPIVAQRDALEASLHKELIGGGFARSKYIQDNIAVPVDMVQATFGHHFKIEEGKVVAYDPNGEKIYSRVRPGELANVDEALESLVGGYQHKDLILKGGKGTGGGFQGGGKGGAPTGMKRSEMSVSQKADYIKEHGNDAFLKLPN A1S_2027 was selected as the target, where as the MNTLNINDIKKHADVIASCGTKVGTVDHLEGENQLKLTK- DENDQHHLIPTSWIGEVKEDVILNKNSEEVKENWQAI for A1S_2230, and MKKLSTILTAGVLAMLSVSAFACPKGTQLQGGTGPNHKGGKCVAVHGKATAQKAKKEATKTKQEVKKDLTMQKHDAMTSATHAQHESHQMTHQMKQDAVKTANTAKAATKP for ACICU_01518.

Real Time qPCR

The expression of the A1S_0938, A1S_2027, A1S_2230/ACICU_02436, A1S_2651, A1S_2752/ACICU_03004 genes showing differences in both COL-R strains compared with the COL-S strains after RNA-seq, as well as lpxACD and pmr-operon transcript quantification were validated and analyzed by real-time qPCR.

Overnight cultures of all strains were diluted 1:50 in Cation-adjusted Mueller–Hinton broth (Ca-MHB) and grown until the mid-log phase (OD600 = 0.5) for RNA-seq data validation, and until the exponential phase (OD600 = 0.04-0.07) and mid-log phase (OD600 = 0.5) for the investigations on lpxACD and pmr-operon transcription. RNA was subsequently extracted, treated and quantified as previously described (Cafiso et al., 2012, 2014). mRNA was retro-transcribed and real-time qPCR was carried out using a previously published method (Cafiso et al., 2012, 2014).

All real time qPCRs were performed in triplicate using an initial denaturation stage of 95°C for 3 min, followed by 35 cycles at 95°C for 10 s, 60°C for 30 s, 72°C for 45 s and a final cycle at 95°C for 1 min, and from 60°C for 30 s to 95°C for 30 s. The primers used to generate products for quantification resulted in the amplification of a fragment of less than 260 bp. rpoB was used as a normalizer and constituted the internal control. All of the primers that were used for the real time qPCR study are listed in S-Table_12. For each analysis, three to five distinct biological replicates were performed. Statistical expression analyses were conducted with REST2009 tool as previously described (Pfaffl et al., 2002).

The real time qPCR expression levels of lpxACD and the pmr-operon were represented as the increment/decrement fold-change (FC) in COL-R (1-R, 2-R) vs. COL-S isolates (1-S, 2-S). Expression level analysis was performed for the exponential and mid-log growth phase cultures.

The real time qPCR expression level of the A1S_0938, A1S_2027, A1S_2230/ACICU_02436, A1S_2651, A1S_2752/ACICU_03004 genes, for the RNA-seq data validation, were shown as FCs of COL-R strains vs. the COL-S strains in RNA-seq vs. real time qPCR. Three biological replicates were considered.

Surface Charge Determination

The cytochrome c binding assay was performed as a surrogate measure of the relative net positive surface charge of the strain-pairs using a previously described procedure (Yang et al., 2009, 2010, 2012). The amount of unbound cytochrome c that was detected in the supernatant correlated directly with the net positive charge associated with the bacterial surface. The generated data are expressed as the mean amount of bound cytochrome c ± SD. A minimum of three independent experimental repeats were performed on at least three separate days.

LPS Amount and Surface-Attached Polysaccharides Quantification

Lipopolysaccharide (LPS) was extracted by the hot phenol-water method as previously described (Rezania et al., 2011). Extra pure E. coli LPS (Sigma) was used to prepare a standard curve to quantify extracted LPSs. For all samples and standards, OD259 was measured in a spectrophotometer (Thermo Scientific™ GENESYS 10S UV-Vis), and the standard curve used to determine LPS concentration in unknown samples. Surface-attached Polysaccharides (SP) extraction and quantification were carried out as described by Brimacombe and Beatty (2013).

LPS and SP extractions were performed during bacterial stationary growth phase and the cultures were normalized to OD650 2.0 (Brimacombe and Beatty, 2013). Data are derived from at least three independent experiments for both methods.

Results

The four Ab strains investigated were isolated from serial bronchial aspirates of two hospitalized patients. Patient 1 underwent a pulmonary lobectomy caused by a respiratory distress, whilst Patient 2 was a severely burned patient that had a cardiac arrest. Both patients were initially infected with COL-S Ab, consequently treated with colistin, and then infected with the COL-R Ab. The interval between the isolation of the COL-S and the COL-R Ab strain was 24 days for Patient 1 and 7 days for Patient 2. No reversion of colistin resistance upon colistin withdrawal was observed in both patients.

Molecular Characterization-Genomic Epidemiology-Phylogeny

All isolates were designated ST-281 according to the Oxford University scheme and ST-2 according to the Pasteur Institute grouping, even though COL-R Ab 1-R was grouped as ST-187 with PI - a ST-2 Single Locus Variant harboring a nucleotide change resulting in the conversion of the rpoB_2 allele to the rpoB_43 allele. All COL-R Ab strains assigned to the same PFGE macrorestriction profile A and to the Global Clonal lineage II (Table 1).

Table 1

StrainOU
MLST
PIMLSTPFGEGCMICs (mg/L)Resistome
COLIPMMEMSAMCIPGENAKTGCSXTβ-lactamsAGsSAs
1-S2812AII0.12516*16*>256*>32*8*128*28*blaADC-25
blaOXA-23
blaOXA-82
aadA2
ant(2″)-Ia
aph(3′)-Vla
sul1
1-R281187AII64*16*16*>256*>32*16*128*28*blaADC-25
blaOXA-23
blaOXA-82
aadA2
ant(2″)-Ia
aph(3′)-Vla
sul1
2-S2812AII0.12516*16*>256*>32*8*64*216*blaADC-25
blaOXA-23
blaOXA-82
aadA1
aadA2
aac(3)-Ia
ant(2″)-Ia
aph(3′)-VIa
sul1
2-R2812AII256*16*16*>256*>32*8*32*216*blaADC-25
blaOXA-23
blaOXA-82
aadA1
aadA2
aac(3)-Ia
ant(2″)-Ia
aph(3′)-VIa
sul1

Molecular characterization, antibiotype and resistome of the A. baumannii strains.

*

indicates that the MIC value falls above the resistance breakpoints. OU, Oxford University; PI, Pasteur Institute; AGs, Aminoglycosides; SAs, Sulfonamides.

To deeply examine and clarify the phylogenetic relatedness among the COL-R and COL-S Ab strains recovered from the same patients, and their relation to Ref strains, we generated two whole gSNP phylogenetic trees by two different computational approach, i.e. a phylogeny based on the reference-based concatenated alignment of the high quality SNPs and a construction of a maximum likelihood tree from the alignment by using a modified, more accurate version of FastTree (CSI-PHYLOGENY) and a phylogeny reconstructed by combined alignments obtained by mapping reads to not one but to multiple reference sequences (REALPHY), shown in Figures 1, 2. Both gSNP phylogenetic trees showed a closely phylogeny of the COL-S and COL-R isolates belonged to the same strain pair along with a stronger correlation of two strain pairs with the Ab ACICU genome than the Ab ATCC 17978. The phylogenetic tree generated on core SNPs (cSNPs) confirmed and corroborated these considerations (Figure 3). Furthermore, the Nullarbor computational analysis, generating a core genome alignment and provided high quality core SNPs, evidenced an average of 11,236 cSNPs across 3,904,116 bp of the Ab ACICU RefGen shared among the 4 strains. Comparing pairwise cSNP differences and according to the criteria considering 1-40 cSNP difference range as indicator of a very high phylogenetic relation and 4-44830 cSNP difference range for genetically distinct phylogenetic subclades recently used to infer the phylogeny in colistin-resistant Ab (Mustapha et al., 2018), we considered the strains of the 1 pair as highly related strains, having 70 cSNP differences between the COL-R and COL-S parent strains, whereas the strains of the 2 pair as very highly related showing 18 cSNP differences. Furthermore, we found 23 cSNP differences comparing pairwise 1-S vs. 2-S, and 81 cSNP differences among the 1-R vs. 2-R (Table 2).

Figure 3

Table 2

StrainCore SNP differencePmrB domains
and AA changes
PmrC domains
and AA changes
LpxC domains
and AA changes
LpxD domains
and AA changes
AA changes in
protein related
to colistin resistance
in COL-R
strains vs. COL-S
parental strain
(1-215)HisKC
(216-276)
(277-330)HTAPaseCC
(331-419)
(1-236)SulfataseC
(237-532)
PET
N-terminal
(44-194)
LptA
(220-515)
UDP-3-O-(3-hydroxymyristoyl)
Glucosamine N-acyltransferase (2-341) containing:
NAT
non-repeat region
(26-92)
Hexapeptide repeats
(112-144) (148-183)
(225-260) (262-288)
1-R vs. 1-S70L208F
(Arroyo et al., 2011)
(This study)
L340F
(This study)
S171Y
(This study)
S292* (This study)- ProB:Y43S-V44I-E66Q
(This study) - A1S_2928:F158Y,T163S, N166I (This study) - ACICU_02735: I120L (This study)
2-R vs. 2-S18R263H
(Lim et al., 2015)
(Choi et al., 2017)
This study

AA changes emerging under therapy in COL-R A. baumannii.

c = Previously predicted domains according to NCBI domain predictor (www.ncbi.nlm.nhi.gov/protein) are indicated as follows: Sulfatase domain; HisK, histidine kinase (dimerization/phosphoacceptor) domain; HTAPaseC, histidine-kinase-like ATPase. PET, Phosphoethanolamine transferase N-terminal; LptA, Lipooligosaccharide Phosphoethanolamine Transferase A or Lipid A Phosphoethanolamine Transferase catalyzes the modification of the lipid A headgroups by phosphoethanolamine (PEA) or 4-amino-arabinose residues (Interpro: https://www.ebi.ac.uk/interpro/). NAT = UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase non-repeat region. The amino acids (aa) corresponding to these domains are displayed in brackets.

*

Stop Codon.

Antibiotype

All strains included in this study were deemed XDR following comparison with previously agreed definitions (Magiorakos et al., 2012). MICs showed an uniform resistance profile to all antimicrobials, with the exception of TGC (MIC of 2 mg/L). Variations in this profile were only observed in the colistin susceptibility within the isogenic strains in both pairs (1-S and 2-S) (Table 1).

Resistome

Resistome analysis refined the occurrence of the several acquired resistance genes including beta-lactam resistance ones, i.e. blaADC-25, blaOXA-82, and blaOXA-23 harbored in Tn2006 and flanked by two copies of the insertion sequence ISAba1 with an opposite orientation as in Refseq GQ861439.1, and the sulphonamide resistance gene sul1, in both Ab strain pairs. Different aminoglycoside resistance genes were also detected, with aadA2, aph(3′)-Vla and ant(2″)-Ia recorded in the 1-S/R Ab and aadA1, aadA2, ant(2″)-Ia, aac(3)-Ia, and aph(3′)-VIa in the 2-S/R Ab (Table 1). Regarding to Fluoroquinolone (FQ) resistance, no GyrA (ACICU_02869) AA changes were detected, whilst S84L in ParC (ACICU_00214) was found in all strains when annotated on Ab ACICU RefGen. All strains harbored T669S in AdeB (ACICU_01824), a resistance-nodulation-cell-division (RND)-type efflux pump related to resistance toward various antibiotics including FQs. Neither the “qnr-family” genes, aac(6′) Ib-cr, norA, oqxA-B, nor the qepA-A2 FQ-resistance genes were observed in Ab strains.

Characterizing COL-R Ab gSNP Signatures

For the genomic SNP call, we preferred to assembly the sequencing raw data on two different reference genomes, i.e. A. baumannii ATCC 17978 and ACICU, since on Ab ATCC 17978 genome were firstly annotated the most important mutations associated with colistin resistance (Arroyo et al., 2011; Traglia et al., 2014), whilst the second genome was previously categorized as MLST Pasteur ST2, Oxford ST281, international clonal lineage II, as the Ab sample in study were categorized. Furthermore, Ab ACICU was used as RefGen in previous investigations on colistin-resistance in Ab (Wright et al., 2016).

In addition, a filtering of the gSNPs present only in both COL-R strains showed distinctive common genomic SNPs in COL-R Ab mapped both on RefGen Ab ATCC 17978 and RefGen Ab ACICU.

In details, the alignment on RefGen Ab ATCC 17978 displayed a total of 22 common synonymous and non-synonymous gSNPs in 10 genes and in three non-coding regions as shown in Table 3A. Among these, genomic re-sequencing data revealed six common nsSNPs conferring S316A change in FilD porin (long-chain fatty acid transport); E66Q in the A1S_2024 - homologous to the 5-glutamate kinase encoding gene of the E. coli proB- involved in intrinsic colistin resistance; L576F and N577D in the A1S_2443 surface adhesion protein; F158Y, T163S, and N166I in A1S_2928 hypothetical protein. Finally, three SNPs fell into three intergenic regions, with one located in the non-coding region predicted as the A1S_1091 succinylornithine transaminase promoter (carbon starvation protein C) (Table 3A).

Table 3

Ab ATCC 17978
protein tag
SNP/indel
genomic
localization (nt)
SNP/indelSNP function class
(AA substitution)
Protein
(A)
A1S_0693825375TCCGCTAAA → GCAGCCAAGS316AFilD
825389AT → TCsSNP
825405T → AsSNP
Non-coding region868391T → C
A1S_09101054569A → TsSNPGamma-glutamyltranspeptidase
Non-coding region
Promoter
(-10) of A1S_1091
1273501CGAG → TGAC-Succinylornithine transaminase (carbon starvation protein C)
A1S_12091414952A → GsSNPBenzoate transport porin (benp)
1414967G → AsSNP
1414979CTTA → TTTGsSNP
A1S_15461800398A → GsSNPOrganic solvent tolerance protein
Non-coding region1961637TA → CT
A1S_20242351886GC → GTsSNPGlutamate 5-kinase
2351896CGTCTCA → CGTCTGAE66Q
A1S_20292357676AACG → CACAsSNPHypothetical protein A1s_2029
2357697T → GsSNP
A1S_24432826634TAAG → CAAAL576F/N577DSurface adhesion protein
A1S_28563304823TAATTTGC → CAACCTGTsSNPEsterase
A1S_29283391139T → AF158YHypothetical Protein A1S_2928
3391149T → AT163S
3391154C → GsSNP
3391163A → TN166I
A1S_31273612685C → AsSNPSignal Peptide
AbACICU
ProteinTag
SNP/indel
genomic
localization (nt)
SNP/indelSNP function class
(AA substitution)
Protein
(B)
ACICU_010061119168CACGCT → AACACCS54GHypothetical protein
ACICU_010431140525ATGTCGAA → CTATTGAGY43S/V44IGlutamate 5-kinase
ACICU_010521144802GCA → ACTA65THypothetical protein
ACICU_010601152378A → TI969LPhage-related minor tail Protein
ACICU_015541666862A → CsSNPBiotin synthase
ACICU_019492080866A → CsSNPAldehyde dehydrogenase
ACICU_019852121627T → GsSNPIclr family transcriptional regulator
ACICU_024032540136A → CsSNPConserved uncharacterized protein
ACICU_027352908460G → AsSNPHypothetical protein
2908471TTAAC → GTAATI120L
ACICU_027362909388TACAGCA → AACTACGA153Bacterial surface proteinContaining Ig-like domains
ACICU_029103084936A → GsSNPPutative surface adhesion protein
3084942T → AsSNP
3084951AGTG → GGTAsSNP
3085085A → CS245A
ACICU_02939
Intergenic region
3123710A → G--
ACICU_029433125312A → GsSNPHypothetical protein
ACICU_tRNA473391221A → T-tRNA-ALA
3391345C → T-tRNA-ALA
ACICU_035093723733A → CsSNP3-Deoxy-D-manno-octulosonicacid transferase
ACICU_RS19025 (pACICU1)24584T → GE92AHypothetical protein
ACICU_p0078 (pACICU2)45280AT → AY53TType IV secretion system
Protein traC

COL-R Ab common genomic SNPs.

sSNP, Synonymous SNP. The nsSNPs are reported in bold.

SNP mapping on Ab ACICU RefGen showed also 22 different common synonymous and nsSNPs in 13 genes. nsSNPs were found in the 5-glutamate kinase, similarly to the Ab ATCC 17978 annotation, determining the Y43S and the V44I AA changes; A153V in ACICU_02736 bacterial surface protein containing Ig-like domains; S54G in ACICU_1006, A65T in ACICU_01052, I120L in ACICU_02735 hypothetical proteins; I969L in the ACICU_01060 phage related minor tail protein; S245A in ACICU_02910 putative surface adhesion protein (Table 3B).

Furthermore, one SNP were found in the ACICU_02938-ACICU_02939 intergenic region, two SNPs in the tRNA-Ala gene, one nsSNPs in pACICU1 and one in pACICU2, as shown in Table 3B. The pACICU1 nsSNP - causing an E92A AA change in the ACICU_RS19025 hypothetical protein homologous to YafO, type II toxin-antitoxin system region of other Ab plasmids. The pACICU2 nsSNP determining the Y53T change in Type IV secretion system protein TraC due to a deletion AT → T resulting in a frameshift causing a premature stop codon at the 58th aminoacid residue in both COL-R strains vs. the COL-S parent strains (Table 3B).

SNPs of the Known Genes Associated With Colistin Resistance

In COL-R Ab vs. their COL-S parent strains mapped both on Ab ATCC 17978 and Ab ACICU RefGens, WGS data showed pmrB nsSNPs on Ab ATCC 17978 and Ab ACICU as follows: (i) L208F AA substitution in a domain without specific functions, in 1-R; (ii) R263H AA substitution in the PmrB histidine kinase domain, in 2-R.

In contrast, pmrC SNPs were only found on Ab ACICU annotation leading to L340F AA change in the PmrC sulfatase domain, coupled to a synonymous T → C SNP in 1-R, while a synonymous C → T was found in 2-R.

No lpxACD nsSNPs were observed in COL-R vs. COL-S strains with respect to the Ab ATCC 17978 RefGen, contrarily lpx cluster-nsSNPs were found on Ab ACICU RefGen in 1-R, determining the S171Y AA substitution in the LpxC phosphoethanolamine transferase N-terminal domain, and G → T in lpxD (ACICU_02090) leading to a truncated protein at the 292 AA (292 AA instead of 356 AA in Ab ACICU RefGen), due to a premature termination codon. No lpxA nsSNPs were found on Ab ACICU RefGen in 1-R and 2-R Ab strains (Table 2).

Comparative Transcriptomics

To define the transcriptomic signatures of the two COL-R vs. COL-S Ab clinical strains, DEGs were determined from the RNomes by filtering firstly the differentially expressed RNAs in the COL-R strains vs. their COL-S parents and, then, re-filtering sorting those present contemporarily in both COL-R isolates with the same expression trend (over or under-expression).

From the Tru-seq (TS) Libraries, Illumina RNA-sequencing generated 1,307,792 - 1,175,327 - 1,173,332 - 1,270,020 total reads in 1-S, 1-R, 2-S, and 2-R, respectively, with 96, 96, 72, and 93% mapped reads on Ab ATCC 17978, as well as 97, 97, 76, and 95% reads aligned on Ab ACICU. RNome analysis on Ab ATCC 17978 revealed 47 and 73 DEGs, 55 and 277 5'-UTR, 18 and 152 3-UTR', 33 and 117 predicted RNAs (with 14 and 32 not-antisense RNAs and 19 and 85 antisense RNAs) in 1-R vs. 1-S and 2-R vs. 2-S. RNome studies on Ab ACICU RefGen evidenced 86 and 50 DEGs, 67 and 221 5'-UTR, 16 and 124 3-UTR', 33 and 102 predicted RNAs (with 12 and 22 not-antisense RNAs and 21 and 80 antisense RNAs) in 1-R vs. 1-S and 2-R vs. 2-S (S-Table_13A).

From the Short-Insert (SI) Libraries 2,353,045 - 2,041,858 - 1,804,167 - 1,819,349 total reads were produced in 1-S, 1-R, 2-S and 2-R, respectively, with 57, 56, 53, and 56% mapped reads on Ab ATCC 17978 and 59, 58, 54, and 57% on Ab ACICU. RNomes annotated on Ab ATCC 17978 RefGen revealed 77 and 28 DEGs, 211 and 94 5'-UTR, 94 and 48 3-UTR', 2909 and 1905 predicted RNAs (with 1497 and 1165 not-antisense RNAs and 1412 and 740 antisense RNAs) in 1-R vs. 1-S and 2-R vs. 2-S. An identical RNome analysis on Ab ACICU revealed 77 and 154 DEGs, 92 and 30 5'-UTR, 37 and 18 3-UTR', 388 and 245 predicted RNAs (with 151 and 107 not-antisense RNAs as well as 237 and 138 antisense RNAs) in 1-R vs. 1-S and 2-R vs. 2-S (S-Table_13B).

Integrating data obtained with the TS- and SI-library RNA-seq data, DAVID enrichment analysis of the COL-R vs. COL-S pairwise DEGs, obtained from the first filtering, evidenced a high variable strain-dependent response to the COL-R onset under COL-pressure.

Specifically, in 1 pair, the enrichment analysis of the pairwise DEGs showed 5 affected KEGG pathways (p-value ≤ 0.01) emerging within the count of the over-expressed DEGs mapped on A. baumannii ACICU RefGen, i.e. Butanoate metabolism (4 genes: ACICU_01343, ACICU_01342, ACICU_01735, ACICU_01767); Glycolysis/Gluconeogenesis (3 genes: ACICU_02656, ACICU_01735, ACICU_01737); Benzoate degradation via CoA ligation (3genes: ACICU_01343, ACICU_01342, ACICU_01767); Pyruvate metabolism (3 genes: ACICU_01735, ACICU_01737, ACICU_01767); Valine, leucine and isoleucine degradation (3 genes: ACICU_01408, ACICU_01342, ACICU_01767). Similarly, the enrichment analysis of the over-expressed DEGs annotated on A. baumannii ATCC 17978 showed 3 affected KEGG pathways including the Butanoate metabolism (5 genes: A1S_1729, A1S_1699, A1S_1341, A1S_2102, A1S_1705), Tryptophan metabolism (4 genes: A1S_1729, A1S_1341, A1S_2102, A1S_2450), Lysine degradation (3 genes: A1S_1729, A1S_1341, A1S_2102), Fatty acid metabolism, Limonene and pinene degradation (3 genes: A1S_1344, A1S_1341, A1S_2102), Benzoate degradation via CoA ligation (3 genes: A1S_1729, A1S_1344, A1S_1341). No KEGG pathways or GO-Biological processes were evidenced by the enrichment of the under-expressed DEGs in both annotations.

In 2 pair, DAVID enrichment analysis detected no affected KEGG pathways among the over-expressed DEGs on Ab ACICU annotation, on the contrary 23 biological process records (p-value ≤ 0.01) (A1S_1746, A1S_1813, A1S_0094, A1S_1529, A1S_0548, A1S_3247, A1S_1471, A1S_1330, A1S_2036, A1S_2042, A1S_1855, A1S_2751, A1S_1320, A1S_2750 genes) mainly attributable to genes involved in the regulation of transcription and gene expression were detected among the over-expressed DEGs assembled on Ab ATCC 17978. No KEGG pathways or Biological processes were evidenced by the DAVID enrichment of the under-expressed DEGs on both annotations.

On the integrated TS and SI library RNA-seq data and on Ab ATCC 17978 and ACICU RefGen annotations, the second comparative filtering analysis of the data sorting for the statistically significant differentially expressed genes with the same expression profile in both COL-R Ab strains showed 7 over-expressed protein-coding genes (q-value ≤ 0.01) for: (i) the PgaB outer membrane lipoprotein catalyzing the N-deacetylation of poly-beta-1,6-N-acetyl-D-glucosamine (PGA), an adhesin polysaccharide that promotes the PGA export associated with biofilm formation (A1S_0938), (Biological Process GO:0005976) (TIGR03938); (ii) the membrane non-ribosomal peptide synthetase module (A1S_2651), (COG:318) (GO:0008152), binding the phosphopantetheine (GO:0031177); (iii) the Lipid A phosphoethanolamine transferase PmrC involved in the phosphoethanolamine incorporation into lipidA (A1S_2752 and its homologous in ACICU_03004) (GO:0008152); (iv) the diacylglycerol kinase (ACICU_02907) for the lipid recycling in the membrane derived oligosaccharides cycle; (v) three hypothetical proteins (A1S_2027, A1S_2230 and its homologous ACICU_02436, and ACICU_01518) (Table 4).

Table 4

Ab ATCC 17978Locus TagaAb ACICU
Locus Taga
LibrarybDescriptionI-Tasser
Ab Initio Modeling Prediction
COGcGO_numb.dExpression of RNA-seq data annotated on
AbATCC 17978a
(q-value≤0,01)
Expression of RNA-seq data annotated on
AbACICUa
(q-value0.01)
FunctionAssociated Phenotype
1-R1-S2-R2-S1-R1-S2-R2-S
A1S_0938SIPoly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaBGGO:0005976812039240Biofilm matrix production regulationBiofilm producer
A1S_2651SIMembrane
Non-ribosomal peptide synthetase
I, QGO:0008152561555927Siderophore productionProtection from ROS
protection of (oxidative stress)
ACICU_02907SIDiacylglycerol kinaseMGO:00086541793974167Recycle the diacylglycerol generated as a by-product of membrane-derived oligosaccharide biosynthesisIntegrity of cell membrane putatively aiding Colistin resistance
A1S_2752ACICU_03004SILipid A phosphoethanol aminotransferase PmrCRGO:0008152159357914369739611LPS modificationColistin resistance
ACICU_01518TSHypotetical protein1042253341736Membrane protein
Periplasmatics
-
A1S_2027-TSHypotetical proteinRNA-binding motif1358970DNA damage responseAcquisition of mutational antibiotic resistance
A1S_2230ACICU_02436TSHypotetical proteinPhotoreaction center of the photosynthesisS4551094911354607318Light responseMotility, biofilm,
MIN and TGC susceptibility

Transcriptomic traits characterizing COL-R A. baumannii.

a

Ab, Acinetobacter baumannii;

b

SI, Short-Insert library; TS, Tru-Seq library;

c

G, carbohydrate metabolism and transport; I, lipid metabolism; Q, secondary structure; R, general functional prediction only; S, unknown function;

d

GO numbers refer only to the biological process.

Validation of RNA-Seq Data

The validation of the RNA-seq data performed by real time qRT-PCR assays confirmed that A1S_0938 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase pgaB, A1S_2027 hypothetical protein, A1S_2230/ACICU_02436 hypothetical protein, A1S_2651 membrane non-ribosomal peptide synthetase, and A1S_2752/ACICU_03004 Lipid A phosphoethanol aminotransferase pmrC had a statistically significant increased expression (p-value ≤ 0.05) in both COL-R Ab strains compared with their COL-S parents (Figure 4).

Figure 4

I-Tasser ab initio Structure Modeling

I-Tasser ab initio structure modeling was used to computationally resolve the structure and function of the A1S_2027, A1S_2230 and ACICU_01518 hypothetical proteins.

Regarding the A1S_2027 hypothetical protein, the CD-BLAST of the A1S_2027 protein returned a homology with the KOW superfamily (cl00354). The KOW domain is known as an RNA-binding motif that is shared, so far, among some families of ribosomal proteins and the essential bacterial transcriptional elongation factor NusG. A1S_2027 contains a predicted alpha-helical coiled-coil and has a predicted cytoplasmatic localization. On the contrary, although the I-TASSER COACH Predicted function found, with a low C-score (0.03), the PDB-hit 1fosG of the human heterodimeric bZIP transcription factor c-Fos-c-Jun bound to DNA involved in transcription, the overview of generated predictions did not clarify the structure and biological function of the A1S_2027 protein. For the A1S_2230 hypothetical protein of unknown function, the CD-BLAST of the A1S_2230/ACICU_02436 protein found homology with the DUF2171 domain (pfam09939) (COG3798). This domain was found in hypothetical prokaryotic conserved proteins with no known function. The I-TASSER prediction of the threading templates, Gene Ontology (GO) and consensus prediction of GO terms of the A1S_2230 protein predicted the closest structural similarity with PDB hit 1e6dH (TM-score 0.730), GO-term 1prcH (0.26 C-scoreGO), consensus prediction of the GO term biological process (GO:0019684) and the cellular component (GO:0030077) with a 0.57 GO-Score, matching a plasma membrane protein of a Photoreaction Center of the photosynthesis characterized in Rhodobacter sphaeroides (Table 4).

Concerning ACICU_01518, unfortunately I-TASSER predictions did not clarify the structure and biological function of the ACICU_01518 protein.

Transcripts of the Known Genes Associated With Colistin Resistance

pmrCAB transcript analysis showed a statistically significant over-expression of the pmr-operon with a notable increase in pmrC, both at the exponential and mid-log growth phases, comparing COL-R isolates with their COL-S counterparts. Conversely, a statistically significant lpxACD under-expression was observed during the mid-log phase for all COL-R strains and only in 1-R isolate during the exponential-growth phase (Figures 5A,B).

Figure 5

Cell-Envelope Charge and LPS/SP Quantification

Determination of the net charge associated with the cell envelope showed a positive charge increase in the COL-R strains compared with their susceptible parent strain (Figure 6). A reduction in surface polysaccharide (SP) amount was displayed in 1-R, and less conspicuously in 2-R, whilst a LPS slight reduction occurred in both COL-R strains, although more evident in 2-R. However, these differences were not statistically significant (Table 5).

Figure 6

Table 5

StrainSP amount ± SD (μg/mL)LPS amount ± SD (μg/mL)
1-S144.84 ± 43.696298.40 ± 1267.04
1-R71.770 ± 31.866002.95 ± 1178.74
2-S178.38 ± 65.246003.80 ± 3717.05
2-R124.54 ± 58.795184.77 ± 2526.66
COL-S A. baumannii
ATCC 19606
170.69 ± 51.675843.86 ± 1102.01

Surface attached polysaccharide (indirect) and LPS (direct) quantification.

Discussion

A. baumannii is representative of the current public health crisis caused by the growing burden of infections associated with organisms that are resistant to most, if not all, antimicrobial agents. This species has proven to be particularly challenging because of its capacity to: (a) persist in hospital environments, (b) become resistant to antimicrobials and disinfectants, and (c) acquire new resistance determinants.

Two main colistin resistance mechanisms have been described in Ab. The first category consists of mutations in the PmrAB two-component regulatory system resulting in lipid A modification (Adams et al., 2009; Beceiro et al., 2011). The second category of resistance mechanisms evoke mutations or disruptions in genes encoding lipid A biosynthesis such as lpxA, lpxC, and lpxD, conferring the complete loss of LPS (Moffatt et al., 2010, 2011). In response to antibiotic pressure and its withdrawal, the pmr-locus can also go through mutational pathways determining, firstly, colistin resistance and, then, its loss together with a reduced probability to reacquire colistin resistance for the acquisition of compensatory inactivating pmr-mutations (Snitkin et al., 2013). Even though Pmr-locus mutations may not confer reduction in fitness, growth alteration, and virulence, an increase in growth retardation, reduced virulence and lower invasiveness in COL-R Ab isolates were also described (Andersson and Hughes, 2010; López-Rojas et al., 2013; Beceiro et al., 2014; Pournaras et al., 2014; Durante-Mangoni et al., 2015). Furthermore, adaptations to colistin treatment can occur following significant changes in physiological processes (Jawad et al., 1998; Dorsey et al., 2004; López-Rojas et al., 2011).

Recently, genome analysis at the population-level on MDR Ab, revealed new insights into their transmission and evolutionary dynamics during long-term infection demonstrating that the over-represented mutations acquired during infection were in transcriptional regulators, notably pmrAB and adeRS, mediating the resistance to colistin and tigecycline as well as transporters, surface structures, and iron acquisition genes (Wright et al., 2016).

Our analysis allowed a multi-level discovery of the genomics and transcriptomics COL-R Ab signatures.

The four Ab strains analyzed in this study were XDR isolates showing the same genomic macrorestriction profile A, belonged to the same Oxford University ST-281 and to Global Clone II, and with a very similar acquired resistome. This resemblance underline a genetic high similarity due to closely related genomes and phylogeny of our sample reflecting a transmission of specific phylogenetic strain clusters, strongly related also to Ab ACICU and Ab ATCC 17978 reference strains. This observation was further supported by the strong phylogenetic genomic correlation found between the two COL-S strains, sharing only 23 cSNP differences, whilst a high genomic diversity was recovered between the two COL-R Ab strains (81 cSNP differences) indicating that the acquisition of colistin resistance gain a high rate of genomic diversification respect to the COL-S parent strains.

In addition, all these considerations suggest that colistin resistance emerges in clinical settings from colistin susceptible strains going through the acquisition of new traits in agreement with recent observations (Mustapha et al., 2018) and our findings.

The whole genome sequencing and its SNP calling detected, in fact, common gSNPs in both COL-R strains vs. susceptible ones mapped on Ab ATCC 17978 and Ab ACICU. COL-R Ab accumulated several different nsSNPs, also associated to synonymous ones, in specific loci or distinct genes. Among these, we would like to highlight those affected proteins involved in COL-R mechanisms, i.e. A1S_2024/ACICU_01043 glutamate-5-kinase and A1S_2928 hypothetical protein previously associated with the intrinsic colistin resistance involved in resistance mechanisms (Olaitan et al., 2014), A1S_2928 related to the inducible colistin tolerance in response to physiologic concentrations of monovalent cations, that mediate osmotolerance-modulating pathways involved in compatible solute, cell envelope biosynthesis and protein folding (Hood et al., 2010), with a conserved domain similar to the stress-responsive protein Ish1 in yeast of the ACICU_02735, speculatively, indicating an involvement of adaptive mechanism in response to stress as colistin selective pressure. As regards the SNPs falling in genes non-directly related to COL-R, such as FilD and BenP porins along with A1S_2443 and ACICU_02910 surface adhesion proteins, we can speculate that these SNPs could affect different properties conditioning indirectly adaptation mechanisms of resistant strains through unknown pathways connecting drug-resistance and the accumulation of genetic mutations.

Conversely, synonymous SNPs that do not change the amino acid sequence in protein-encoding genes, because of genetic code redundancy, could impact translation efficiency and the amount of produced protein (Chaney and Clark, 2015), whilst SNPs that occur in non-coding regions are likely able to modify transcription factor binding or non-coding RNA sequences, this is understandable especially when located in promoter regions (Chaney and Clark, 2015).

To better investigate the transcriptomic profiling of COL-R vs. COL-S Ab strain pairs, we used two different libraries (single-end and paired-end with insert reads of different size) in the analysis of biological replicates, in order to minimize the biases due to the complexity of the RNA-seq procedures and algorithms for the processing of RNA-seq “big data”.

Comparative transcriptomic pairwise analysis highlighted a strain-dependent response to the colistin resistance onset highly variable among COL-R isolates, on the contrary the filtering of DEGs sorting for the COL-R common traits showed transcriptional changes consisting of seven common over-expressed genes in both COL-R Ab strains, representing the mRNA signatures of our COL-R Ab. In detail, we recorded an increased pgaB mRNA, for an outer membrane lipoprotein responsible for the N-deacetylation of PGA - a surface adhesin polysaccharide - in agreement with findings by other authors (Eijkelkamp et al., 2014). The pgaB over-expression increased the primary amine content (glucosamine of PGA via PGA deacetylation) promoting their export through a PgaA porin (A1S_0938) associated with biofilm formation (Choi et al., 2009). The consequent positively charged PNAG can indirectly inhibit the activity of cationic colistin on LPS. In addition, polysaccharide deacetylase was related to cell-wall modification (Ramazzina et al., 2008) and it can modulate the uptake of antibiotics, including colistin. Hence, a glycosyltransferase (PNAG deacetylase) could be part of an interaction network affecting the outer membrane and cell-wall integrity, giving a further contribution to the colistin resistance in Ab (Park et al., 2015).

Regarding the over-expressed A1S_2027 mRNA, this signature suggests that COL-R Ab isolates are distinguished by an induction of the transcriptional response to DNA damage related to the acquisition of antibiotic resistance and, thus, to their Multi-Drug-Resistance (Hare et al., 2014). Although it was not possible to determine the A1S_2027 precise structure and functionality, we found that it was previously described as a hypothetical phage protein involved in the complex network of A. baumannii and A. baylyi DNA damage response regulated by recA. Furthermore, Norton et al. (2013) demonstrated that the DNA damage response increases mutagenesis and it is one of the mechanisms used by Ab to acquire antibiotic resistance under clinically relevant DNA-damaging conditions (Hua et al., 2017).

The over-expressed A1S_2230/ACICU_02436 mRNA, according to the results of a proteome study (Mussi et al., 2010), may be a signature related to the light response of COL-R Ab, also related to their TGC susceptibility. For this mRNA, the computational predictions found similarity with a protein of a photoreaction center of the photosynthesis characterized in Rhodobacter sphaeroides. Surprisingly, we found that in the genome of Ab ATCC 17978, the A1S_2230 tag is located near A1S_2225, previously described as encoding the BlsA (blue-light-sensing A) A. baumannii photoreceptor protein. Mussi et al. (2010) demonstrated that A. baumannii senses and responds to blue light. These bacterial responses depended on the expression of the Ab ATCC 17978 A1S_2225 gene named blue-light-sensing A (blsA). The light modulated motility and biofilm formation (Ramírez et al., 2015a), more precisely motility and formation of biofilms and pellicles, were observed only when bacterial cells were incubated in darkness. Furthermore, the same authors demonstrated that susceptibility to minocycline and tigecycline, two antibiotics used for the treatment of MDR A. baumannii infections, was modulated by light (Ramírez et al., 2015b). Beyond susceptibility to antibiotics, this response to light might enhance the ability of the bacterium to persist until conditions are more favorable for growth or accumulation of additional resistance determinants, directly impacting the microorganism's ability to persist in the environment.

Regarding the over-expressed non-ribosomal peptide synthetase module A1S_2651, in agreement to previous findings (Dwyer et al., 2009; Adler et al., 2012; Wright et al., 2017), this typical COL-R trait could be related to a high biosynthesis of a siderophore for iron coordination implicated in protection from reactive oxygen species (ROS), by chelating free iron, and in the protection of oxidative stress.

As regards the over-expression of ACICU_02907 encoding a diacylglycerol kinase (DAGK), a small integral membrane protein (Smith et al., 1994), this transcriptomic trait evidenced that COL-R Ab have an increased recycle of diacylglycerol (DAG), by-product of membrane-derived oligosaccharide biosynthesis (Walsh and Bell, 1992), in phospholipids in the cell. This metabolic adaptation was previously related to the integrity of the cell membrane and aided colistin resistance although with an unknown mechanism. Furthermore, if the amount of DAG in the lipid bilayer becomes too high, cells lose their ability to proliferate in mildly stressful environments (Badola and Sanders, 1997). Furthermore, the over-expressed ACICU_01518 hypothetical protein of unknown function was previously found with an increased expression in COL-R laboratory-derived strains under in vitro colistin selection (Park et al., 2015).

The up-regulation of lipid A phosphoethanolamine transferase PmrC - likely in association with pmrB SNPs-, evidenced by RNA-seq as well as in exponential and mid-log growth-phase real time qPCR data, strongly supports its key role in COL-resistance in Ab due to a lipid A phosphoethanolamine modification that determines a change in the cell surface charge responsible for a repulsion between positive colistin and the more positively charged phosphoethanolamine-modified LPS. These results, in agreement with previous findings (Arroyo et al., 2011; Lim et al., 2015; Choi et al., 2017), demonstrated that specific alterations in pmrCAB, such as the PmrB L208F or R263H in histidine kinase domain along with the firstly found L340 in the PmrC sulfatase domain, are responsible for an increase of colistin MIC and associated with pmrBC over-expression and polymyxin resistance in our A. baumannii.

Regarding the colistin resistance mechanisms mediated by lpx-cluster, previously described by other authors in “in vitro-derived” mutants (Moffatt et al., 2010), for the first time the involvement of lpxC and lpxD nsSNPs was demonstrated in a clinical COL-R Ab. In detail, we found a S171Y AA substitution in the phosphoethanolamine transferase N-terminal LpxC domain and a S292 in the LpxD UDP-3-O-(3-hydroxymyristoyl) Glucosamine N-acyltransferase domain generating a premature stop codon. These results suggested either that a LpxD premature stop codon at the 292 AA did not entirely affect LpxD functionality and LPS biosynthesis, or that a functional LpxD could be not required for LPS biosynthesis in our clinical COL-R Ab. Anyhow, this LpxD condition, together with the under-expression in the S171Y modified-LpxC transcript and lpxA, could explain at least theoretically the decreased LPS amount displayed in this strain. In addition, more in general, our data on lpxACD support the relation between lpx-nsSNP occurrence and under-expression with the colistin-resistance onset in Ab strains.

In conclusion, genomic and transcriptomic signatures of COL-R vs. COL-S Ab strains revealed main and secondary accessory traits, reflecting the complexity of these microorganisms in the continuous balance between their antimicrobial resistance and virulence that interplay for the survival in the host under antimicrobial pressure.

Our study defined nsSNPs hotspots and transcriptomic traits correlating to the colistin resistance onset and demonstrated the involvement of many adaptation features occurring in loci indirectly related to the antibiotic resistance. It seems being clear that becoming COL-R is a complex event in which LPS as a target is involved, but it is not the exclusive one. Indeed, new signatures and indirect pathways are also implicated.

Statements

Author contributions

VC and SS conceived and designed the study. VC, SStr, FL, and GG performed the Genomics, Transcriptomics, real time qPCR and bioinformatics. MM and CC performed the MICs and Molecular Typing. GP and AF contributed to the bioinformatics analysis. All authors analyzed the data and contributed to the manuscript.

Funding

This work was partially supported by a research grant DIAMOND HV PO-FESR 2007-2013 from MIUR Italy. This study was supported by 2016/2018 Department Research Plan of University of Catania (2nd line of intervention).

Acknowledgments

A preliminary part of this work was presented at the ICAAC/ICC2015 Congress, September 17–21, 2015 San Diego, CA, USA.

We wish to thank the Scientific Bureau of the University of Catania (Italy) for language support services.

Conflict of interest

The authors declare that the research was conducted in the absence of any commercial or financial relationships that could be construed as a potential conflict of interest.

Supplementary material

The Supplementary Material for this article can be found online at: https://www.frontiersin.org/articles/10.3389/fmicb.2018.03195/full#supplementary-material

References

  • 1

    AdamsM. D.NickelG. C.BajaksouzianS.LavenderH.MurthyA. R.JacobsM. R.et al. (2009). Resistance to colistin in Acinetobacter baumannii associated with mutations in the PmrAB two-component system. Antimicrob. Agents Chemother. 53, 36283634. 10.1128/AAC.00284-09

  • 2

    AdlerC.CorbalánN. S.SeyedsayamdostM. R.PomaresM. F.de CristóbalR. E.ClardyJ.et al. (2012). Catecholate siderophores protect bacteria from pyochelin toxicity. PLoS ONE7:e46754. 10.1371/journal.pone.0046754

  • 3

    AnderssonD. I.HughesD. (2010). Antibiotic resistance and its cost: is it possible to reverse resistance?Nat Rev Microbiol. 8, 260271. 10.1038/nrmicro2319

  • 4

    ArroyoL. A.HerreraC. M.FernandezL.HankinsJ. V.TrentM. S.HancockR. E. (2011). The pmrCAB operon mediates polymyxin resistance in Acinetobacter baumannii ATCC 17978 and clinical isolates through phosphoethanolamine modification of lipid A. Antimicrob. Agents Hemother. 55, 37433751. 10.1128/AAC.00256-11

  • 5

    BadolaP.SandersC. (1997). Escherichia coli Diacylglycerol kinase is an evolutionarily optimized membrane enzyme and catalyzes direct phosphoryl transfer. J. Biol. Chem. 272, 2417624182. 10.1074/jbc.272.39.24176

  • 6

    BeceiroA.LlobetE.ArandaJ.BengoecheaJ. A.DoumithM.HorsneyM.et al. (2011). Phosphoethanolamine modification of lipid A in colistin-resistant variants of Acinetobacter baumannii mediated by the pmrAB two-component regulatory system. Antimicrob. Agents Chemother. 55, 33703379. 10.1128/AAC.00079-11

  • 7

    BeceiroA.MorenoA.FernándezN.VallejoJ. A.ArandaJ.AdlerB.et al. (2014). Biological cost of different mechanisms of colistin resistance and their impact on virulence in Acinetobacter baumannii. Antimicrob. Agents Chemother. 58, 518526. 10.1128/AAC.01597-13

  • 8

    BertelsF.SilanderO. K.PachkovM.RaineyP. B.van NimwegenE. (2014). Automated reconstruction of whole-genome phylogenies from short-sequence reads. Mol. Biol. Evol. 31, 10771088. 10.1093/molbev/msu088

  • 9

    BrimacombeC. A.BeattyJ. T. (2013). Surface polysaccharide extraction and quantification. Bio Protocol3:e934. 10.21769/BioProtoc.934

  • 10

    CafisoV.BertuccioT.PurrelloS.CampanileF.MamminaC.SartorA.et al. (2014). dltA overexpression: a strain-independent keystone of daptomycin resistance in methicillin-resistant Staphylococcus aureus. Int. J. Antimicrob. Agents. 43, 2631. 10.1016/j.ijantimicag.2013.10.001

  • 11

    CafisoV.BertuccioT.SpinaD.PurrelloS.CampanileF.Di PietroC.et al. (2012). Modulating activity of vancomycin and daptomycin on the expression of autolysis cell-wall turnover and membrane charge genes in hVISA and VISA strains. PLoS ONE7:e29573. 10.1371/journal.pone.0029573

  • 12

    CaiY.ChaiD.WangR.LiangB.BaiN. (2012). Colistin resistance of Acinetobacter baumannii: clinical reports, mechanisms and antimicrobial strategies. J. Antimicrob. Chemother. 67, 16071615. 10.1093/jac/dks084

  • 13

    ChaneyJ. L.ClarkP. L. (2015). Roles for synonymous codon usage in protein biogenesis. Annu. Rev. Biophys. 44, 143166. 10.1146/annurev-biophys-060414-034333

  • 14

    CheahS. E.JohnsonM. D.ZhuY.TsujiB. T.ForrestA.BulittaJ. B.et al. (2016). Polymyxin Resistance in Acinetobacter baumannii: genetic mutations and transcriptomic changes in response to clinically relevant dosage regimens. Sci. Rep.6:26233. 10.1038/srep26233

  • 15

    ChoiA. H.SlamtiL.AvciF. Y.PierG. B.Maira-LitránT. (2009). The pgaABCD locus of Acinetobacter baumannii encodes the production of poly-beta-1-6-N-acetylglucosamine, which is critical for biofilm formation. J. Bacteriol. 191, 59535963. 10.1128/JB.00647-09

  • 16

    ChoiH. J.KilM. C.ChoiJ. Y.KimS. J.ParkK. S.KimY. J.et al. (2017). Characterisation of successive Acinetobacter baumannii isolates from a deceased haemophagocytic lymphohistiocytosis patient. Int. J. Antimicrob. Agents. 49, 102106. 10.1016/j.ijantimicag.2016.09.024

  • 17

    DorseyC. W.TomarasA. P.ConnerlyP. L.TolmaskyM. E.CrosaJ. H.ActisL. A. (2004). The siderophore-mediated iron acquisition systems of Acinetobacter baumannii ATCC 19606 and Vibrio anguillarum 775 are structurally and functionally related. Microbiology150(Pt 11), 36573667. 10.1099/mic.0.27371-0

  • 18

    Durante-MangoniE.Del FrancoM.AndiniR.BernardoM.GiannouliM. (2015). Emergence of colistin resistance without loss of fitness and virulence after prolonged colistin administration in a patient with extensively drug-resistant Acinetobacter baumannii. Diagn. Microbiol. Infect. Dis. 82, 222226. 10.1016/j.diagmicrobio.2015.03.013

  • 19

    Durante-MangoniE.UtiliR.ZarrilliR. (2014). Combination therapy in severe Acinetobacter baumannii infections: an update on the evidence to date. Future Microbiol. 9, 773789. 10.2217/fmb.14.34

  • 20

    DwyerD. J.KohanskiM. A.CollinsJ. J. (2009). Role of reactive oxygen species in antibiotic action and resistance. Curr. Opin. Microbiol. 12, 482489. 10.1016/j.mib.2009.06.018

  • 21

    EijkelkampB. A.StroeherU. H.HassanK. A.PaulsenI. T.BrownM. H. (2014). Comparative analysis of surface-exposed virulence factors of Acinetobacter baumannii. BMC Genomics. 25:1020. 10.1186/1471-2164-15-1020

  • 22

    FalagasM. E.RafailidisP. I.MatthaiouD. K. (2010). Resistance to polymyxins: mechanisms, frequency and treatment options. Drug Resist. Updat. 13, 132138. 10.1016/j.drup.2010.05.002

  • 23

    GalesA. C.JonesR. N.SaderH. S. (2011). Contemporary activity of colistin and polymyxin B against a worldwide collection of gram-negative pathogens: results from the SENTRY antimicrobial surveillance program (2006–09). J. Antimicrob. Chemother. 66, 20702074. 10.1093/jac/dkr239

  • 24

    HancockR. E.ChappleD. S. (1999). Peptide antibiotics. Antimicrob. Agents Chemother. 43, 13171323. 10.1128/AAC.43.6.1317

  • 25

    HareJ. M.FerrellJ. C.WitkowskiT. A.GriceA. N. (2014). Prophage induction and differential RecA and UmuDAb transcriptome regulation in the DNA damage responses of Acinetobacter baumannii and Acinetobacter baylyi. PLoS ONE. 9:e93861. 10.1371/journal.pone.0093861

  • 26

    HenryR.VithanageN.HarrisonP.SeemannT.CouttsS.MoffattJ. H.et al. (2012). Colistin-Resistant, Lipopolysaccharide-Deficient Acinetobacter baumannii Responds to Lipopolysaccharide Loss through Increased Expression of Genes Involved in the Synthesis and Transport of Lipoproteins, Phospholipids, and Poly-β-1,6-N-Acetylglucosamine. Antimicrob. Agents Chemother. 56, 5969. 10.1128/AAC.05191-11

  • 27

    HoodM. I.BeckerK. W.RouxC. M.DunmanP. M.SkaarE. P. (2013). Genetic determinants of intrinsic colistin tolerance in Acinetobacter baumannii. Infect Immun. 81, 542551. 10.1128/IAI.00704-12

  • 28

    HoodM. I.JacobsA. C.SayoodK.DunmanP. M.SkaarE. P. (2010). Acinetobacter baumannii increases tolerance to antibiotics in response to monovalent cations. Antimicrob. Agents Chemother. 54, 10291041. 10.1128/AAC.00963-09

  • 29

    HuaX.LiuL.FangY.ShiQ.LiX.ChenQ.et al. (2017). Colistin resistance in Acinetobacter baumannii MDR-ZJ06 revealed by a multiomics approach. Front. Cell Infect. Microbiol. 22:45. 10.3389/fcimb.2017.00045

  • 30

    HuangD. W.ShermanB. T.LempickiR. A. (2009a). Bioinformatics enrichment tools: paths toward the comprehensive functional analysis of large gene lists. Nucleic Acids Res. 37, 113. 10.1093/nar/gkn923

  • 31

    HuangD. W.ShermanB. T.LempickiR. A. (2009b). Systematic and integrative analysis of large gene lists using DAVID Bioinformatics Resources. Nature Protoc. 4, 4457. 10.1038/nprot.2008.211

  • 32

    JawadA.SeifertH.SnellingA. M.HeritageJ.HawkeyP. M. (1998). Survival of Acinetobacter baumannii on dry surfaces: comparison of outbreak and sporadic isolates. J. Clin. Microbiol. 36, 19381941.

  • 33

    KaasR. S.LeekitcharoenphonP.AarestrupF. M.LundO. (2014). Solving the problem of comparing whole bacterial genomes across different sequencing platforms. PLoS ONE9:e104984. 10.1371/journal.pone.0104984

  • 34

    KoK. S.SuhJ. Y.KwonK. T.JungS. I.ParkK. H.KangC. I.et al. (2007). High rates of resistance to colistin and polymyxin B in subgroups of Acinetobacter baumannii isolates from Korea. J Antimicrob Chemother. 60, 11631167. 10.1093/jac/dkm305

  • 35

    LarsenM. V.CosentinoS.RasmussenS.FriisC.HasmanH.MarvigR. L.et al. (2012). Multilocus sequence typing of total genome sequenced bacteria. Clin. Micobiol. 50, 13551361. 10.1128/JCM.06094-11

  • 36

    LiJ.RaynerC. R.NationR. L.OwenR. J.SpelmanD.TanK. E.et al. (2006). Heteroresistance to colistin in multidrug-resistant Acinetobacter baumannii. Antimicrob. Agents Chemother. 50, 29462950. 10.1128/AAC.00103-06

  • 37

    LimT. P.OngR. T.HonP. Y.HawkeyJ.HoltK. E. Kohet al. (2015). Multiple genetic mutations associated with polymyxin resistance in Acinetobacter baumannii. Antimicrob. Agents Chemother. 59, 78997902. 10.1128/AAC.01884-15

  • 38

    López-RojasR.Jimenez-MejiasM. E.LepeJ. A.PachonJ. (2011). Acinetobacter baumannii resistant to colistin alters its antibiotic resistance profile: a case report from Spain. J. Infect. Dis. 204, 11471148. 10.1093/infdis/jir476

  • 39

    López-RojasR.McConnellM. J.Jiménez-MejíasM. E.Domínguez-HerreraJ.Fernández-CuencaF.PachónJ. (2013). Colistin resistance in a clinical Acinetobacter baumannii strain appearing after colistin treatment: effect on virulence and bacterial fitness. Antimicrob. Agents Chemother. 57, 45874589. 10.1128/AAC.00543-13

  • 40

    MagiorakosA. P.SrinivasanA.CareyR. B.CarmeliY.FalagasM. E.GiskeC. G.et al. (2012). Multidrug-resistant, extensively drug-resistant and pandrug-resistant bacteria: an international expert proposal for interim standard definitions for acquired resistance. Clin. Microbiol. Infect. 18, 268281. 10.1111/j.1469-0691.2011.03570.x

  • 41

    McClureR.BalasubramanianD.SunY.BobrovskyyM.SumbyP.GencoC. A.et al. (2013). Computational analysis of bacterial RNA-seq data. Nucleic Acids Res. 41:e140. 10.1093/nar/gkt444

  • 42

    MezzatestaM. L.D'AndreaM. M.MigliavaccaR.GianiT.GonaF.NucleoE.et al. (2012). Epidemiological characterization and distribution of carbapenem-resistant Acinetobacter baumannii clinical isolates in Italy. Clin. Microbiol. Infect. 18, 160166. 10.1111/j.1469-0691.2011.03527.x

  • 43

    MoffattJ. H.HarperM.AdlerB.NationR. L.LiJ.BoyceJ. D. (2011). Insertion sequence ISAba1 is involved in colistin resistance and loss of lipolysaccharide in Acinetobacter baumannii. Antimicrob. Agents Chemother. 55, 30223024. 10.1128/AAC.01732-10

  • 44

    MoffattJ. H.HarperM.HarrisonP.HaleJ. D.VinogradovE.SeemannT.et al. (2010). Colistin resistance in Acinetobacter baumannii is mediated by complete loss of lipopolysaccharide production. Antimicrob. Agents Chemother. 54, 49714977. 10.1128/AAC.00834-10

  • 45

    MussiM. A.GaddyJ. A.CabrujaM.ArivettB. A.VialeA. M.RasiaR.et al. (2010). The opportunistic human pathogen Acinetobacter baumannii senses and responds to light. J. Bacteriol. 192, 63366345. 10.1128/JB.00917-10

  • 46

    MustaphaM. M.LiB.PaceyM. P.MettusR. T.McElhenyC. L.MarshallC. W.et al. (2018). Phylogenomics of colistin-susceptible and resistant XDR Acinetobacter baumannii. J. Antimicrob. Chemother. 73, 29522959. 10.1093/jac/dky290

  • 47

    NortonM. D.SpilkiaA. J.GodoyV. G. (2013). Antibiotic resistance acquired through a DNA damage-inducible response in Acinetobacter baumannii. J. Bacteriol. 195, 13351345. 10.1128/JB.02176-12

  • 48

    OlaitanA. O.MorandS.RolainJ. M. (2014). Mechanisms of polymyxin resistance: acquired and intrinsic resistance in bacteria. Front. Microbiol. 5:643. 10.3389/fmicb.2014.00643

  • 49

    ParkY. K.LeeJ. Y.KoK. S. (2015). Transcriptomic analysis of colistin-susceptible and colistin-resistant isolates identifies genes associated with colistin resistance in Acinetobacter baumannii. Clin. Microbiol. Infect. 21, 765.e17. 10.1016/j.cmi.2015.04.009

  • 50

    PfafflM. W.HorganG. W.DempfleL. (2002). Relative expression software tool (REST) for group-wise comparison and statistical analysis of relative expression results in real-time PCR. Nucleic Acids Res. 30:e36. 10.1093/nar/30.9.e36

  • 51

    PournarasS.PoulouA.DafopoulouK.ChabaneY. N.KristoI.MakrisD.et al. (2014). Growth retardation, reduced invasiveness, and impaired colistin-mediated cell death associated with colistin resistance development in Acinetobacter baumannii. Antimicrob. Agents Chemother. 58, 828832. 10.1128/AAC.01439-13

  • 52

    RamazzinaI.CendronL.FolliC.BerniR.MonteverdiD.ZanottiG.et al. (2008). Logical Identification of an Allantoinase Analog (puuE) recruited from polysaccharide deacetylases. J. Biol. Chem.283:34. 10.1074/jbc.M801195200

  • 53

    RamírezM. S.MüllerG. L.PérezJ. F.GolicA. E.MussiM. A. (2015a). More than just light: clinical relevance of light perception in the nosocomial pathogen Acinetobacter baumannii and other members of the genus acinetobacter. Photochem. Photobiol. 91, 12911301. 10.1111/php.12523

  • 54

    RamírezM. S.TragliaG. M.PérezJ. F.MüllerG. L.MartínezM. F.GolicA. E.et al. (2015b). White and blue light induce reduction in susceptibility to minocycline and tigecycline in Acinetobacter spp. and other bacteria of clinical importance. J. Med. Microbiol. 64(Pt 5), 525537. 10.1099/jmm.0.000048

  • 55

    RezaniaS.AmirmozaffariN.TabarraeiB.Jeddi-TehraniM.ZareiO.AlizadehR.et al. (2011). Extraction, purification and characterization of Lipopolysaccharide from Escherichia coli and Salmonella typhi. Avicenna J. Med. Biotechnol. 3, 39.

  • 56

    RoyA.KucukuralA.ZhangY. (2010). I-TASSER: a unified platform for automated protein structure and function prediction. Nat. Protoc. 5, 725738. 10.1038/nprot.2010.5

  • 57

    SmithR. L.O'TooleJ. F.MaguireM. E.SandersC. R. (1994). 2nd Membrane topology of Escherichia coli diacylglycerol kinase. J. Bacteriol. 176:54595465. 10.1128/jb.176.17.5459-5465.1994

  • 58

    SnitkinE. S.ZelaznyA. M.GuptaJ. N. I. S. CComparative Sequencing Program PalmoreT. N.MurrayP. R.et al. (2013). Genomic insights into the fate of colistin resistance and Acinetobacter baumannii during patient treatment. Genome Res. 23, 11551162. 10.1101/gr.154328.112

  • 59

    TjadenB. (2015). De novo assembly of bacterial transcriptomes from RNA-seq data. Genome Biol. 16:1. 10.1186/s13059-014-0572-2

  • 60

    TragliaG. M.ChuaK.CentrónD.TolmaskyM. E.RamírezM. S. (2014). Whole-genome sequence analysis of the naturally competent Acinetobacter baumannii clinical isolate A118. Genome Biol. Evol. 6, 22352239. 10.1093/gbe/evu176

  • 61

    VilaJ.PachónJ. (2012). Therapeutic options for Acinetobacter baumannii infections: an update. Expert Opin. Pharmacother. 13, 23192336. 10.1517/14656566.2012.729820

  • 62

    WalshJ. P.BellR. M. (1992). Diacylglycerol kinase from Escherichia coli. Methods Enzymol. 209, 153162. 10.1016/0076-6879(92)09019-Y

  • 63

    WrightM. S.IovlevaA.JacobsM. R.BonomoR. A.AdamsM. D. (2016). Genome dynamics of multidrug-resistant Acinetobacter baumannii during infection and treatment. Genome Med. 8:26. 10.1186/s13073-016-0279-y

  • 64

    WrightM. S.JacobsM. R.BonomoR. A.AdamsM. D. (2017). Transcriptome remodeling of Acinetobacter baumannii during infection and treatment. mBio78:e0219316. 10.1128/mBio.02193-16

  • 65

    YangS. J.BayerA. S.MishraN. N.MeehlM.LedalaN.YeamanM. R.et al. (2012). The Staphylococcus aureus two-component regulatory system, GraRS, senses and confers resistance to selected cationic antimicrobial peptides. Infect Immun. 80, 7481. 10.1128/IAI.05669-11

  • 66

    YangS. J.KreiswirthB. N.SakoulasG.YeamanM. R.XiongY. Q.SawaA.et al. (2009). Enhanced expression of dltABCD is associated with development of daptomycin non susceptibility in a clinical endocarditis isolate of Staphylococcus aureus. J. Infect. Dis. 200, 19161920. 10.1086/648473

  • 67

    YangS. J.NastC. C.MishraN. N.YeamanM. R.FeyP. D.BayerA. S. (2010). Cell wall thickening is not a universal accompaniment of the daptomycin non susceptibility phenotype in Staphylococcus aureus: evidence for multiple resistance mechanisms. Antimicrob Agents Chemother. 54, 30793085. 10.1128/AAC.00122-10

  • 68

    ZankariE.HasmanH.CosentinoS.VestergaardM.RasmussenS.LundO.et al. (2012). Identification of acquired antimicrobial resistance genes. J. Antimicrob Chemother. 67, 26402644. 10.1093/jac/dks261

  • 69

    ZavasckiA. P.GoldaniL. Z.LiJ.NationR. L. (2007). Polymyxin B for the treatment of multidrug-resistant pathogens: a critical review. J. Antimicrob Chemother. 60, 12061215. 10.1093/jac/dkm357

Summary

Keywords

A. baumannii, colistin-resistance, genomics, transcriptomics, signatures

Citation

Cafiso V, Stracquadanio S, Lo Verde F, Gabriele G, Mezzatesta ML, Caio C, Pigola G, Ferro A and Stefani S (2019) Colistin Resistant A. baumannii: Genomic and Transcriptomic Traits Acquired Under Colistin Therapy. Front. Microbiol. 9:3195. doi: 10.3389/fmicb.2018.03195

Received

23 July 2018

Accepted

10 December 2018

Published

07 January 2019

Volume

9 - 2018

Edited by

Paolo Visca, Università degli Studi Roma Tre, Italy

Reviewed by

Francesco Imperi, Sapienza University of Rome, Italy; Raffaele Zarrilli, University of Naples Federico II, Italy

Updates

Copyright

*Correspondence: Viviana Cafiso

This article was submitted to Antimicrobials, Resistance and Chemotherapy, a section of the journal Frontiers in Microbiology

Disclaimer

All claims expressed in this article are solely those of the authors and do not necessarily represent those of their affiliated organizations, or those of the publisher, the editors and the reviewers. Any product that may be evaluated in this article or claim that may be made by its manufacturer is not guaranteed or endorsed by the publisher.

Outline

Figures

Cite article

Copy to clipboard


Export citation file


Share article

Article metrics